F432291

General Info

Members Datasets Scaffolds Average Seq Length
392 225 784 111

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10248639|Ga0105245_102486392
Length 128
Sequence LRFYKTRAIFPVEAKGEQMGDERLELPQGTLDLLILRTLALGPQHGWAVSERIQQISSDVLQVQQGSLYPSLHRLERRGLVKARWGASDNNRKAKFYELTAAGRKQLDADARSWRKLAGAIAQVLDMA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.63
Rhizosphere 91.58
Stem 0
Stem Tuber 0
Unclassified 26.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10248639 3300009098 Bacteria 1727
2 Ga0065714_10457580 3300005288 Unclassified 516
3 Ga0065715_11010547 3300005293 Unclassified 542
4 Ga0070658_10247117 3300005327 Bacteria 1513
5 Ga0070676_10000417 3300005328 Bacteria 20086
6 Ga0070676_10016432 3300005328 Bacteria 4092
7 Ga0070676_10505361 3300005328 Bacteria 859
8 Ga0070683_100037977 3300005329 Bacteria 4411
9 Ga0070683_101437594 3300005329 Unclassified 663
10 Ga0070690_100048412 3300005330 Bacteria 2707
11 Ga0070690_100217056 3300005330 Bacteria 1338
12 Ga0070670_100004494 3300005331 Bacteria 11687
13 Ga0070670_100102414 3300005331 Bacteria 2466
14 Ga0070670_100919355 3300005331 Unclassified 794
15 Ga0070670_101402882 3300005331 Unclassified 640
16 Ga0068869_100011912 3300005334 Bacteria 5722
17 Ga0070666_10134424 3300005335 Bacteria 1720
18 Ga0070680_100084234 3300005336 Bacteria 2626
19 Ga0070680_100330724 3300005336 Bacteria 1294
20 Ga0070682_100885975 3300005337 Unclassified 732
21 Ga0070682_101313861 3300005337 Unclassified 615
22 Ga0070682_101335739 3300005337 Unclassified 610
23 Ga0068868_100590701 3300005338 Bacteria 983
24 Ga0068868_100610820 3300005338 Bacteria 967
25 Ga0070660_101436847 3300005339 Bacteria 586
26 Ga0070689_101296916 3300005340 Unclassified 656
27 Ga0070687_101179719 3300005343 Unclassified 564
28 Ga0070661_100408709 3300005344 Bacteria 1074
29 Ga0070661_100764936 3300005344 Unclassified 791
30 Ga0070668_100032810 3300005347 Unclassified 3952
31 Ga0070669_100031753 3300005353 Bacteria 3814
32 Ga0070669_100343716 3300005353 Bacteria 1210
33 Ga0070669_100706232 3300005353 Bacteria 852
34 Ga0070674_100000077 3300005356 Bacteria 45192
35 Ga0070673_100071656 3300005364 Bacteria 2785
36 Ga0070673_100225417 3300005364 Unclassified 1624
37 Ga0070673_100506265 3300005364 Bacteria 1093
38 Ga0070667_100012089 3300005367 Bacteria 7147
39 Ga0070667_100211751 3300005367 Bacteria 1723
40 Ga0070667_100311885 3300005367 Bacteria 1418
41 Ga0070703_10273921 3300005406 Unclassified 694
42 Ga0070703_10314392 3300005406 Unclassified 657
43 Ga0070713_100436390 3300005436 Bacteria 1228
44 Ga0070701_10021933 3300005438 Bacteria 3056
45 Ga0070705_100011133 3300005440 Bacteria 4526
46 Ga0070705_100211162 3300005440 Bacteria 1338
47 Ga0070700_100105070 3300005441 Bacteria 1867
48 Ga0070694_100003183 3300005444 Bacteria 9792
49 Ga0070708_100005446 3300005445 Bacteria 10090
50 Ga0070663_100274134 3300005455 Bacteria 1342
51 Ga0070678_100085083 3300005456 Bacteria 2409
52 Ga0070678_100174222 3300005456 Bacteria 1755
53 Ga0070678_100644102 3300005456 Unclassified 950
54 Ga0070662_100000331 3300005457 Bacteria 28399
55 Ga0070681_10514342 3300005458 Bacteria 1110
56 Ga0070681_10946918 3300005458 Unclassified 780
57 Ga0068867_100000532 3300005459 Bacteria 25154
58 Ga0070685_10468552 3300005466 Bacteria 886
59 Ga0070707_101204869 3300005468 Unclassified 723
60 Ga0070679_100046125 3300005530 Bacteria 4343
61 Ga0070684_100105456 3300005535 Unclassified 2522
62 Ga0070684_100169184 3300005535 Unclassified 1985
63 Ga0070697_100005562 3300005536 Bacteria 9714
64 Ga0070697_100318468 3300005536 Bacteria 1339
65 Ga0070697_102082017 3300005536 Unclassified 508
66 Ga0068853_100810310 3300005539 Unclassified 897
67 Ga0068853_101257069 3300005539 Unclassified 715
68 Ga0070672_100089154 3300005543 Bacteria 2485
69 Ga0070672_100100900 3300005543 Bacteria 2341
70 Ga0070686_100033725 3300005544 Bacteria 3148
71 Ga0070686_100299176 3300005544 Bacteria 1193
72 Ga0070686_100757031 3300005544 Unclassified 779
73 Ga0070695_100000779 3300005545 Bacteria 17123
74 Ga0070695_100302997 3300005545 Bacteria 1182
75 Ga0070695_100708155 3300005545 Unclassified 800
76 Ga0070695_101122063 3300005545 Bacteria 644
77 Ga0070696_100006704 3300005546 Bacteria 7694
78 Ga0070693_100058635 3300005547 Bacteria 2229
79 Ga0070665_100015652 3300005548 Bacteria 7619
80 Ga0070665_100436951 3300005548 Bacteria 1318
81 Ga0070704_100016695 3300005549 Bacteria 4646
82 Ga0070704_102085538 3300005549 Bacteria 527
83 Ga0070704_102231766 3300005549 Bacteria 509
84 Ga0068855_100003827 3300005563 Bacteria 18404
85 Ga0068855_100052262 3300005563 Bacteria 4811
86 Ga0070664_100421860 3300005564 Bacteria 1222
87 Ga0068857_100039546 3300005577 Bacteria 4178
88 Ga0068857_101202491 3300005577 Unclassified 734
89 Ga0068857_101237582 3300005577 Unclassified 723
90 Ga0068854_100005489 3300005578 Bacteria 8012
91 Ga0068852_100000003 3300005616 Bacteria 246525
92 Ga0068852_100514870 3300005616 Bacteria 1193
93 Ga0068852_101171948 3300005616 Bacteria 789
94 Ga0068859_100071287 3300005617 Bacteria 3511
95 Ga0068859_100214730 3300005617 Bacteria 2011
96 Ga0068864_100027947 3300005618 Bacteria 4767
97 Ga0068864_100032445 3300005618 Bacteria 4438
98 Ga0068864_100041364 3300005618 Bacteria 3942
99 Ga0068866_10000057 3300005718 Bacteria 43798
100 Ga0068866_10321779 3300005718 Bacteria 973
101 Ga0068866_11198051 3300005718 Unclassified 548
102 Ga0068861_100001288 3300005719 Bacteria 15680
103 Ga0068870_10114062 3300005840 Bacteria 1547
104 Ga0068863_100013051 3300005841 Bacteria 8012
105 Ga0068863_100017782 3300005841 Bacteria 6804
106 Ga0068863_101668590 3300005841 Unclassified 647
107 Ga0068858_100015845 3300005842 Bacteria 7085
108 Ga0068860_100013854 3300005843 Bacteria 7908
109 Ga0068862_100985539 3300005844 Unclassified 833
110 Ga0068862_102224949 3300005844 Unclassified 560
111 Ga0081540_1006023 3300005983 Bacteria 8921
112 Ga0070717_11381733 3300006028 Unclassified 640
113 Ga0097621_100104817 3300006237 Bacteria 2383
114 Ga0097621_100598290 3300006237 Bacteria 1008
115 Ga0068871_100064422 3300006358 Bacteria 3001
116 Ga0075430_100221400 3300006846 Bacteria 1570
117 Ga0075430_100365684 3300006846 Bacteria 1191
118 Ga0075431_101266733 3300006847 Unclassified 699
119 Ga0068865_100003941 3300006881 Bacteria 8911
120 Ga0068865_100263673 3300006881 Bacteria 1365
121 Ga0068865_100379126 3300006881 Bacteria 1153
122 Ga0097620_100071286 3300006931 Bacteria 3511
123 Ga0097620_100214734 3300006931 Bacteria 2011
124 Ga0105240_10000001 3300009093 Bacteria 2887840
125 Ga0105240_10000114 3300009093 Bacteria 166405
126 Ga0105240_11422246 3300009093 Bacteria 729
127 Ga0111539_10809480 3300009094 Unclassified 1090
128 Ga0105245_10195168 3300009098 Bacteria 1941
129 Ga0105245_10590000 3300009098 Bacteria 1136
130 Ga0114129_10300939 3300009147 Bacteria 2138
131 Ga0105243_10005759 3300009148 Bacteria 9620
132 Ga0105243_10799231 3300009148 Bacteria 930
133 Ga0105241_10008130 3300009174 Bacteria 7725
134 Ga0105241_10985107 3300009174 Unclassified 788
135 Ga0105241_12407138 3300009174 Viruses 526
136 Ga0105242_10001533 3300009176 Bacteria 18163
137 Ga0105242_10048307 3300009176 Bacteria 3459
138 Ga0105242_10115758 3300009176 Bacteria 2292
139 Ga0105242_10663448 3300009176 Bacteria 1016
140 Ga0105248_10028621 3300009177 Bacteria 6209
141 Ga0105248_10038415 3300009177 Bacteria 5357
142 Ga0105248_10485897 3300009177 Bacteria 1392
143 Ga0105237_10200830 3300009545 Unclassified 1994
144 Ga0105249_10023166 3300009553 Bacteria 5569
145 Ga0105249_10029712 3300009553 Bacteria 4937
146 Ga0105249_10684878 3300009553 Unclassified 1084
147 Ga0105239_10022351 3300010375 Bacteria 6974
148 Ga0105246_10436430 3300011119 Unclassified 1097
149 Ga0105246_11393949 3300011119 Unclassified 654
150 Ga0157371_10961782 3300013102 Unclassified 650
151 Ga0157370_10000001 3300013104 Bacteria 529517
152 Ga0157370_11812064 3300013104 Bacteria 548
153 Ga0157369_10000066 3300013105 Bacteria 144815
154 Ga0157369_10769123 3300013105 Unclassified 990
155 Ga0157374_10110056 3300013296 Bacteria 2649
156 Ga0157374_10283066 3300013296 Bacteria 1637
157 Ga0157374_11996130 3300013296 Unclassified 606
158 Ga0157378_10000259 3300013297 Bacteria 52043
159 Ga0163162_10013346 3300013306 Bacteria 8023
160 Ga0163162_11032751 3300013306 Bacteria 930
161 Ga0157372_10000038 3300013307 Bacteria 167357
162 Ga0157372_10109298 3300013307 Bacteria 3166
163 Ga0157372_10224186 3300013307 Bacteria 2179
164 Ga0157372_12347470 3300013307 Unclassified 612
165 Ga0157375_10060418 3300013308 Bacteria 3758
166 Ga0157375_10083441 3300013308 Bacteria 3240
167 Ga0157375_10321352 3300013308 Bacteria 1712
168 Ga0157375_10919113 3300013308 Bacteria 1018
169 Ga0163163_10029233 3300014325 Bacteria 5300
170 Ga0163163_10044749 3300014325 Bacteria 4343
171 Ga0157380_10159270 3300014326 Bacteria 1960
172 Ga0157377_11228355 3300014745 Bacteria 582
173 Ga0157379_10065284 3300014968 Bacteria 3254
174 Ga0157379_10132645 3300014968 Bacteria 2242
175 Ga0157376_10123845 3300014969 Bacteria 2295
176 Ga0157376_10283144 3300014969 Bacteria 1562
177 Ga0157376_10682837 3300014969 Bacteria 1030
178 Ga0157376_11254969 3300014969 Unclassified 770
179 Ga0163161_10100482 3300017792 Bacteria 2152
180 Ga0163161_10254588 3300017792 Bacteria 1369
181 Ga0213876_10064886 3300021384 Unclassified 1927
182 Ga0213876_10080668 3300021384 Unclassified 1720
183 Ga0224572_1053393 3300024225 Unclassified 752
184 Ga0207682_10165227 3300025893 Unclassified 1005
185 Ga0207642_10020607 3300025899 Bacteria 2578
186 Ga0207680_10229300 3300025903 Bacteria 1276
187 Ga0207645_10016147 3300025907 Bacteria 4946
188 Ga0207645_10022800 3300025907 Bacteria 4070
189 Ga0207645_10097338 3300025907 Bacteria 1896
190 Ga0207643_10002015 3300025908 Bacteria 11210
191 Ga0207705_10478552 3300025909 Bacteria 966
192 Ga0207684_10005767 3300025910 Bacteria 11364
193 Ga0207654_10069108 3300025911 Bacteria 2092
194 Ga0207707_10610141 3300025912 Unclassified 923
195 Ga0207695_10000001 3300025913 Bacteria 2888630
196 Ga0207695_10000026 3300025913 Bacteria 624558
197 Ga0207671_10215096 3300025914 Unclassified 1504
198 Ga0207663_10324824 3300025916 Bacteria 1157
199 Ga0207660_10082433 3300025917 Bacteria 2366
200 Ga0207660_10090201 3300025917 Unclassified 2271
201 Ga0207660_10288659 3300025917 Bacteria 1304
202 Ga0207662_10091507 3300025918 Bacteria 1872
203 Ga0207657_10496506 3300025919 Bacteria 956
204 Ga0207652_10082059 3300025921 Bacteria 2821
205 Ga0207646_10356282 3300025922 Bacteria 1322
206 Ga0207681_10043687 3300025923 Bacteria 3001
207 Ga0207681_10348689 3300025923 Bacteria 1185
208 Ga0207681_10454935 3300025923 Bacteria 1042
209 Ga0207681_11205465 3300025923 Bacteria 636
210 Ga0207694_11646642 3300025924 Unclassified 540
211 Ga0207650_10020111 3300025925 Bacteria 4703
212 Ga0207650_10956618 3300025925 Bacteria 728
213 Ga0207659_10117409 3300025926 Bacteria 2033
214 Ga0207687_10188250 3300025927 Bacteria 1604
215 Ga0207690_10569871 3300025932 Unclassified 922
216 Ga0207706_10000038 3300025933 Bacteria 132725
217 Ga0207686_10000258 3300025934 Bacteria 40191
218 Ga0207686_10051989 3300025934 Bacteria 2555
219 Ga0207709_10042773 3300025935 Bacteria 2727
220 Ga0207670_10082535 3300025936 Bacteria 2253
221 Ga0207670_10955783 3300025936 Unclassified 719
222 Ga0207669_10001333 3300025937 Bacteria 10508
223 Ga0207704_10010885 3300025938 Bacteria 4457
224 Ga0207704_10171468 3300025938 Bacteria 1557
225 Ga0207704_10288297 3300025938 Bacteria 1251
226 Ga0207704_10348352 3300025938 Bacteria 1152
227 Ga0207691_10119059 3300025940 Bacteria 2342
228 Ga0207691_10120672 3300025940 Bacteria 2324
229 Ga0207691_11259428 3300025940 Unclassified 612
230 Ga0207711_10009611 3300025941 Bacteria 8061
231 Ga0207689_10025485 3300025942 Bacteria 4956
232 Ga0207661_10031538 3300025944 Unclassified 4096
233 Ga0207679_10368875 3300025945 Bacteria 1256
234 Ga0207667_10003936 3300025949 Bacteria 18271
235 Ga0207667_10066182 3300025949 Bacteria 3767
236 Ga0207651_10048119 3300025960 Bacteria 2880
237 Ga0207651_10278463 3300025960 Unclassified 1381
238 Ga0207712_10030619 3300025961 Bacteria 3619
239 Ga0207640_10118019 3300025981 Bacteria 1895
240 Ga0207658_10022280 3300025986 Bacteria 4410
241 Ga0207658_10169442 3300025986 Bacteria 1798
242 Ga0207658_11325072 3300025986 Unclassified 658
243 Ga0207677_10144574 3300026023 Bacteria 1826
244 Ga0207703_10008416 3300026035 Bacteria 8153
245 Ga0207703_10297266 3300026035 Bacteria 1471
246 Ga0207639_10186495 3300026041 Unclassified 1769
247 Ga0207678_10318654 3300026067 Bacteria 1337
248 Ga0207708_10114630 3300026075 Bacteria 2095
249 Ga0207708_10120491 3300026075 Bacteria 2044
250 Ga0207708_10686749 3300026075 Archaea 874
251 Ga0207708_11190054 3300026075 Unclassified 666
252 Ga0207702_11532128 3300026078 Unclassified 660
253 Ga0207641_10009936 3300026088 Bacteria 7832
254 Ga0207641_10846893 3300026088 Unclassified 906
255 Ga0207648_10000036 3300026089 Bacteria 122209
256 Ga0207648_10041025 3300026089 Bacteria 4065
257 Ga0207676_10003929 3300026095 Bacteria 10495
258 Ga0207676_10044410 3300026095 Bacteria 3428
259 Ga0207676_10734664 3300026095 Bacteria 959
260 Ga0207674_10005847 3300026116 Bacteria 14587
261 Ga0207674_10016315 3300026116 Bacteria 8135
262 Ga0207674_10168403 3300026116 Bacteria 2145
263 Ga0207674_11863421 3300026116 Unclassified 568
264 Ga0207675_100130731 3300026118 Bacteria 2381
265 Ga0207683_10007203 3300026121 Bacteria 9535
266 Ga0207683_10378094 3300026121 Unclassified 1302
267 Ga0207698_10000016 3300026142 Bacteria 183355
268 Ga0207698_10505537 3300026142 Bacteria 1177
269 Ga0207698_10522247 3300026142 Bacteria 1159
270 Ga0268265_10243926 3300028380 Bacteria 1587
271 Ga0268264_10010549 3300028381 Bacteria 7639
272 Ga0265338_10961571 3300028800 Bacteria 579
273 Ga0265340_10408147 3300031247 Unclassified 599
274 Ga0265316_10105859 3300031344 Unclassified 2134
275 Ga0265313_10113070 3300031595 Unclassified 1192
276 Ga0307508_10026183 3300031616 Bacteria 5287
277 Ga0373933_0689466 3300035724 Unclassified 672
278 Ga0373937_1467075 3300036401 Bacteria 630
279 Ga0373937_1723049 3300036401 Bacteria 573
280 Ga0395900_0378593 3300037418 Bacteria 1384
281 Ga0395898_0617292 3300037466 Bacteria 1027
282 Ga0436365_0109539 3300039437 Bacteria 7483
283 Ga0436365_0682282 3300039437 Unclassified 2007
284 Ga0436365_1186387 3300039437 Bacteria 1687
285 Ga0436365_1851707 3300039437 Unclassified 4892
286 Ga0436362_1147588 3300039453 Bacteria 5280
287 Ga0439461_0186288 3300041410 Bacteria 552
288 Ga0439435_0007401 3300042436 Bacteria 2510
289 Ga0466963_0029542 3300044694 Bacteria 3530
290 Ga0466959_0402519 3300045049 Unclassified 930
291 Ga0451576_1904078 3300045051 Bacteria 614
292 Ga0466958_0126360 3300045836 Bacteria 1604
293 Ga0466967_0002381 3300045976 Bacteria 11653
294 Ga0495629_0173426 3300046459 Unclassified 1496
295 Ga0495629_0256148 3300046459 Unclassified 1203
296 Ga0495651_0353909 3300046462 Unclassified 970
297 Ga0495580_0118392 3300046472 Bacteria 1839
298 Ga0495580_0510967 3300046472 Bacteria 801
299 Ga0495652_0185720 3300046529 Bacteria 1591
300 Ga0495586_0045431 3300046535 Bacteria 2367
301 Ga0495645_0338714 3300046543 Unclassified 972
302 Ga0495645_0379859 3300046543 Bacteria 904
303 Ga0495635_0501197 3300046663 Unclassified 799
304 Ga0495659_0033620 3300046664 Bacteria 1801
305 Ga0495599_0323748 3300046678 Bacteria 927
306 Ga0495669_0005345 3300046684 Bacteria 5351
307 Ga0495649_0295820 3300046694 Bacteria 825
308 Ga0495674_0203710 3300047319 Bacteria 1641
309 Ga0495602_0384984 3300048088 Bacteria 1004
310 Ga0496100_0648546 3300048903 Bacteria 822
311 Ga0496101_0080686 3300048904 Bacteria 2404
312 Ga0496101_0224223 3300048904 Unclassified 1459
313 Ga0496101_0392738 3300048904 Unclassified 1092
314 Ga0496101_0715171 3300048904 Bacteria 791
315 Ga0496102_1865652 3300048905 Bacteria 518
316 Ga0496103_0262461 3300048906 Bacteria 1111
317 Ga0496104_0083254 3300048907 Bacteria 3051
318 Ga0496105_0372311 3300048908 Unclassified 1138
319 Ga0496106_0179575 3300048909 Bacteria 1680
320 Ga0496106_0790874 3300048909 Bacteria 753
321 Ga0496107_0329500 3300048910 Bacteria 1136
322 Ga0496107_0836682 3300048910 Bacteria 673
323 Ga0496108_0277028 3300048911 Bacteria 1460
324 Ga0496109_0001671 3300048912 Bacteria 18491
325 Ga0496109_0031517 3300048912 Bacteria 4758
326 Ga0496110_0219993 3300048913 Unclassified 1727
327 Ga0496110_0358500 3300048913 Unclassified 1329
328 Ga0496111_0096295 3300048914 Bacteria 2172
329 Ga0496112_0005007 3300048915 Bacteria 11370
330 Ga0496113_0008571 3300048916 Bacteria 6670
331 Ga0496114_0054889 3300048917 Bacteria 3322
332 Ga0496114_0092378 3300048917 Unclassified 2571
333 Ga0496114_0154838 3300048917 Bacteria 1990
334 Ga0496115_0036315 3300048918 Unclassified 3901
335 Ga0496115_0054693 3300048918 Bacteria 3206
336 Ga0501033_0496883 3300049570 Unclassified 844
337 Ga0501036_0104794 3300049572 Bacteria 2391
338 Ga0501036_0247877 3300049572 Unclassified 1493
339 Ga0501037_0249257 3300049573 Unclassified 1243
340 Ga0501038_0052591 3300049574 Bacteria 3511
341 Ga0501038_0154021 3300049574 Bacteria 1873
342 Ga0501040_0265442 3300049576 Unclassified 1225
343 Ga0501040_0458817 3300049576 Unclassified 917
344 Ga0501041_0038032 3300049577 Bacteria 2917
345 Ga0501041_0192114 3300049577 Bacteria 1279
346 Ga0501041_1069433 3300049577 Unclassified 520
347 Ga0501042_0055238 3300049578 Unclassified 2833
348 Ga0501042_0158384 3300049578 Bacteria 1633
349 Ga0501043_0689242 3300049579 Unclassified 747
350 Ga0501046_0147263 3300049580 Bacteria 1778
351 Ga0501046_0173475 3300049580 Bacteria 1617
352 Ga0501046_0618690 3300049580 Unclassified 767
353 Ga0501048_0054989 3300049582 Bacteria 2827
354 Ga0501069_1006882 3300049585 Unclassified 509
355 Ga0501071_0107859 3300049587 Bacteria 2056
356 Ga0501071_0176884 3300049587 Unclassified 1598
357 Ga0501072_0014463 3300049588 Bacteria 6047
358 Ga0501072_0388789 3300049588 Bacteria 1107
359 Ga0501072_0440462 3300049588 Bacteria 1032
360 Ga0501074_0764746 3300049590 Unclassified 681
361 Ga0501074_0896852 3300049590 Unclassified 624
362 Ga0501075_0012797 3300049591 Bacteria 5972
363 Ga0501075_0039583 3300049591 Bacteria 3528
364 Ga0501075_0087804 3300049591 Bacteria 2357
365 Ga0501075_0447897 3300049591 Bacteria 984
366 Ga0501075_1197907 3300049591 Bacteria 576
367 Ga0501076_0023519 3300049592 Bacteria 4751
368 Ga0501076_0040769 3300049592 Bacteria 3650
369 Ga0501076_0069653 3300049592 Bacteria 2811
370 Ga0501076_1210674 3300049592 Bacteria 621
371 Ga0501079_0051555 3300049741 Bacteria 3178
372 Ga0501079_0153846 3300049741 Bacteria 1793
373 Ga0501079_0189489 3300049741 Unclassified 1605
374 Ga0501079_1402700 3300049741 Bacteria 550
375 Ga0501080_0321274 3300049742 Bacteria 1401
376 Ga0501080_1039729 3300049742 Bacteria 709
377 Ga0501081_0031020 3300049743 Bacteria 3622
378 Ga0501081_0234732 3300049743 Unclassified 1337
379 Ga0501081_0268387 3300049743 Bacteria 1248
380 Ga0501035_0407186 3300049822 Unclassified 1131
381 Ga0501045_0023981 3300049824 Bacteria 4379
382 Ga0501045_0066419 3300049824 Bacteria 2648
383 Ga0501045_0256584 3300049824 Unclassified 1301
384 Ga0501045_0865444 3300049824 Unclassified 664
385 nmdc:mga05p37_1864461_c1 3300050507 Unclassified 576
386 nmdc:mga0qj67_512294_c1 3300050509 Bacteria 964
387 nmdc:mga06r32_694813_c1 3300050510 Bacteria 983
388 nmdc:mga0rr50_1197160_c1 3300050513 Bacteria 645
389 nmdc:mga08x19_193180_c1 3300050514 Bacteria 1393
390 Ga0501082_0193075 3300060353 Bacteria 1771
391 Ga0501082_0281260 3300060353 Bacteria 1448
392 Ga0530510_0103364 3300061734 Bacteria 2083
393 Ga0105245_10248639
394 Ga0065714_10457580
395 Ga0065715_11010547
396 Ga0070658_10247117
397 Ga0070676_10000417
398 Ga0070676_10016432
399 Ga0070676_10505361
400 Ga0070683_100037977
401 Ga0070683_101437594
402 Ga0070690_100048412
403 Ga0070690_100217056
404 Ga0070670_100004494
405 Ga0070670_100102414
406 Ga0070670_100919355
407 Ga0070670_101402882
408 Ga0068869_100011912
409 Ga0070666_10134424
410 Ga0070680_100084234
411 Ga0070680_100330724
412 Ga0070682_100885975
413 Ga0070682_101313861
414 Ga0070682_101335739
415 Ga0068868_100590701
416 Ga0068868_100610820
417 Ga0070660_101436847
418 Ga0070689_101296916
419 Ga0070687_101179719
420 Ga0070661_100408709
421 Ga0070661_100764936
422 Ga0070668_100032810
423 Ga0070669_100031753
424 Ga0070669_100343716
425 Ga0070669_100706232
426 Ga0070674_100000077
427 Ga0070673_100071656
428 Ga0070673_100225417
429 Ga0070673_100506265
430 Ga0070667_100012089
431 Ga0070667_100211751
432 Ga0070667_100311885
433 Ga0070703_10273921
434 Ga0070703_10314392
435 Ga0070713_100436390
436 Ga0070701_10021933
437 Ga0070705_100011133
438 Ga0070705_100211162
439 Ga0070700_100105070
440 Ga0070694_100003183
441 Ga0070708_100005446
442 Ga0070663_100274134
443 Ga0070678_100085083
444 Ga0070678_100174222
445 Ga0070678_100644102
446 Ga0070662_100000331
447 Ga0070681_10514342
448 Ga0070681_10946918
449 Ga0068867_100000532
450 Ga0070685_10468552
451 Ga0070707_101204869
452 Ga0070679_100046125
453 Ga0070684_100105456
454 Ga0070684_100169184
455 Ga0070697_100005562
456 Ga0070697_100318468
457 Ga0070697_102082017
458 Ga0068853_100810310
459 Ga0068853_101257069
460 Ga0070672_100089154
461 Ga0070672_100100900
462 Ga0070686_100033725
463 Ga0070686_100299176
464 Ga0070686_100757031
465 Ga0070695_100000779
466 Ga0070695_100302997
467 Ga0070695_100708155
468 Ga0070695_101122063
469 Ga0070696_100006704
470 Ga0070693_100058635
471 Ga0070665_100015652
472 Ga0070665_100436951
473 Ga0070704_100016695
474 Ga0070704_102085538
475 Ga0070704_102231766
476 Ga0068855_100003827
477 Ga0068855_100052262
478 Ga0070664_100421860
479 Ga0068857_100039546
480 Ga0068857_101202491
481 Ga0068857_101237582
482 Ga0068854_100005489
483 Ga0068852_100000003
484 Ga0068852_100514870
485 Ga0068852_101171948
486 Ga0068859_100071287
487 Ga0068859_100214730
488 Ga0068864_100027947
489 Ga0068864_100032445
490 Ga0068864_100041364
491 Ga0068866_10000057
492 Ga0068866_10321779
493 Ga0068866_11198051
494 Ga0068861_100001288
495 Ga0068870_10114062
496 Ga0068863_100013051
497 Ga0068863_100017782
498 Ga0068863_101668590
499 Ga0068858_100015845
500 Ga0068860_100013854
501 Ga0068862_100985539
502 Ga0068862_102224949
503 Ga0081540_1006023
504 Ga0070717_11381733
505 Ga0097621_100104817
506 Ga0097621_100598290
507 Ga0068871_100064422
508 Ga0075430_100221400
509 Ga0075430_100365684
510 Ga0075431_101266733
511 Ga0068865_100003941
512 Ga0068865_100263673
513 Ga0068865_100379126
514 Ga0097620_100071286
515 Ga0097620_100214734
516 Ga0105240_10000001
517 Ga0105240_10000114
518 Ga0105240_11422246
519 Ga0111539_10809480
520 Ga0105245_10195168
521 Ga0105245_10590000
522 Ga0114129_10300939
523 Ga0105243_10005759
524 Ga0105243_10799231
525 Ga0105241_10008130
526 Ga0105241_10985107
527 Ga0105241_12407138
528 Ga0105242_10001533
529 Ga0105242_10048307
530 Ga0105242_10115758
531 Ga0105242_10663448
532 Ga0105248_10028621
533 Ga0105248_10038415
534 Ga0105248_10485897
535 Ga0105237_10200830
536 Ga0105249_10023166
537 Ga0105249_10029712
538 Ga0105249_10684878
539 Ga0105239_10022351
540 Ga0105246_10436430
541 Ga0105246_11393949
542 Ga0157371_10961782
543 Ga0157370_10000001
544 Ga0157370_11812064
545 Ga0157369_10000066
546 Ga0157369_10769123
547 Ga0157374_10110056
548 Ga0157374_10283066
549 Ga0157374_11996130
550 Ga0157378_10000259
551 Ga0163162_10013346
552 Ga0163162_11032751
553 Ga0157372_10000038
554 Ga0157372_10109298
555 Ga0157372_10224186
556 Ga0157372_12347470
557 Ga0157375_10060418
558 Ga0157375_10083441
559 Ga0157375_10321352
560 Ga0157375_10919113
561 Ga0163163_10029233
562 Ga0163163_10044749
563 Ga0157380_10159270
564 Ga0157377_11228355
565 Ga0157379_10065284
566 Ga0157379_10132645
567 Ga0157376_10123845
568 Ga0157376_10283144
569 Ga0157376_10682837
570 Ga0157376_11254969
571 Ga0163161_10100482
572 Ga0163161_10254588
573 Ga0213876_10064886
574 Ga0213876_10080668
575 Ga0224572_1053393
576 Ga0207682_10165227
577 Ga0207642_10020607
578 Ga0207680_10229300
579 Ga0207645_10016147
580 Ga0207645_10022800
581 Ga0207645_10097338
582 Ga0207643_10002015
583 Ga0207705_10478552
584 Ga0207684_10005767
585 Ga0207654_10069108
586 Ga0207707_10610141
587 Ga0207695_10000001
588 Ga0207695_10000026
589 Ga0207671_10215096
590 Ga0207663_10324824
591 Ga0207660_10082433
592 Ga0207660_10090201
593 Ga0207660_10288659
594 Ga0207662_10091507
595 Ga0207657_10496506
596 Ga0207652_10082059
597 Ga0207646_10356282
598 Ga0207681_10043687
599 Ga0207681_10348689
600 Ga0207681_10454935
601 Ga0207681_11205465
602 Ga0207694_11646642
603 Ga0207650_10020111
604 Ga0207650_10956618
605 Ga0207659_10117409
606 Ga0207687_10188250
607 Ga0207690_10569871
608 Ga0207706_10000038
609 Ga0207686_10000258
610 Ga0207686_10051989
611 Ga0207709_10042773
612 Ga0207670_10082535
613 Ga0207670_10955783
614 Ga0207669_10001333
615 Ga0207704_10010885
616 Ga0207704_10171468
617 Ga0207704_10288297
618 Ga0207704_10348352
619 Ga0207691_10119059
620 Ga0207691_10120672
621 Ga0207691_11259428
622 Ga0207711_10009611
623 Ga0207689_10025485
624 Ga0207661_10031538
625 Ga0207679_10368875
626 Ga0207667_10003936
627 Ga0207667_10066182
628 Ga0207651_10048119
629 Ga0207651_10278463
630 Ga0207712_10030619
631 Ga0207640_10118019
632 Ga0207658_10022280
633 Ga0207658_10169442
634 Ga0207658_11325072
635 Ga0207677_10144574
636 Ga0207703_10008416
637 Ga0207703_10297266
638 Ga0207639_10186495
639 Ga0207678_10318654
640 Ga0207708_10114630
641 Ga0207708_10120491
642 Ga0207708_10686749
643 Ga0207708_11190054
644 Ga0207702_11532128
645 Ga0207641_10009936
646 Ga0207641_10846893
647 Ga0207648_10000036
648 Ga0207648_10041025
649 Ga0207676_10003929
650 Ga0207676_10044410
651 Ga0207676_10734664
652 Ga0207674_10005847
653 Ga0207674_10016315
654 Ga0207674_10168403
655 Ga0207674_11863421
656 Ga0207675_100130731
657 Ga0207683_10007203
658 Ga0207683_10378094
659 Ga0207698_10000016
660 Ga0207698_10505537
661 Ga0207698_10522247
662 Ga0268265_10243926
663 Ga0268264_10010549
664 Ga0265338_10961571
665 Ga0265340_10408147
666 Ga0265316_10105859
667 Ga0265313_10113070
668 Ga0307508_10026183
669 Ga0373933_0689466
670 Ga0373937_1467075
671 Ga0373937_1723049
672 Ga0395900_0378593
673 Ga0395898_0617292
674 Ga0436365_0109539
675 Ga0436365_0682282
676 Ga0436365_1186387
677 Ga0436365_1851707
678 Ga0436362_1147588
679 Ga0439461_0186288
680 Ga0439435_0007401
681 Ga0466963_0029542
682 Ga0466959_0402519
683 Ga0451576_1904078
684 Ga0466958_0126360
685 Ga0466967_0002381
686 Ga0495629_0173426
687 Ga0495629_0256148
688 Ga0495651_0353909
689 Ga0495580_0118392
690 Ga0495580_0510967
691 Ga0495652_0185720
692 Ga0495586_0045431
693 Ga0495645_0338714
694 Ga0495645_0379859
695 Ga0495635_0501197
696 Ga0495659_0033620
697 Ga0495599_0323748
698 Ga0495669_0005345
699 Ga0495649_0295820
700 Ga0495674_0203710
701 Ga0495602_0384984
702 Ga0496100_0648546
703 Ga0496101_0080686
704 Ga0496101_0224223
705 Ga0496101_0392738
706 Ga0496101_0715171
707 Ga0496102_1865652
708 Ga0496103_0262461
709 Ga0496104_0083254
710 Ga0496105_0372311
711 Ga0496106_0179575
712 Ga0496106_0790874
713 Ga0496107_0329500
714 Ga0496107_0836682
715 Ga0496108_0277028
716 Ga0496109_0001671
717 Ga0496109_0031517
718 Ga0496110_0219993
719 Ga0496110_0358500
720 Ga0496111_0096295
721 Ga0496112_0005007
722 Ga0496113_0008571
723 Ga0496114_0054889
724 Ga0496114_0092378
725 Ga0496114_0154838
726 Ga0496115_0036315
727 Ga0496115_0054693
728 Ga0501033_0496883
729 Ga0501036_0104794
730 Ga0501036_0247877
731 Ga0501037_0249257
732 Ga0501038_0052591
733 Ga0501038_0154021
734 Ga0501040_0265442
735 Ga0501040_0458817
736 Ga0501041_0038032
737 Ga0501041_0192114
738 Ga0501041_1069433
739 Ga0501042_0055238
740 Ga0501042_0158384
741 Ga0501043_0689242
742 Ga0501046_0147263
743 Ga0501046_0173475
744 Ga0501046_0618690
745 Ga0501048_0054989
746 Ga0501069_1006882
747 Ga0501071_0107859
748 Ga0501071_0176884
749 Ga0501072_0014463
750 Ga0501072_0388789
751 Ga0501072_0440462
752 Ga0501074_0764746
753 Ga0501074_0896852
754 Ga0501075_0012797
755 Ga0501075_0039583
756 Ga0501075_0087804
757 Ga0501075_0447897
758 Ga0501075_1197907
759 Ga0501076_0023519
760 Ga0501076_0040769
761 Ga0501076_0069653
762 Ga0501076_1210674
763 Ga0501079_0051555
764 Ga0501079_0153846
765 Ga0501079_0189489
766 Ga0501079_1402700
767 Ga0501080_0321274
768 Ga0501080_1039729
769 Ga0501081_0031020
770 Ga0501081_0234732
771 Ga0501081_0268387
772 Ga0501035_0407186
773 Ga0501045_0023981
774 Ga0501045_0066419
775 Ga0501045_0256584
776 Ga0501045_0865444
777 nmdc:mga05p37_1864461_c1
778 nmdc:mga0qj67_512294_c1
779 nmdc:mga06r32_694813_c1
780 nmdc:mga0rr50_1197160_c1
781 nmdc:mga08x19_193180_c1
782 Ga0501082_0193075
783 Ga0501082_0281260
784 Ga0530510_0103364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

35

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9459 11 108
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9452 10 109
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9395 10 104
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9306 10 104
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9299 6 109
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9337 10 106 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9306 10 104 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9022 10 110 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8966 13 94 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8917 10 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.9997 10 107
AF-A0A7Y3IAF1-F1-model_v4 PadR family transcriptional regulator 0.998 9 107
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9948 10 88
AF-A0A843TB24-F1-model_v4 PadR family transcriptional regulator 0.994 10 110
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.9937 4 110

Map