F432163

General Info

Members Datasets Scaffolds Average Seq Length
391 226 782 310

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0087168|Ga0501048_0087168_608_1534
Length 308
Sequence MRIVVHGQQAFGKSVLEALLERGEDVVAVYCAPDPKQGGRPDPLKAAALARHLPVYQPRSFRNKPEVWEEFAQLKADLCVMAYVTLFIPEDVLHLPTRGTIQYHPSLLPRHRGPSSINWPIIWGETKTGLTIFWPDNGLDTGPILLQKDVEILDTDTLGSLYFDRLYPLGIAALLEAVDLVRAGKAPKIAQDESQATYEGWCKEEHVQIDWHKPLQEVWNLIRGADPQPGAWTTYDGATVQMYDAKKHVGTTTGRPGEVTAVSEASFTVAAAGGQIEVLRVRPAGGQKISAAAFANSVGLRPGAQLGG

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
225 641522639 Methylobacterium sp. 4-46 Isolate Nodule
226 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.77
Rhizoplane 3.58
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0087168 3300049582 Unclassified 2203
2 rootL2_10125296 3300003322 Bacteria 2633
3 JGI25405J52794_10000958 3300003911 Bacteria 4538
4 Ga0070658_10048699 3300005327 Bacteria 3431
5 Ga0070676_10121156 3300005328 Unclassified 1642
6 Ga0070683_100012827 3300005329 Bacteria 7293
7 Ga0070683_100037715 3300005329 Bacteria 4425
8 Ga0070683_100167275 3300005329 Bacteria 2086
9 Ga0070683_100264673 3300005329 Bacteria 1636
10 Ga0070683_100286550 3300005329 Bacteria 1567
11 Ga0070683_100589953 3300005329 Unclassified 1063
12 Ga0070690_100068020 3300005330 Bacteria 2309
13 Ga0070690_100078285 3300005330 Bacteria 2160
14 Ga0070677_10026125 3300005333 Bacteria 2186
15 Ga0070677_10026749 3300005333 Bacteria 2166
16 Ga0068869_100338606 3300005334 Bacteria 1224
17 Ga0070666_10046817 3300005335 Bacteria 2902
18 Ga0070680_100103534 3300005336 Bacteria 2365
19 Ga0070660_100223321 3300005339 Bacteria 1531
20 Ga0070689_100120556 3300005340 Bacteria 2094
21 Ga0070689_100239939 3300005340 Bacteria 1492
22 Ga0070691_10041032 3300005341 Bacteria 2188
23 Ga0070687_100056375 3300005343 Bacteria 2056
24 Ga0070661_100040304 3300005344 Bacteria 3407
25 Ga0070661_100155275 3300005344 Bacteria 1731
26 Ga0070668_100182166 3300005347 Unclassified 1716
27 Ga0070669_100171504 3300005353 Bacteria 1692
28 Ga0070675_100172987 3300005354 Bacteria 1863
29 Ga0070675_100196781 3300005354 Bacteria 1748
30 Ga0070675_100251280 3300005354 Bacteria 1547
31 Ga0070671_100017025 3300005355 Bacteria 5879
32 Ga0070671_100130534 3300005355 Bacteria 2116
33 Ga0070671_100215692 3300005355 Bacteria 1628
34 Ga0070674_100018935 3300005356 Bacteria 4364
35 Ga0070673_100094796 3300005364 Bacteria 2447
36 Ga0070673_100164075 3300005364 Bacteria 1891
37 Ga0070667_100004739 3300005367 Bacteria 11397
38 Ga0070667_100084677 3300005367 Bacteria 2718
39 Ga0070667_100416974 3300005367 Bacteria 1223
40 Ga0070714_100238710 3300005435 Bacteria 1677
41 Ga0070713_100004137 3300005436 Bacteria 9676
42 Ga0070701_10224175 3300005438 Bacteria 1123
43 Ga0070663_100401327 3300005455 Bacteria 1121
44 Ga0070678_100265264 3300005456 Bacteria 1446
45 Ga0070662_100170561 3300005457 Bacteria 1709
46 Ga0070681_10002526 3300005458 Bacteria 16778
47 Ga0070681_10012370 3300005458 Bacteria 8463
48 Ga0070681_10053127 3300005458 Bacteria 4037
49 Ga0068867_100030484 3300005459 Bacteria 3891
50 Ga0070685_10135063 3300005466 Bacteria 1546
51 Ga0070707_100128622 3300005468 Bacteria 2462
52 Ga0070698_100160529 3300005471 Bacteria 2192
53 Ga0070699_100000195 3300005518 Bacteria 59336
54 Ga0070679_100003096 3300005530 Bacteria 15196
55 Ga0070679_100053163 3300005530 Bacteria 4032
56 Ga0070679_100058113 3300005530 Bacteria 3854
57 Ga0070679_100098082 3300005530 Bacteria 2918
58 Ga0070684_100016361 3300005535 Bacteria 6059
59 Ga0070684_100043795 3300005535 Bacteria 3867
60 Ga0070684_100155975 3300005535 Bacteria 2070
61 Ga0068853_100119026 3300005539 Bacteria 2354
62 Ga0070672_100013572 3300005543 Bacteria 5760
63 Ga0070696_100005502 3300005546 Bacteria 8451
64 Ga0070665_100001205 3300005548 Bacteria 31505
65 Ga0070665_100024359 3300005548 Bacteria 6095
66 Ga0070665_100084072 3300005548 Bacteria 3187
67 Ga0070665_100178973 3300005548 Bacteria 2121
68 Ga0070704_100019208 3300005549 Bacteria 4388
69 Ga0068855_100029800 3300005563 Bacteria 6525
70 Ga0068855_100269299 3300005563 Bacteria 1894
71 Ga0070664_100046943 3300005564 Bacteria 3649
72 Ga0070664_100081770 3300005564 Bacteria 2784
73 Ga0068857_100275297 3300005577 Bacteria 1547
74 Ga0068854_100034379 3300005578 Bacteria 3540
75 Ga0068856_100226430 3300005614 Bacteria 1885
76 Ga0070702_100055513 3300005615 Bacteria 2284
77 Ga0070702_100082750 3300005615 Bacteria 1926
78 Ga0068852_100385398 3300005616 Bacteria 1376
79 Ga0068852_100510560 3300005616 Bacteria 1198
80 Ga0068859_100000344 3300005617 Bacteria 46218
81 Ga0068859_100039124 3300005617 Bacteria 4757
82 Ga0068859_100077172 3300005617 Bacteria 3372
83 Ga0068859_100402032 3300005617 Bacteria 1466
84 Ga0068864_100033614 3300005618 Bacteria 4360
85 Ga0068864_100071368 3300005618 Bacteria 3023
86 Ga0068864_100314776 3300005618 Bacteria 1468
87 Ga0068866_10163082 3300005718 Bacteria 1301
88 Ga0068861_100202027 3300005719 Bacteria 1669
89 Ga0068851_10019042 3300005834 Bacteria 3316
90 Ga0068863_100058099 3300005841 Bacteria 3661
91 Ga0068863_100363303 3300005841 Bacteria 1412
92 Ga0068858_100003154 3300005842 Bacteria 16508
93 Ga0068858_100016245 3300005842 Bacteria 6993
94 Ga0068858_100286145 3300005842 Bacteria 1570
95 Ga0068858_100375525 3300005842 Bacteria 1364
96 Ga0068858_100400076 3300005842 Bacteria 1319
97 Ga0068858_100438930 3300005842 Bacteria 1257
98 Ga0068860_100040765 3300005843 Bacteria 4437
99 Ga0068860_100303637 3300005843 Bacteria 1564
100 Ga0068860_100465348 3300005843 Bacteria 1259
101 Ga0068860_100472791 3300005843 Bacteria 1248
102 Ga0068862_100032098 3300005844 Bacteria 4436
103 Ga0068862_100262910 3300005844 Bacteria 1576
104 Ga0081538_10069335 3300005981 Bacteria 1954
105 Ga0070717_10057260 3300006028 Bacteria 3222
106 Ga0097621_100192038 3300006237 Bacteria 1769
107 Ga0097621_100278655 3300006237 Bacteria 1471
108 Ga0097621_100315418 3300006237 Bacteria 1384
109 Ga0068871_100039252 3300006358 Bacteria 3787
110 Ga0068871_100046421 3300006358 Bacteria 3498
111 Ga0068871_100060294 3300006358 Bacteria 3095
112 Ga0075428_100003862 3300006844 Bacteria 16461
113 Ga0075428_100044128 3300006844 Bacteria 4900
114 Ga0068865_100092789 3300006881 Bacteria 2194
115 Ga0097620_100000344 3300006931 Bacteria 46218
116 Ga0097620_100039123 3300006931 Bacteria 4757
117 Ga0097620_100077172 3300006931 Bacteria 3372
118 Ga0097620_100402029 3300006931 Bacteria 1466
119 Ga0105251_10058933 3300009011 Bacteria 1812
120 Ga0105240_10013075 3300009093 Bacteria 11423
121 Ga0105240_10263484 3300009093 Bacteria 1987
122 Ga0105240_10347455 3300009093 Bacteria 1683
123 Ga0111539_10044890 3300009094 Bacteria 5292
124 Ga0111539_10060218 3300009094 Bacteria 4500
125 Ga0105245_10008915 3300009098 Bacteria 8756
126 Ga0105245_10017852 3300009098 Bacteria 6196
127 Ga0105245_10027705 3300009098 Bacteria 4992
128 Ga0105245_10114821 3300009098 Bacteria 2508
129 Ga0105247_10000392 3300009101 Bacteria 37149
130 Ga0105247_10047046 3300009101 Bacteria 2649
131 Ga0114129_10229957 3300009147 Bacteria 2498
132 Ga0114129_10947825 3300009147 Bacteria 1087
133 Ga0105243_10016899 3300009148 Bacteria 5516
134 Ga0105243_10049516 3300009148 Bacteria 3315
135 Ga0105243_10330867 3300009148 Unclassified 1391
136 Ga0105241_10050369 3300009174 Bacteria 3174
137 Ga0105242_10051071 3300009176 Bacteria 3369
138 Ga0105242_10235105 3300009176 Bacteria 1644
139 Ga0105248_10020106 3300009177 Bacteria 7396
140 Ga0105248_10167060 3300009177 Bacteria 2480
141 Ga0105248_10302235 3300009177 Unclassified 1802
142 Ga0105248_10347935 3300009177 Bacteria 1669
143 Ga0105237_10058318 3300009545 Bacteria 3864
144 Ga0105237_10144355 3300009545 Bacteria 2374
145 Ga0105238_10149558 3300009551 Bacteria 2310
146 Ga0105238_10260788 3300009551 Bacteria 1712
147 Ga0105249_10011847 3300009553 Bacteria 7666
148 Ga0105239_10003375 3300010375 Bacteria 19592
149 Ga0105239_10107947 3300010375 Bacteria 3084
150 Ga0105239_10971932 3300010375 Unclassified 976
151 Ga0105246_10310722 3300011119 Bacteria 1277
152 Ga0105246_10439429 3300011119 Bacteria 1094
153 Ga0157370_10018439 3300013104 Bacteria 7018
154 Ga0157369_10192332 3300013105 Bacteria 2144
155 Ga0157374_10006492 3300013296 Bacteria 9930
156 Ga0157374_10060943 3300013296 Bacteria 3532
157 Ga0157378_10014348 3300013297 Bacteria 6937
158 Ga0163162_10068174 3300013306 Bacteria 3608
159 Ga0163162_10158996 3300013306 Bacteria 2381
160 Ga0163162_10429849 3300013306 Bacteria 1453
161 Ga0163162_10701942 3300013306 Bacteria 1133
162 Ga0157372_10355956 3300013307 Bacteria 1705
163 Ga0157375_10027170 3300013308 Bacteria 5346
164 Ga0157375_10252257 3300013308 Bacteria 1925
165 Ga0157375_10804307 3300013308 Bacteria 1089
166 Ga0163163_10095285 3300014325 Bacteria 2996
167 Ga0163163_10114344 3300014325 Bacteria 2729
168 Ga0163163_10270344 3300014325 Unclassified 1751
169 Ga0163163_10294717 3300014325 Bacteria 1674
170 Ga0157380_10318887 3300014326 Bacteria 1440
171 Ga0182008_10126306 3300014497 Bacteria 1274
172 Ga0157379_10003818 3300014968 Bacteria 12842
173 Ga0157379_10025588 3300014968 Bacteria 5245
174 Ga0157379_10172502 3300014968 Bacteria 1952
175 Ga0157379_10244300 3300014968 Bacteria 1628
176 Ga0157379_10383980 3300014968 Bacteria 1289
177 Ga0157376_10009291 3300014969 Bacteria 7139
178 Ga0157376_10278170 3300014969 Bacteria 1575
179 Ga0163161_10100581 3300017792 Bacteria 2151
180 Ga0213876_10015241 3300021384 Bacteria 4072
181 Ga0213875_10108882 3300021388 Bacteria 1293
182 Ga0207697_10004360 3300025315 Bacteria 6769
183 Ga0207656_10088644 3300025321 Unclassified 1401
184 Ga0207682_10000938 3300025893 Bacteria 13497
185 Ga0207682_10047624 3300025893 Unclassified 1765
186 Ga0207692_10025540 3300025898 Bacteria 2761
187 Ga0207710_10000388 3300025900 Bacteria 29888
188 Ga0207688_10026540 3300025901 Bacteria 3186
189 Ga0207688_10146249 3300025901 Bacteria 1393
190 Ga0207680_10004158 3300025903 Bacteria 6854
191 Ga0207645_10002914 3300025907 Bacteria 13216
192 Ga0207645_10247521 3300025907 Unclassified 1179
193 Ga0207643_10021170 3300025908 Bacteria 3571
194 Ga0207643_10182296 3300025908 Bacteria 1271
195 Ga0207707_10002765 3300025912 Bacteria 15642
196 Ga0207707_10021032 3300025912 Bacteria 5699
197 Ga0207707_10146919 3300025912 Bacteria 2061
198 Ga0207695_10000264 3300025913 Bacteria 132624
199 Ga0207695_10106643 3300025913 Bacteria 2788
200 Ga0207695_10192224 3300025913 Bacteria 1958
201 Ga0207695_10217094 3300025913 Bacteria 1821
202 Ga0207695_10275279 3300025913 Bacteria 1578
203 Ga0207671_10068992 3300025914 Bacteria 2635
204 Ga0207671_10216596 3300025914 Bacteria 1499
205 Ga0207663_10135444 3300025916 Bacteria 1708
206 Ga0207662_10031524 3300025918 Bacteria 3081
207 Ga0207652_10002261 3300025921 Bacteria 16336
208 Ga0207652_10110449 3300025921 Bacteria 2438
209 Ga0207652_10165720 3300025921 Bacteria 1981
210 Ga0207681_10014785 3300025923 Bacteria 4859
211 Ga0207694_10006767 3300025924 Bacteria 8706
212 Ga0207659_10069888 3300025926 Bacteria 2559
213 Ga0207659_10078391 3300025926 Bacteria 2434
214 Ga0207687_10046338 3300025927 Bacteria 3010
215 Ga0207687_10061205 3300025927 Bacteria 2658
216 Ga0207687_10095707 3300025927 Bacteria 2175
217 Ga0207687_10140119 3300025927 Bacteria 1834
218 Ga0207700_10163549 3300025928 Bacteria 1850
219 Ga0207700_10263939 3300025928 Unclassified 1475
220 Ga0207664_10164218 3300025929 Bacteria 1896
221 Ga0207706_10011274 3300025933 Bacteria 8146
222 Ga0207706_10078453 3300025933 Bacteria 2904
223 Ga0207686_10003315 3300025934 Bacteria 8659
224 Ga0207686_10054338 3300025934 Bacteria 2508
225 Ga0207686_10348659 3300025934 Bacteria 1114
226 Ga0207709_10033637 3300025935 Bacteria 3013
227 Ga0207709_10050097 3300025935 Bacteria 2552
228 Ga0207669_10155921 3300025937 Bacteria 1606
229 Ga0207669_10227561 3300025937 Bacteria 1373
230 Ga0207704_10101771 3300025938 Bacteria 1917
231 Ga0207691_10005774 3300025940 Bacteria 11970
232 Ga0207691_10068342 3300025940 Bacteria 3210
233 Ga0207711_10018135 3300025941 Bacteria 5852
234 Ga0207711_10082840 3300025941 Bacteria 2805
235 Ga0207711_10106798 3300025941 Bacteria 2485
236 Ga0207711_10155102 3300025941 Unclassified 2069
237 Ga0207689_10003022 3300025942 Bacteria 15496
238 Ga0207689_10038206 3300025942 Bacteria 3978
239 Ga0207661_10058053 3300025944 Bacteria 3114
240 Ga0207661_10255308 3300025944 Bacteria 1560
241 Ga0207661_10310724 3300025944 Bacteria 1415
242 Ga0207679_10074569 3300025945 Bacteria 2571
243 Ga0207679_10186284 3300025945 Bacteria 1721
244 Ga0207667_10003559 3300025949 Bacteria 19251
245 Ga0207651_10005281 3300025960 Bacteria 6609
246 Ga0207651_10037194 3300025960 Bacteria 3186
247 Ga0207712_10251062 3300025961 Bacteria 1430
248 Ga0207640_10025568 3300025981 Bacteria 3575
249 Ga0207640_10301511 3300025981 Bacteria 1268
250 Ga0207658_10068201 3300025986 Bacteria 2682
251 Ga0207677_10057898 3300026023 Bacteria 2664
252 Ga0207703_10003581 3300026035 Bacteria 12980
253 Ga0207703_10016528 3300026035 Bacteria 5753
254 Ga0207703_10030921 3300026035 Bacteria 4232
255 Ga0207703_10159950 3300026035 Bacteria 1972
256 Ga0207703_10361107 3300026035 Bacteria 1339
257 Ga0207639_10075098 3300026041 Bacteria 2657
258 Ga0207678_10111778 3300026067 Bacteria 2331
259 Ga0207678_10217166 3300026067 Bacteria 1636
260 Ga0207708_10078110 3300026075 Bacteria 2541
261 Ga0207702_10024109 3300026078 Bacteria 5048
262 Ga0207641_10083734 3300026088 Bacteria 2775
263 Ga0207648_10034552 3300026089 Bacteria 4456
264 Ga0207648_10044086 3300026089 Bacteria 3914
265 Ga0207648_10249697 3300026089 Bacteria 1582
266 Ga0207676_10155986 3300026095 Bacteria 1972
267 Ga0207674_10046304 3300026116 Bacteria 4466
268 Ga0207674_10173399 3300026116 Bacteria 2110
269 Ga0207675_100001937 3300026118 Bacteria 20659
270 Ga0207675_100021433 3300026118 Bacteria 6019
271 Ga0207675_100045917 3300026118 Bacteria 4080
272 Ga0207675_100208311 3300026118 Bacteria 1880
273 Ga0207683_10000010 3300026121 Bacteria 150106
274 Ga0207683_10012960 3300026121 Bacteria 7118
275 Ga0207683_10013710 3300026121 Bacteria 6911
276 Ga0207683_10202537 3300026121 Bacteria 1804
277 Ga0207698_10300652 3300026142 Bacteria 1494
278 Ga0209999_1014639 3300027543 Bacteria 1425
279 Ga0207428_10118544 3300027907 Bacteria 2031
280 Ga0207428_10291967 3300027907 Bacteria 1208
281 Ga0268266_10023376 3300028379 Bacteria 5263
282 Ga0268266_10141503 3300028379 Bacteria 2159
283 Ga0268266_10153985 3300028379 Bacteria 2075
284 Ga0268266_10180900 3300028379 Bacteria 1919
285 Ga0268266_10218432 3300028379 Bacteria 1751
286 Ga0268266_10252033 3300028379 Bacteria 1633
287 Ga0268265_10015671 3300028380 Bacteria 5192
288 Ga0268265_10312648 3300028380 Bacteria 1419
289 Ga0268265_10430034 3300028380 Bacteria 1228
290 Ga0268264_10008448 3300028381 Bacteria 8563
291 Ga0268264_10041530 3300028381 Bacteria 3805
292 Ga0265338_10006070 3300028800 Bacteria 15517
293 Ga0307511_10008741 3300030521 Bacteria 10123
294 Ga0265330_10081087 3300031235 Bacteria 1398
295 Ga0265332_10009434 3300031238 Bacteria 4356
296 Ga0265332_10086188 3300031238 Bacteria 1330
297 Ga0265329_10035920 3300031242 Bacteria 1599
298 Ga0265340_10058764 3300031247 Bacteria 1846
299 Ga0265313_10008677 3300031595 Bacteria 6722
300 Ga0316575_10000707 3300031665 Bacteria 9973
301 Ga0316579_10006566 3300031691 Bacteria 4750
302 Ga0265314_10002214 3300031711 Bacteria 20264
303 Ga0265314_10003982 3300031711 Bacteria 13972
304 Ga0265314_10056635 3300031711 Bacteria 2697
305 Ga0265342_10054462 3300031712 Bacteria 2377
306 Ga0307416_100580940 3300032002 Bacteria 1198
307 Ga0316583_10011388 3300032133 Bacteria 3206
308 Ga0307510_10000018 3300033180 Bacteria 192986
309 Ga0307510_10046472 3300033180 Bacteria 4667
310 Ga0373926_0092847 3300035083 Bacteria 1123
311 Ga0373936_0006629 3300035113 Bacteria 4360
312 Ga0373936_0019088 3300035113 Bacteria 2655
313 Ga0316574_0001441 3300035398 Bacteria 11286
314 Ga0373933_0039154 3300035724 Bacteria 2788
315 Ga0373937_0090954 3300036401 Unclassified 2827
316 Ga0436364_0110538 3300037853 Unclassified 1715
317 Ga0436364_0112772 3300037853 Bacteria 6952
318 Ga0436364_0594710 3300037853 Bacteria 1888
319 Ga0436365_0213469 3300039437 Bacteria 2083
320 Ga0436365_0777278 3300039437 Bacteria 12701
321 Ga0466960_0031348 3300044901 Bacteria 2453
322 Ga0451576_0159492 3300045051 Bacteria 2354
323 Ga0466967_0033312 3300045976 Bacteria 4359
324 Ga0466967_0155014 3300045976 Bacteria 2145
325 Ga0495580_0197371 3300046472 Bacteria 1387
326 Ga0495582_0115273 3300046473 Bacteria 1511
327 Ga0495605_0044336 3300046474 Bacteria 2200
328 Ga0495664_0102223 3300046477 Bacteria 1727
329 Ga0495628_0215095 3300046516 Bacteria 1445
330 Ga0495652_0021672 3300046529 Bacteria 5711
331 Ga0495645_0006449 3300046543 Bacteria 8141
332 Ga0495645_0252279 3300046543 Bacteria 1172
333 Ga0495656_0020354 3300046615 Bacteria 2572
334 Ga0495635_0057607 3300046663 Bacteria 2673
335 Ga0495657_0189790 3300046675 Bacteria 1257
336 Ga0495599_0043259 3300046678 Bacteria 2826
337 Ga0495658_0009654 3300046683 Bacteria 4811
338 Ga0495670_0157331 3300046691 Bacteria 1193
339 Ga0495674_0023978 3300047319 Bacteria 5613
340 Ga0495684_0315366 3300047471 Bacteria 1119
341 Ga0496102_0218328 3300048905 Bacteria 1797
342 Ga0496104_0112053 3300048907 Bacteria 2616
343 Ga0496108_0064592 3300048911 Bacteria 3084
344 Ga0496109_0043021 3300048912 Bacteria 4093
345 Ga0496109_0053544 3300048912 Bacteria 3680
346 Ga0496110_0053382 3300048913 Bacteria 3553
347 Ga0496111_0080840 3300048914 Bacteria 2372
348 Ga0496111_0246089 3300048914 Bacteria 1327
349 Ga0496112_0469520 3300048915 Unclassified 1195
350 Ga0496113_0119471 3300048916 Bacteria 2059
351 Ga0496113_0278646 3300048916 Bacteria 1337
352 Ga0496114_0074104 3300048917 Bacteria 2866
353 Ga0496114_0200966 3300048917 Bacteria 1746
354 Ga0496115_0055309 3300048918 Unclassified 3188
355 Ga0496116_0008896 3300048919 Bacteria 8636
356 Ga0496117_0001025 3300048920 Bacteria 42677
357 Ga0496118_0000419 3300048921 Bacteria 70630
358 Ga0496119_0000691 3300048922 Bacteria 45184
359 Ga0496120_0000014 3300048923 Bacteria 323163
360 Ga0496120_0021309 3300048923 Bacteria 4097
361 Ga0496120_0099977 3300048923 Bacteria 1534
362 Ga0496121_0002735 3300048924 Bacteria 26259
363 Ga0496121_0024688 3300048924 Bacteria 5737
364 Ga0496125_0007658 3300048928 Bacteria 11446
365 Ga0496125_0013006 3300048928 Bacteria 8214
366 Ga0496125_0108275 3300048928 Bacteria 2022
367 Ga0496126_0181140 3300048929 Bacteria 1790
368 Ga0501032_0119745 3300049569 Bacteria 1741
369 Ga0501033_0127617 3300049570 Bacteria 1844
370 Ga0501034_0479231 3300049571 Bacteria 1160
371 Ga0501037_0273204 3300049573 Bacteria 1179
372 Ga0501038_0204694 3300049574 Bacteria 1582
373 Ga0501038_0286150 3300049574 Bacteria 1296
374 Ga0501043_0017496 3300049579 Bacteria 5620
375 Ga0501046_0026684 3300049580 Bacteria 4718
376 Ga0501047_0211164 3300049581 Bacteria 1799
377 Ga0501076_0113121 3300049592 Bacteria 2196
378 Ga0501080_0028386 3300049742 Bacteria 5205
379 Ga0501080_0429057 3300049742 Unclassified 1187
380 Ga0501035_0051622 3300049822 Bacteria 3681
381 Ga0501035_0195706 3300049822 Bacteria 1736
382 Ga0501044_0084858 3300049823 Bacteria 3200
383 nmdc:mga05p37_238904_c1 3300050507 Bacteria 2186
384 nmdc:mga08y16_443914_c1 3300050511 Bacteria 1324
385 nmdc:mga08y16_8940_c1 3300050511 Bacteria 10518
386 Ga0495601_0023568 3300053077 Bacteria 3783
387 Ga0495595_0092816 3300053084 Unclassified 1450
388 Ga0530510_0167999 3300061734 Bacteria 1625
389 2545676884 2545555834 Bacteria 8130841
390 641642786 641522639 Bacteria 7737025
391 643602461 643348564 Bacteria 8839022
392 Ga0501048_0087168
393 rootL2_10125296
394 JGI25405J52794_10000958
395 Ga0070658_10048699
396 Ga0070676_10121156
397 Ga0070683_100012827
398 Ga0070683_100037715
399 Ga0070683_100167275
400 Ga0070683_100264673
401 Ga0070683_100286550
402 Ga0070683_100589953
403 Ga0070690_100068020
404 Ga0070690_100078285
405 Ga0070677_10026125
406 Ga0070677_10026749
407 Ga0068869_100338606
408 Ga0070666_10046817
409 Ga0070680_100103534
410 Ga0070660_100223321
411 Ga0070689_100120556
412 Ga0070689_100239939
413 Ga0070691_10041032
414 Ga0070687_100056375
415 Ga0070661_100040304
416 Ga0070661_100155275
417 Ga0070668_100182166
418 Ga0070669_100171504
419 Ga0070675_100172987
420 Ga0070675_100196781
421 Ga0070675_100251280
422 Ga0070671_100017025
423 Ga0070671_100130534
424 Ga0070671_100215692
425 Ga0070674_100018935
426 Ga0070673_100094796
427 Ga0070673_100164075
428 Ga0070667_100004739
429 Ga0070667_100084677
430 Ga0070667_100416974
431 Ga0070714_100238710
432 Ga0070713_100004137
433 Ga0070701_10224175
434 Ga0070663_100401327
435 Ga0070678_100265264
436 Ga0070662_100170561
437 Ga0070681_10002526
438 Ga0070681_10012370
439 Ga0070681_10053127
440 Ga0068867_100030484
441 Ga0070685_10135063
442 Ga0070707_100128622
443 Ga0070698_100160529
444 Ga0070699_100000195
445 Ga0070679_100003096
446 Ga0070679_100053163
447 Ga0070679_100058113
448 Ga0070679_100098082
449 Ga0070684_100016361
450 Ga0070684_100043795
451 Ga0070684_100155975
452 Ga0068853_100119026
453 Ga0070672_100013572
454 Ga0070696_100005502
455 Ga0070665_100001205
456 Ga0070665_100024359
457 Ga0070665_100084072
458 Ga0070665_100178973
459 Ga0070704_100019208
460 Ga0068855_100029800
461 Ga0068855_100269299
462 Ga0070664_100046943
463 Ga0070664_100081770
464 Ga0068857_100275297
465 Ga0068854_100034379
466 Ga0068856_100226430
467 Ga0070702_100055513
468 Ga0070702_100082750
469 Ga0068852_100385398
470 Ga0068852_100510560
471 Ga0068859_100000344
472 Ga0068859_100039124
473 Ga0068859_100077172
474 Ga0068859_100402032
475 Ga0068864_100033614
476 Ga0068864_100071368
477 Ga0068864_100314776
478 Ga0068866_10163082
479 Ga0068861_100202027
480 Ga0068851_10019042
481 Ga0068863_100058099
482 Ga0068863_100363303
483 Ga0068858_100003154
484 Ga0068858_100016245
485 Ga0068858_100286145
486 Ga0068858_100375525
487 Ga0068858_100400076
488 Ga0068858_100438930
489 Ga0068860_100040765
490 Ga0068860_100303637
491 Ga0068860_100465348
492 Ga0068860_100472791
493 Ga0068862_100032098
494 Ga0068862_100262910
495 Ga0081538_10069335
496 Ga0070717_10057260
497 Ga0097621_100192038
498 Ga0097621_100278655
499 Ga0097621_100315418
500 Ga0068871_100039252
501 Ga0068871_100046421
502 Ga0068871_100060294
503 Ga0075428_100003862
504 Ga0075428_100044128
505 Ga0068865_100092789
506 Ga0097620_100000344
507 Ga0097620_100039123
508 Ga0097620_100077172
509 Ga0097620_100402029
510 Ga0105251_10058933
511 Ga0105240_10013075
512 Ga0105240_10263484
513 Ga0105240_10347455
514 Ga0111539_10044890
515 Ga0111539_10060218
516 Ga0105245_10008915
517 Ga0105245_10017852
518 Ga0105245_10027705
519 Ga0105245_10114821
520 Ga0105247_10000392
521 Ga0105247_10047046
522 Ga0114129_10229957
523 Ga0114129_10947825
524 Ga0105243_10016899
525 Ga0105243_10049516
526 Ga0105243_10330867
527 Ga0105241_10050369
528 Ga0105242_10051071
529 Ga0105242_10235105
530 Ga0105248_10020106
531 Ga0105248_10167060
532 Ga0105248_10302235
533 Ga0105248_10347935
534 Ga0105237_10058318
535 Ga0105237_10144355
536 Ga0105238_10149558
537 Ga0105238_10260788
538 Ga0105249_10011847
539 Ga0105239_10003375
540 Ga0105239_10107947
541 Ga0105239_10971932
542 Ga0105246_10310722
543 Ga0105246_10439429
544 Ga0157370_10018439
545 Ga0157369_10192332
546 Ga0157374_10006492
547 Ga0157374_10060943
548 Ga0157378_10014348
549 Ga0163162_10068174
550 Ga0163162_10158996
551 Ga0163162_10429849
552 Ga0163162_10701942
553 Ga0157372_10355956
554 Ga0157375_10027170
555 Ga0157375_10252257
556 Ga0157375_10804307
557 Ga0163163_10095285
558 Ga0163163_10114344
559 Ga0163163_10270344
560 Ga0163163_10294717
561 Ga0157380_10318887
562 Ga0182008_10126306
563 Ga0157379_10003818
564 Ga0157379_10025588
565 Ga0157379_10172502
566 Ga0157379_10244300
567 Ga0157379_10383980
568 Ga0157376_10009291
569 Ga0157376_10278170
570 Ga0163161_10100581
571 Ga0213876_10015241
572 Ga0213875_10108882
573 Ga0207697_10004360
574 Ga0207656_10088644
575 Ga0207682_10000938
576 Ga0207682_10047624
577 Ga0207692_10025540
578 Ga0207710_10000388
579 Ga0207688_10026540
580 Ga0207688_10146249
581 Ga0207680_10004158
582 Ga0207645_10002914
583 Ga0207645_10247521
584 Ga0207643_10021170
585 Ga0207643_10182296
586 Ga0207707_10002765
587 Ga0207707_10021032
588 Ga0207707_10146919
589 Ga0207695_10000264
590 Ga0207695_10106643
591 Ga0207695_10192224
592 Ga0207695_10217094
593 Ga0207695_10275279
594 Ga0207671_10068992
595 Ga0207671_10216596
596 Ga0207663_10135444
597 Ga0207662_10031524
598 Ga0207652_10002261
599 Ga0207652_10110449
600 Ga0207652_10165720
601 Ga0207681_10014785
602 Ga0207694_10006767
603 Ga0207659_10069888
604 Ga0207659_10078391
605 Ga0207687_10046338
606 Ga0207687_10061205
607 Ga0207687_10095707
608 Ga0207687_10140119
609 Ga0207700_10163549
610 Ga0207700_10263939
611 Ga0207664_10164218
612 Ga0207706_10011274
613 Ga0207706_10078453
614 Ga0207686_10003315
615 Ga0207686_10054338
616 Ga0207686_10348659
617 Ga0207709_10033637
618 Ga0207709_10050097
619 Ga0207669_10155921
620 Ga0207669_10227561
621 Ga0207704_10101771
622 Ga0207691_10005774
623 Ga0207691_10068342
624 Ga0207711_10018135
625 Ga0207711_10082840
626 Ga0207711_10106798
627 Ga0207711_10155102
628 Ga0207689_10003022
629 Ga0207689_10038206
630 Ga0207661_10058053
631 Ga0207661_10255308
632 Ga0207661_10310724
633 Ga0207679_10074569
634 Ga0207679_10186284
635 Ga0207667_10003559
636 Ga0207651_10005281
637 Ga0207651_10037194
638 Ga0207712_10251062
639 Ga0207640_10025568
640 Ga0207640_10301511
641 Ga0207658_10068201
642 Ga0207677_10057898
643 Ga0207703_10003581
644 Ga0207703_10016528
645 Ga0207703_10030921
646 Ga0207703_10159950
647 Ga0207703_10361107
648 Ga0207639_10075098
649 Ga0207678_10111778
650 Ga0207678_10217166
651 Ga0207708_10078110
652 Ga0207702_10024109
653 Ga0207641_10083734
654 Ga0207648_10034552
655 Ga0207648_10044086
656 Ga0207648_10249697
657 Ga0207676_10155986
658 Ga0207674_10046304
659 Ga0207674_10173399
660 Ga0207675_100001937
661 Ga0207675_100021433
662 Ga0207675_100045917
663 Ga0207675_100208311
664 Ga0207683_10000010
665 Ga0207683_10012960
666 Ga0207683_10013710
667 Ga0207683_10202537
668 Ga0207698_10300652
669 Ga0209999_1014639
670 Ga0207428_10118544
671 Ga0207428_10291967
672 Ga0268266_10023376
673 Ga0268266_10141503
674 Ga0268266_10153985
675 Ga0268266_10180900
676 Ga0268266_10218432
677 Ga0268266_10252033
678 Ga0268265_10015671
679 Ga0268265_10312648
680 Ga0268265_10430034
681 Ga0268264_10008448
682 Ga0268264_10041530
683 Ga0265338_10006070
684 Ga0307511_10008741
685 Ga0265330_10081087
686 Ga0265332_10009434
687 Ga0265332_10086188
688 Ga0265329_10035920
689 Ga0265340_10058764
690 Ga0265313_10008677
691 Ga0316575_10000707
692 Ga0316579_10006566
693 Ga0265314_10002214
694 Ga0265314_10003982
695 Ga0265314_10056635
696 Ga0265342_10054462
697 Ga0307416_100580940
698 Ga0316583_10011388
699 Ga0307510_10000018
700 Ga0307510_10046472
701 Ga0373926_0092847
702 Ga0373936_0006629
703 Ga0373936_0019088
704 Ga0316574_0001441
705 Ga0373933_0039154
706 Ga0373937_0090954
707 Ga0436364_0110538
708 Ga0436364_0112772
709 Ga0436364_0594710
710 Ga0436365_0213469
711 Ga0436365_0777278
712 Ga0466960_0031348
713 Ga0451576_0159492
714 Ga0466967_0033312
715 Ga0466967_0155014
716 Ga0495580_0197371
717 Ga0495582_0115273
718 Ga0495605_0044336
719 Ga0495664_0102223
720 Ga0495628_0215095
721 Ga0495652_0021672
722 Ga0495645_0006449
723 Ga0495645_0252279
724 Ga0495656_0020354
725 Ga0495635_0057607
726 Ga0495657_0189790
727 Ga0495599_0043259
728 Ga0495658_0009654
729 Ga0495670_0157331
730 Ga0495674_0023978
731 Ga0495684_0315366
732 Ga0496102_0218328
733 Ga0496104_0112053
734 Ga0496108_0064592
735 Ga0496109_0043021
736 Ga0496109_0053544
737 Ga0496110_0053382
738 Ga0496111_0080840
739 Ga0496111_0246089
740 Ga0496112_0469520
741 Ga0496113_0119471
742 Ga0496113_0278646
743 Ga0496114_0074104
744 Ga0496114_0200966
745 Ga0496115_0055309
746 Ga0496116_0008896
747 Ga0496117_0001025
748 Ga0496118_0000419
749 Ga0496119_0000691
750 Ga0496120_0000014
751 Ga0496120_0021309
752 Ga0496120_0099977
753 Ga0496121_0002735
754 Ga0496121_0024688
755 Ga0496125_0007658
756 Ga0496125_0013006
757 Ga0496125_0108275
758 Ga0496126_0181140
759 Ga0501032_0119745
760 Ga0501033_0127617
761 Ga0501034_0479231
762 Ga0501037_0273204
763 Ga0501038_0204694
764 Ga0501038_0286150
765 Ga0501043_0017496
766 Ga0501046_0026684
767 Ga0501047_0211164
768 Ga0501076_0113121
769 Ga0501080_0028386
770 Ga0501080_0429057
771 Ga0501035_0051622
772 Ga0501035_0195706
773 Ga0501044_0084858
774 nmdc:mga05p37_238904_c1
775 nmdc:mga08y16_443914_c1
776 nmdc:mga08y16_8940_c1
777 Ga0495601_0023568
778 Ga0495595_0092816
779 Ga0530510_0167999
780 2545676884
781 641642786
782 643602461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

202

299

0.96

PF00551

Formyl_trans_N

Formyl transferase

1

178

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9322 7 317
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9293 7 317
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9252 9 318
8gjh-assembly1.cif.gz_E salmonella arna 0.9133 10 315
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9111 9 318
ID Description Score Start End Superfamily
af_G5ECV9_1_209_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9423 10 207 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9081 9 209 3.40.50.170
1yrwA02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9059 211 311 3.10.25.10
4wkgD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9023 10 316 3.40.50.12230
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9011 11 209 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A1F3ZN46-F1-model_v4 Methionyl-tRNA formyltransferase 0.978 10 318 GO:0004479
GO:0005829
AF-A0A1F3ZN46-F1-model_v4 Methionyl-tRNA formyltransferase 0.9718 10 318 GO:0004479
GO:0005829
AF-A0A382CC87-F1-model_v4 Uncharacterized protein 0.9643 10 259 GO:0004479
GO:0005829
AF-A0A3D1LXR3-F1-model_v4 Methionyl-tRNA formyltransferase 0.962 86 317 GO:0004479
GO:0005829
AF-A0A315XHB3-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9607 10 317 GO:0004479
GO:0005829

Map