F432109

General Info

Members Datasets Scaffolds Average Seq Length
391 245 782 115

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0005076|Ga0453684_0005076_1337_1669
Length 110
Sequence MNATDPFPYTGPDALRQPVLKALTRVVDPEFALTIVDLGLVVGVTVDDERLHVALTMTSAACPVADLIVDDAAAELEPLAGARAVDIELVWTPAWTPERMSERARRFMHG

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
169 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
173 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
179 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
180 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
181 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
202 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
203 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
204 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
211 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
212 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
213 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
214 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
220 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
221 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
222 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
223 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
239 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
240 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
243 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
244 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
245 2643221672 Variovorax sp. Root434 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 0
Rhizoplane 2.56
Rhizosphere 81.84
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0005076 3300044712 Bacteria 26598
2 rootH1_10023749 3300003323 Bacteria 2484
3 rootH1_10051564 3300003323 Bacteria 1152
4 Ga0055540_1076464 3300003792 Bacteria 647
5 Ga0065712_10290822 3300005290 Bacteria 878
6 Ga0065715_10629840 3300005293 Bacteria 690
7 Ga0070658_10350362 3300005327 Bacteria 1264
8 Ga0070690_101524371 3300005330 Bacteria 540
9 Ga0070670_100002799 3300005331 Bacteria 14429
10 Ga0070677_10347534 3300005333 Bacteria 767
11 Ga0070666_10673956 3300005335 Bacteria 757
12 Ga0070666_11208273 3300005335 Bacteria 563
13 Ga0070680_100406258 3300005336 Bacteria 1161
14 Ga0070660_100740641 3300005339 Bacteria 825
15 Ga0070691_10200447 3300005341 Bacteria 1048
16 Ga0070661_100186258 3300005344 Bacteria 1581
17 Ga0070692_10284247 3300005345 Bacteria 1004
18 Ga0070669_101908886 3300005353 Unclassified 519
19 Ga0070675_100075077 3300005354 Bacteria 2810
20 Ga0070675_100194725 3300005354 Bacteria 1757
21 Ga0070675_100524698 3300005354 Bacteria 1069
22 Ga0070671_100017985 3300005355 Bacteria 5734
23 Ga0070671_100345274 3300005355 Unclassified 1270
24 Ga0070671_100616636 3300005355 Unclassified 938
25 Ga0070671_101748745 3300005355 Bacteria 552
26 Ga0070674_100044310 3300005356 Bacteria 3032
27 Ga0070674_100137545 3300005356 Bacteria 1829
28 Ga0070674_100436583 3300005356 Bacteria 1078
29 Ga0070674_101525002 3300005356 Unclassified 601
30 Ga0070673_100073596 3300005364 Bacteria 2750
31 Ga0070673_100189338 3300005364 Bacteria 1766
32 Ga0070659_100395029 3300005366 Bacteria 1167
33 Ga0070667_100138932 3300005367 Bacteria 2126
34 Ga0070667_100294074 3300005367 Bacteria 1461
35 Ga0070667_100304484 3300005367 Bacteria 1435
36 Ga0070700_100001526 3300005441 Bacteria 11529
37 Ga0070700_100067395 3300005441 Bacteria 2274
38 Ga0070663_100377325 3300005455 Unclassified 1154
39 Ga0070678_101643132 3300005456 Unclassified 604
40 Ga0070678_101955984 3300005456 Bacteria 554
41 Ga0070681_10116953 3300005458 Bacteria 2603
42 Ga0068867_100005321 3300005459 Bacteria 9096
43 Ga0068867_100650409 3300005459 Bacteria 925
44 Ga0068867_100762982 3300005459 Unclassified 859
45 Ga0070707_100105598 3300005468 Bacteria 2731
46 Ga0070698_100078497 3300005471 Bacteria 3300
47 Ga0068853_100080176 3300005539 Bacteria 2855
48 Ga0068853_101630352 3300005539 Unclassified 625
49 Ga0070672_100025300 3300005543 Bacteria 4400
50 Ga0070672_100280753 3300005543 Bacteria 1408
51 Ga0070672_100432629 3300005543 Bacteria 1131
52 Ga0070672_100496922 3300005543 Bacteria 1055
53 Ga0070686_100817692 3300005544 Unclassified 752
54 Ga0070693_100048343 3300005547 Bacteria 2422
55 Ga0070665_100501636 3300005548 Bacteria 1225
56 Ga0068855_100117442 3300005563 Bacteria 3048
57 Ga0070664_100363617 3300005564 Bacteria 1318
58 Ga0070664_101063745 3300005564 Bacteria 761
59 Ga0068857_100019499 3300005577 Bacteria 5957
60 Ga0068854_100866605 3300005578 Bacteria 792
61 Ga0068856_100052570 3300005614 Bacteria 4018
62 Ga0070702_100433507 3300005615 Bacteria 949
63 Ga0068852_100051385 3300005616 Bacteria 3537
64 Ga0068852_100292081 3300005616 Bacteria 1575
65 Ga0068852_100369783 3300005616 Bacteria 1404
66 Ga0068852_100493456 3300005616 Unclassified 1218
67 Ga0068859_100010927 3300005617 Bacteria 9138
68 Ga0068859_100168890 3300005617 Bacteria 2268
69 Ga0068864_100000464 3300005618 Bacteria 35141
70 Ga0068864_100586777 3300005618 Unclassified 1080
71 Ga0068864_102051685 3300005618 Bacteria 578
72 Ga0068866_10212238 3300005718 Bacteria 1163
73 Ga0068866_10364218 3300005718 Unclassified 922
74 Ga0068861_100002003 3300005719 Bacteria 13175
75 Ga0068861_100107779 3300005719 Bacteria 2228
76 Ga0068851_10078495 3300005834 Bacteria 1720
77 Ga0068870_10137764 3300005840 Bacteria 1425
78 Ga0068863_100008475 3300005841 Bacteria 10042
79 Ga0068858_100001151 3300005842 Bacteria 27341
80 Ga0068860_100006511 3300005843 Bacteria 11721
81 Ga0068860_100057960 3300005843 Bacteria 3682
82 Ga0068862_100003437 3300005844 Bacteria 13623
83 Ga0068862_100763577 3300005844 Bacteria 941
84 Ga0075365_10032052 3300006038 Bacteria 3376
85 Ga0075368_10125430 3300006042 Unclassified 1065
86 Ga0075363_100005370 3300006048 Bacteria 5693
87 Ga0075363_100471720 3300006048 Bacteria 743
88 Ga0075364_10416958 3300006051 Bacteria 916
89 Ga0075432_10018383 3300006058 Bacteria 2384
90 Ga0075362_10000908 3300006177 Bacteria 8973
91 Ga0075362_10003472 3300006177 Bacteria 5519
92 Ga0075362_10037144 3300006177 Bacteria 2134
93 Ga0075367_10011470 3300006178 Bacteria 4692
94 Ga0075367_10074207 3300006178 Bacteria 2051
95 Ga0075369_10093210 3300006186 Bacteria 1345
96 Ga0075369_10160901 3300006186 Bacteria 1029
97 Ga0075366_10001307 3300006195 Bacteria 12421
98 Ga0075366_10017718 3300006195 Bacteria 4104
99 Ga0075366_10039358 3300006195 Bacteria 2795
100 Ga0075366_10147488 3300006195 Bacteria 1424
101 Ga0075366_10296425 3300006195 Unclassified 989
102 Ga0075366_10540798 3300006195 Bacteria 721
103 Ga0097621_101474674 3300006237 Bacteria 645
104 Ga0075370_10002949 3300006353 Bacteria 7996
105 Ga0075370_10133056 3300006353 Bacteria 1452
106 Ga0075370_10169790 3300006353 Bacteria 1282
107 Ga0075370_10610232 3300006353 Bacteria 661
108 Ga0068871_100066052 3300006358 Bacteria 2964
109 Ga0068871_100153178 3300006358 Bacteria 1967
110 Ga0068865_100001816 3300006881 Bacteria 12537
111 Ga0097620_100010927 3300006931 Bacteria 9138
112 Ga0097620_100168886 3300006931 Bacteria 2268
113 Ga0105240_10002253 3300009093 Bacteria 31317
114 Ga0111539_10666748 3300009094 Bacteria 1211
115 Ga0105245_11601992 3300009098 Bacteria 703
116 Ga0114129_10996265 3300009147 Bacteria 1055
117 Ga0105243_10121650 3300009148 Bacteria 2201
118 Ga0105243_11643085 3300009148 Bacteria 670
119 Ga0105242_10482792 3300009176 Bacteria 1175
120 Ga0105248_10009399 3300009177 Bacteria 10763
121 Ga0105248_10009954 3300009177 Bacteria 10467
122 Ga0105248_10085292 3300009177 Bacteria 3554
123 Ga0105248_10122174 3300009177 Bacteria 2937
124 Ga0105248_11014008 3300009177 Bacteria 938
125 Ga0105237_10221811 3300009545 Bacteria 1891
126 Ga0105238_10482947 3300009551 Bacteria 1238
127 Ga0105249_10214546 3300009553 Bacteria 1891
128 Ga0157327_1009174 3300012512 Bacteria 904
129 Ga0157371_10189197 3300013102 Bacteria 1473
130 Ga0157370_10068906 3300013104 Bacteria 3342
131 Ga0157374_10066722 3300013296 Bacteria 3382
132 Ga0157378_10386295 3300013297 Bacteria 1376
133 Ga0157378_11221189 3300013297 Bacteria 791
134 Ga0163162_10006914 3300013306 Bacteria 10999
135 Ga0163162_10604546 3300013306 Bacteria 1223
136 Ga0163162_11808495 3300013306 Bacteria 698
137 Ga0163162_11813753 3300013306 Bacteria 697
138 Ga0157372_10481099 3300013307 Bacteria 1447
139 Ga0157375_10107173 3300013308 Bacteria 2887
140 Ga0157375_10228112 3300013308 Bacteria 2021
141 Ga0157375_10369140 3300013308 Bacteria 1601
142 Ga0157375_10670648 3300013308 Unclassified 1192
143 Ga0163163_10002467 3300014325 Bacteria 15632
144 Ga0163163_10123610 3300014325 Bacteria 2624
145 Ga0157380_10376554 3300014326 Bacteria 1338
146 Ga0157380_10622340 3300014326 Bacteria 1072
147 Ga0157380_11046341 3300014326 Bacteria 852
148 Ga0182008_10512329 3300014497 Bacteria 661
149 Ga0157377_10165397 3300014745 Bacteria 1379
150 Ga0157379_10002968 3300014968 Bacteria 14312
151 Ga0157379_10047309 3300014968 Bacteria 3838
152 Ga0157379_10583457 3300014968 Bacteria 1042
153 Ga0157376_10032449 3300014969 Bacteria 4193
154 Ga0157376_10035844 3300014969 Bacteria 4015
155 Ga0157376_12967817 3300014969 Bacteria 514
156 Ga0182006_1062648 3300015261 Bacteria 1399
157 Ga0163161_10047599 3300017792 Bacteria 3096
158 Ga0209758_1061314 3300025297 Bacteria 1240
159 Ga0209051_1007313 3300025303 Bacteria 6059
160 Ga0207697_10095668 3300025315 Bacteria 1262
161 Ga0207656_10023795 3300025321 Bacteria 2470
162 Ga0207642_10085023 3300025899 Unclassified 1547
163 Ga0207688_10177935 3300025901 Bacteria 1267
164 Ga0207680_10002054 3300025903 Bacteria 9430
165 Ga0207705_10092592 3300025909 Bacteria 2215
166 Ga0207684_10043823 3300025910 Bacteria 3794
167 Ga0207695_10514793 3300025913 Bacteria 1078
168 Ga0207695_11000521 3300025913 Unclassified 716
169 Ga0207671_10001494 3300025914 Bacteria 26993
170 Ga0207671_10095834 3300025914 Bacteria 2241
171 Ga0207671_10242860 3300025914 Bacteria 1415
172 Ga0207657_10050829 3300025919 Bacteria 3605
173 Ga0207657_10441326 3300025919 Bacteria 1022
174 Ga0207646_10095475 3300025922 Bacteria 2663
175 Ga0207681_10123884 3300025923 Bacteria 1900
176 Ga0207681_10741409 3300025923 Bacteria 818
177 Ga0207694_10137674 3300025924 Bacteria 1962
178 Ga0207650_10001449 3300025925 Bacteria 17085
179 Ga0207650_10157781 3300025925 Bacteria 1795
180 Ga0207659_10017484 3300025926 Bacteria 4686
181 Ga0207659_10018651 3300025926 Bacteria 4551
182 Ga0207659_10968741 3300025926 Unclassified 732
183 Ga0207687_10339200 3300025927 Bacteria 1221
184 Ga0207644_10006232 3300025931 Bacteria 7776
185 Ga0207644_10014080 3300025931 Bacteria 5349
186 Ga0207644_10609561 3300025931 Unclassified 907
187 Ga0207644_10874683 3300025931 Bacteria 753
188 Ga0207690_10231090 3300025932 Bacteria 1420
189 Ga0207690_11346391 3300025932 Bacteria 597
190 Ga0207706_10012594 3300025933 Bacteria 7701
191 Ga0207706_10019520 3300025933 Bacteria 6098
192 Ga0207686_10192454 3300025934 Bacteria 1455
193 Ga0207709_10079526 3300025935 Bacteria 2108
194 Ga0207709_10484532 3300025935 Bacteria 962
195 Ga0207670_10318223 3300025936 Bacteria 1223
196 Ga0207669_10040988 3300025937 Bacteria 2691
197 Ga0207704_10021053 3300025938 Bacteria 3465
198 Ga0207704_10180599 3300025938 Bacteria 1524
199 Ga0207704_10225368 3300025938 Bacteria 1390
200 Ga0207691_10008129 3300025940 Bacteria 10071
201 Ga0207691_10012805 3300025940 Bacteria 8028
202 Ga0207691_10199155 3300025940 Bacteria 1744
203 Ga0207691_10564967 3300025940 Unclassified 964
204 Ga0207691_11016116 3300025940 Bacteria 692
205 Ga0207711_10008052 3300025941 Bacteria 8822
206 Ga0207711_10033319 3300025941 Bacteria 4358
207 Ga0207711_10045756 3300025941 Bacteria 3740
208 Ga0207711_10540823 3300025941 Bacteria 1087
209 Ga0207711_10712655 3300025941 Unclassified 936
210 Ga0207689_10009366 3300025942 Bacteria 8462
211 Ga0207689_10041237 3300025942 Bacteria 3819
212 Ga0207679_10014112 3300025945 Bacteria 5244
213 Ga0207679_10343997 3300025945 Bacteria 1298
214 Ga0207651_10007161 3300025960 Bacteria 5927
215 Ga0207651_10193094 3300025960 Bacteria 1626
216 Ga0207668_10089939 3300025972 Bacteria 2252
217 Ga0207668_10658837 3300025972 Bacteria 917
218 Ga0207658_10007319 3300025986 Bacteria 7529
219 Ga0207658_10136473 3300025986 Bacteria 1979
220 Ga0207658_10329574 3300025986 Bacteria 1324
221 Ga0207658_10781357 3300025986 Unclassified 866
222 Ga0207677_10000685 3300026023 Bacteria 20041
223 Ga0207703_10000731 3300026035 Bacteria 32297
224 Ga0207703_10401214 3300026035 Unclassified 1272
225 Ga0207639_10857225 3300026041 Bacteria 848
226 Ga0207639_11602815 3300026041 Bacteria 611
227 Ga0207678_10050553 3300026067 Bacteria 3591
228 Ga0207678_11026423 3300026067 Bacteria 730
229 Ga0207708_10191181 3300026075 Bacteria 1629
230 Ga0207708_10341872 3300026075 Bacteria 1226
231 Ga0207702_10033477 3300026078 Bacteria 4293
232 Ga0207641_10019046 3300026088 Bacteria 5629
233 Ga0207641_10309256 3300026088 Bacteria 1495
234 Ga0207641_10660946 3300026088 Bacteria 1027
235 Ga0207641_11670000 3300026088 Bacteria 639
236 Ga0207648_10000799 3300026089 Bacteria 35474
237 Ga0207648_10026420 3300026089 Bacteria 5159
238 Ga0207648_10046190 3300026089 Bacteria 3818
239 Ga0207648_10047502 3300026089 Bacteria 3763
240 Ga0207648_10803855 3300026089 Unclassified 875
241 Ga0207648_11551718 3300026089 Unclassified 622
242 Ga0207676_10004351 3300026095 Bacteria 10014
243 Ga0207676_10463375 3300026095 Unclassified 1197
244 Ga0207676_11761829 3300026095 Bacteria 618
245 Ga0207674_10012009 3300026116 Bacteria 9704
246 Ga0207675_100001875 3300026118 Bacteria 21019
247 Ga0207675_100103048 3300026118 Bacteria 2689
248 Ga0207683_10006275 3300026121 Bacteria 10189
249 Ga0207683_11002204 3300026121 Bacteria 775
250 Ga0207698_10013427 3300026142 Bacteria 5403
251 Ga0207698_10564937 3300026142 Unclassified 1117
252 Ga0207698_10722292 3300026142 Bacteria 993
253 Ga0207698_11560809 3300026142 Archaea 675
254 Ga0207698_11610712 3300026142 Bacteria 665
255 Ga0209813_10094748 3300027866 Unclassified 1007
256 Ga0207428_10508896 3300027907 Bacteria 874
257 Ga0268265_10002373 3300028380 Bacteria 14246
258 Ga0268265_10862868 3300028380 Bacteria 886
259 Ga0268264_10045547 3300028381 Bacteria 3642
260 Ga0268264_10390160 3300028381 Bacteria 1335
261 Ga0268264_10921946 3300028381 Bacteria 878
262 Ga0268264_11387259 3300028381 Unclassified 713
263 Ga0307515_10000011 3300028794 Bacteria 633903
264 Ga0307515_10001417 3300028794 Bacteria 54238
265 Ga0307515_10785221 3300028794 Unclassified 574
266 Ga0307512_10162498 3300030522 Bacteria 1303
267 Ga0307509_10002501 3300031507 Bacteria 29644
268 Ga0307509_10175837 3300031507 Bacteria 2013
269 Ga0307408_100000026 3300031548 Bacteria 261688
270 Ga0307408_100030474 3300031548 Bacteria 3746
271 Ga0307408_100198677 3300031548 Bacteria 1621
272 Ga0307408_100297605 3300031548 Bacteria 1350
273 Ga0307408_100460393 3300031548 Bacteria 1105
274 Ga0307408_102189479 3300031548 Unclassified 534
275 Ga0307508_10174426 3300031616 Bacteria 1753
276 Ga0265342_10135983 3300031712 Bacteria 1374
277 Ga0307405_10108972 3300031731 Bacteria 1872
278 Ga0307406_11958933 3300031901 Unclassified 523
279 Ga0307412_10101254 3300031911 Bacteria 2038
280 Ga0307412_10237531 3300031911 Bacteria 1407
281 Ga0307416_100389053 3300032002 Bacteria 1428
282 Ga0307416_101722568 3300032002 Bacteria 731
283 Ga0307411_10000039 3300032005 Bacteria 40183
284 Ga0307411_11201378 3300032005 Bacteria 687
285 Ga0307507_10077396 3300033179 Bacteria 2959
286 Ga0373948_0017258 3300034817 Bacteria 1343
287 Ga0373950_0014874 3300034818 Bacteria 1314
288 Ga0373959_0045369 3300034820 Bacteria 934
289 Ga0373951_0003857 3300035091 Bacteria 3603
290 Ga0373939_0000009 3300035114 Bacteria 69322
291 Ga0373961_0009153 3300035241 Bacteria 2419
292 Ga0373962_0086809 3300035242 Bacteria 958
293 Ga0373931_0000526 3300035691 Bacteria 15674
294 Ga0373947_0475541 3300035725 Bacteria 848
295 Ga0373925_0346412 3300037068 Bacteria 1206
296 Ga0439436_0230014 3300041404 Unclassified 535
297 Ga0439439_0013292 3300041406 Bacteria 1995
298 Ga0439461_0144796 3300041410 Unclassified 610
299 Ga0439466_0045706 3300041411 Bacteria 1447
300 Ga0439466_0161008 3300041411 Bacteria 687
301 Ga0451791_1572732 3300041451 Bacteria 572
302 Ga0451802_0935317 3300041460 Bacteria 548
303 Ga0451853_2657684 3300041512 Bacteria 887
304 Ga0439431_0083828 3300041997 Unclassified 862
305 Ga0439433_0036682 3300041999 Bacteria 1133
306 Ga0439442_024286 3300042002 Bacteria 1260
307 Ga0439449_0006607 3300042007 Bacteria 4435
308 Ga0439452_005934 3300042010 Bacteria 3874
309 Ga0439457_025007 3300042014 Bacteria 1322
310 Ga0439462_0012179 3300042015 Bacteria 2196
311 Ga0450921_003593 3300042123 Bacteria 1098
312 Ga0450890_005325 3300042127 Bacteria 1657
313 Ga0450906_008793 3300042145 Bacteria 1942
314 Ga0450906_012532 3300042145 Bacteria 1570
315 Ga0450909_005052 3300042185 Bacteria 1893
316 Ga0439434_0006925 3300042435 Bacteria 3310
317 Ga0450918_008052 3300042531 Bacteria 1855
318 Ga0466969_0422169 3300044656 Bacteria 606
319 Ga0453684_0102601 3300044712 Bacteria 3497
320 Ga0451576_0109514 3300045051 Bacteria 2874
321 Ga0495603_0215328 3300046455 Bacteria 1109
322 Ga0495618_0909320 3300046514 Bacteria 508
323 Ga0495628_0975190 3300046516 Bacteria 584
324 Ga0495598_0009293 3300046537 Bacteria 2320
325 Ga0495621_0060897 3300046539 Bacteria 1370
326 Ga0495597_0113595 3300046542 Bacteria 1134
327 Ga0495645_0074003 3300046543 Bacteria 2453
328 Ga0495625_0001579 3300046660 Bacteria 27104
329 Ga0495671_0099088 3300046692 Bacteria 1425
330 Ga0495614_0441435 3300048089 Bacteria 615
331 Ga0496104_0105730 3300048907 Bacteria 2697
332 Ga0496108_0026142 3300048911 Bacteria 4815
333 Ga0496108_0307489 3300048911 Unclassified 1381
334 Ga0496108_0801023 3300048911 Bacteria 813
335 Ga0496109_0782380 3300048912 Bacteria 892
336 Ga0496109_1890861 3300048912 Bacteria 529
337 Ga0496112_0238650 3300048915 Bacteria 1771
338 Ga0496114_0114693 3300048917 Bacteria 2311
339 Ga0501290_036030 3300049513 Bacteria 726
340 Ga0501293_031612 3300049516 Bacteria 569
341 Ga0501297_006894 3300049520 Bacteria 1223
342 Ga0501301_005979 3300049524 Bacteria 906
343 Ga0501202_038395 3300049652 Bacteria 1026
344 Ga0501211_008109 3300049658 Bacteria 1026
345 Ga0501217_142729 3300049661 Bacteria 710
346 Ga0501222_001561 3300049662 Bacteria 3191
347 Ga0501222_013352 3300049662 Bacteria 1081
348 Ga0501235_010971 3300049669 Bacteria 1983
349 Ga0501236_066943 3300049670 Bacteria 649
350 Ga0501253_090772 3300049683 Bacteria 703
351 Ga0501255_008712 3300049684 Bacteria 1107
352 Ga0501257_002232 3300049686 Bacteria 4057
353 Ga0501258_048931 3300049687 Unclassified 585
354 Ga0501221_000056 3300049704 Bacteria 11975
355 Ga0501225_0052912 3300049705 Bacteria 1133
356 Ga0501265_065427 3300049762 Bacteria 602
357 Ga0501268_054663 3300049765 Unclassified 780
358 Ga0501271_030571 3300049768 Bacteria 664
359 Ga0501272_001154 3300049769 Bacteria 2443
360 Ga0501280_004001 3300049776 Bacteria 2198
361 Ga0501282_003392 3300049778 Bacteria 1719
362 Ga0501283_030302 3300049779 Bacteria 905
363 Ga0501035_0121608 3300049822 Bacteria 2282
364 Ga0501204_053868 3300049850 Bacteria 623
365 nmdc:mga03n38_311187_c1 3300050490 Bacteria 848
366 nmdc:mga03n38_329638_c1 3300050490 Bacteria 826
367 nmdc:mga00v17_645856_c1 3300050491 Bacteria 681
368 nmdc:mga0k408_25703_c1 3300050493 Bacteria 3336
369 nmdc:mga0k408_33214_c1 3300050493 Bacteria 2950
370 nmdc:mga0k408_346092_c1 3300050493 Unclassified 886
371 nmdc:mga0k408_39956_c1 3300050493 Bacteria 2697
372 nmdc:mga0k408_51647_c1 3300050493 Bacteria 2382
373 nmdc:mga06z11_148216_c1 3300050494 Bacteria 1332
374 nmdc:mga06z11_477048_c1 3300050494 Archaea 755
375 nmdc:mga04h51_107477_c1 3300050495 Unclassified 1024
376 nmdc:mga07m45_29018_c1 3300050496 Bacteria 3056
377 nmdc:mga07m45_45942_c1 3300050496 Bacteria 2452
378 nmdc:mga05p37_573520_c1 3300050507 Bacteria 1279
379 nmdc:mga0sz30_25544_c1 3300050516 Bacteria 2416
380 Ga0500648_361630 3300053097 Bacteria 583
381 Ga0500608_039614 3300053122 Bacteria 2256
382 Ga0500626_035211 3300053128 Bacteria 2262
383 Ga0500559_0034096 3300053136 Bacteria 2194
384 Ga0500574_100676 3300053141 Bacteria 856
385 Ga0500619_194627 3300053154 Bacteria 682
386 Ga0500620_262783 3300053155 Bacteria 571
387 Ga0590071_080706 3300059421 Bacteria 808
388 2587736348 2585428058 Bacteria 6853932
389 2644217863 2643221639 Bacteria 6649903
390 2644258400 2643221646 Bacteria 6433402
391 2644398180 2643221672 Bacteria 6322190
392 Ga0453684_0005076
393 rootH1_10023749
394 rootH1_10051564
395 Ga0055540_1076464
396 Ga0065712_10290822
397 Ga0065715_10629840
398 Ga0070658_10350362
399 Ga0070690_101524371
400 Ga0070670_100002799
401 Ga0070677_10347534
402 Ga0070666_10673956
403 Ga0070666_11208273
404 Ga0070680_100406258
405 Ga0070660_100740641
406 Ga0070691_10200447
407 Ga0070661_100186258
408 Ga0070692_10284247
409 Ga0070669_101908886
410 Ga0070675_100075077
411 Ga0070675_100194725
412 Ga0070675_100524698
413 Ga0070671_100017985
414 Ga0070671_100345274
415 Ga0070671_100616636
416 Ga0070671_101748745
417 Ga0070674_100044310
418 Ga0070674_100137545
419 Ga0070674_100436583
420 Ga0070674_101525002
421 Ga0070673_100073596
422 Ga0070673_100189338
423 Ga0070659_100395029
424 Ga0070667_100138932
425 Ga0070667_100294074
426 Ga0070667_100304484
427 Ga0070700_100001526
428 Ga0070700_100067395
429 Ga0070663_100377325
430 Ga0070678_101643132
431 Ga0070678_101955984
432 Ga0070681_10116953
433 Ga0068867_100005321
434 Ga0068867_100650409
435 Ga0068867_100762982
436 Ga0070707_100105598
437 Ga0070698_100078497
438 Ga0068853_100080176
439 Ga0068853_101630352
440 Ga0070672_100025300
441 Ga0070672_100280753
442 Ga0070672_100432629
443 Ga0070672_100496922
444 Ga0070686_100817692
445 Ga0070693_100048343
446 Ga0070665_100501636
447 Ga0068855_100117442
448 Ga0070664_100363617
449 Ga0070664_101063745
450 Ga0068857_100019499
451 Ga0068854_100866605
452 Ga0068856_100052570
453 Ga0070702_100433507
454 Ga0068852_100051385
455 Ga0068852_100292081
456 Ga0068852_100369783
457 Ga0068852_100493456
458 Ga0068859_100010927
459 Ga0068859_100168890
460 Ga0068864_100000464
461 Ga0068864_100586777
462 Ga0068864_102051685
463 Ga0068866_10212238
464 Ga0068866_10364218
465 Ga0068861_100002003
466 Ga0068861_100107779
467 Ga0068851_10078495
468 Ga0068870_10137764
469 Ga0068863_100008475
470 Ga0068858_100001151
471 Ga0068860_100006511
472 Ga0068860_100057960
473 Ga0068862_100003437
474 Ga0068862_100763577
475 Ga0075365_10032052
476 Ga0075368_10125430
477 Ga0075363_100005370
478 Ga0075363_100471720
479 Ga0075364_10416958
480 Ga0075432_10018383
481 Ga0075362_10000908
482 Ga0075362_10003472
483 Ga0075362_10037144
484 Ga0075367_10011470
485 Ga0075367_10074207
486 Ga0075369_10093210
487 Ga0075369_10160901
488 Ga0075366_10001307
489 Ga0075366_10017718
490 Ga0075366_10039358
491 Ga0075366_10147488
492 Ga0075366_10296425
493 Ga0075366_10540798
494 Ga0097621_101474674
495 Ga0075370_10002949
496 Ga0075370_10133056
497 Ga0075370_10169790
498 Ga0075370_10610232
499 Ga0068871_100066052
500 Ga0068871_100153178
501 Ga0068865_100001816
502 Ga0097620_100010927
503 Ga0097620_100168886
504 Ga0105240_10002253
505 Ga0111539_10666748
506 Ga0105245_11601992
507 Ga0114129_10996265
508 Ga0105243_10121650
509 Ga0105243_11643085
510 Ga0105242_10482792
511 Ga0105248_10009399
512 Ga0105248_10009954
513 Ga0105248_10085292
514 Ga0105248_10122174
515 Ga0105248_11014008
516 Ga0105237_10221811
517 Ga0105238_10482947
518 Ga0105249_10214546
519 Ga0157327_1009174
520 Ga0157371_10189197
521 Ga0157370_10068906
522 Ga0157374_10066722
523 Ga0157378_10386295
524 Ga0157378_11221189
525 Ga0163162_10006914
526 Ga0163162_10604546
527 Ga0163162_11808495
528 Ga0163162_11813753
529 Ga0157372_10481099
530 Ga0157375_10107173
531 Ga0157375_10228112
532 Ga0157375_10369140
533 Ga0157375_10670648
534 Ga0163163_10002467
535 Ga0163163_10123610
536 Ga0157380_10376554
537 Ga0157380_10622340
538 Ga0157380_11046341
539 Ga0182008_10512329
540 Ga0157377_10165397
541 Ga0157379_10002968
542 Ga0157379_10047309
543 Ga0157379_10583457
544 Ga0157376_10032449
545 Ga0157376_10035844
546 Ga0157376_12967817
547 Ga0182006_1062648
548 Ga0163161_10047599
549 Ga0209758_1061314
550 Ga0209051_1007313
551 Ga0207697_10095668
552 Ga0207656_10023795
553 Ga0207642_10085023
554 Ga0207688_10177935
555 Ga0207680_10002054
556 Ga0207705_10092592
557 Ga0207684_10043823
558 Ga0207695_10514793
559 Ga0207695_11000521
560 Ga0207671_10001494
561 Ga0207671_10095834
562 Ga0207671_10242860
563 Ga0207657_10050829
564 Ga0207657_10441326
565 Ga0207646_10095475
566 Ga0207681_10123884
567 Ga0207681_10741409
568 Ga0207694_10137674
569 Ga0207650_10001449
570 Ga0207650_10157781
571 Ga0207659_10017484
572 Ga0207659_10018651
573 Ga0207659_10968741
574 Ga0207687_10339200
575 Ga0207644_10006232
576 Ga0207644_10014080
577 Ga0207644_10609561
578 Ga0207644_10874683
579 Ga0207690_10231090
580 Ga0207690_11346391
581 Ga0207706_10012594
582 Ga0207706_10019520
583 Ga0207686_10192454
584 Ga0207709_10079526
585 Ga0207709_10484532
586 Ga0207670_10318223
587 Ga0207669_10040988
588 Ga0207704_10021053
589 Ga0207704_10180599
590 Ga0207704_10225368
591 Ga0207691_10008129
592 Ga0207691_10012805
593 Ga0207691_10199155
594 Ga0207691_10564967
595 Ga0207691_11016116
596 Ga0207711_10008052
597 Ga0207711_10033319
598 Ga0207711_10045756
599 Ga0207711_10540823
600 Ga0207711_10712655
601 Ga0207689_10009366
602 Ga0207689_10041237
603 Ga0207679_10014112
604 Ga0207679_10343997
605 Ga0207651_10007161
606 Ga0207651_10193094
607 Ga0207668_10089939
608 Ga0207668_10658837
609 Ga0207658_10007319
610 Ga0207658_10136473
611 Ga0207658_10329574
612 Ga0207658_10781357
613 Ga0207677_10000685
614 Ga0207703_10000731
615 Ga0207703_10401214
616 Ga0207639_10857225
617 Ga0207639_11602815
618 Ga0207678_10050553
619 Ga0207678_11026423
620 Ga0207708_10191181
621 Ga0207708_10341872
622 Ga0207702_10033477
623 Ga0207641_10019046
624 Ga0207641_10309256
625 Ga0207641_10660946
626 Ga0207641_11670000
627 Ga0207648_10000799
628 Ga0207648_10026420
629 Ga0207648_10046190
630 Ga0207648_10047502
631 Ga0207648_10803855
632 Ga0207648_11551718
633 Ga0207676_10004351
634 Ga0207676_10463375
635 Ga0207676_11761829
636 Ga0207674_10012009
637 Ga0207675_100001875
638 Ga0207675_100103048
639 Ga0207683_10006275
640 Ga0207683_11002204
641 Ga0207698_10013427
642 Ga0207698_10564937
643 Ga0207698_10722292
644 Ga0207698_11560809
645 Ga0207698_11610712
646 Ga0209813_10094748
647 Ga0207428_10508896
648 Ga0268265_10002373
649 Ga0268265_10862868
650 Ga0268264_10045547
651 Ga0268264_10390160
652 Ga0268264_10921946
653 Ga0268264_11387259
654 Ga0307515_10000011
655 Ga0307515_10001417
656 Ga0307515_10785221
657 Ga0307512_10162498
658 Ga0307509_10002501
659 Ga0307509_10175837
660 Ga0307408_100000026
661 Ga0307408_100030474
662 Ga0307408_100198677
663 Ga0307408_100297605
664 Ga0307408_100460393
665 Ga0307408_102189479
666 Ga0307508_10174426
667 Ga0265342_10135983
668 Ga0307405_10108972
669 Ga0307406_11958933
670 Ga0307412_10101254
671 Ga0307412_10237531
672 Ga0307416_100389053
673 Ga0307416_101722568
674 Ga0307411_10000039
675 Ga0307411_11201378
676 Ga0307507_10077396
677 Ga0373948_0017258
678 Ga0373950_0014874
679 Ga0373959_0045369
680 Ga0373951_0003857
681 Ga0373939_0000009
682 Ga0373961_0009153
683 Ga0373962_0086809
684 Ga0373931_0000526
685 Ga0373947_0475541
686 Ga0373925_0346412
687 Ga0439436_0230014
688 Ga0439439_0013292
689 Ga0439461_0144796
690 Ga0439466_0045706
691 Ga0439466_0161008
692 Ga0451791_1572732
693 Ga0451802_0935317
694 Ga0451853_2657684
695 Ga0439431_0083828
696 Ga0439433_0036682
697 Ga0439442_024286
698 Ga0439449_0006607
699 Ga0439452_005934
700 Ga0439457_025007
701 Ga0439462_0012179
702 Ga0450921_003593
703 Ga0450890_005325
704 Ga0450906_008793
705 Ga0450906_012532
706 Ga0450909_005052
707 Ga0439434_0006925
708 Ga0450918_008052
709 Ga0466969_0422169
710 Ga0453684_0102601
711 Ga0451576_0109514
712 Ga0495603_0215328
713 Ga0495618_0909320
714 Ga0495628_0975190
715 Ga0495598_0009293
716 Ga0495621_0060897
717 Ga0495597_0113595
718 Ga0495645_0074003
719 Ga0495625_0001579
720 Ga0495671_0099088
721 Ga0495614_0441435
722 Ga0496104_0105730
723 Ga0496108_0026142
724 Ga0496108_0307489
725 Ga0496108_0801023
726 Ga0496109_0782380
727 Ga0496109_1890861
728 Ga0496112_0238650
729 Ga0496114_0114693
730 Ga0501290_036030
731 Ga0501293_031612
732 Ga0501297_006894
733 Ga0501301_005979
734 Ga0501202_038395
735 Ga0501211_008109
736 Ga0501217_142729
737 Ga0501222_001561
738 Ga0501222_013352
739 Ga0501235_010971
740 Ga0501236_066943
741 Ga0501253_090772
742 Ga0501255_008712
743 Ga0501257_002232
744 Ga0501258_048931
745 Ga0501221_000056
746 Ga0501225_0052912
747 Ga0501265_065427
748 Ga0501268_054663
749 Ga0501271_030571
750 Ga0501272_001154
751 Ga0501280_004001
752 Ga0501282_003392
753 Ga0501283_030302
754 Ga0501035_0121608
755 Ga0501204_053868
756 nmdc:mga03n38_311187_c1
757 nmdc:mga03n38_329638_c1
758 nmdc:mga00v17_645856_c1
759 nmdc:mga0k408_25703_c1
760 nmdc:mga0k408_33214_c1
761 nmdc:mga0k408_346092_c1
762 nmdc:mga0k408_39956_c1
763 nmdc:mga0k408_51647_c1
764 nmdc:mga06z11_148216_c1
765 nmdc:mga06z11_477048_c1
766 nmdc:mga04h51_107477_c1
767 nmdc:mga07m45_29018_c1
768 nmdc:mga07m45_45942_c1
769 nmdc:mga05p37_573520_c1
770 nmdc:mga0sz30_25544_c1
771 Ga0500648_361630
772 Ga0500608_039614
773 Ga0500626_035211
774 Ga0500559_0034096
775 Ga0500574_100676
776 Ga0500619_194627
777 Ga0500620_262783
778 Ga0590071_080706
779 2587736348
780 2644217863
781 2644258400
782 2644398180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

16

89

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8br1-assembly2.cif.gz_C exoy nucleotidyl cyclase domain from vibrio nigripulchritudo martx toxin, bound to latrunculin-b-atp-mg-actin, and 3'-deoxyadenosine-5'-triphosphate and 2 mg ions 0.8559 64 89
8oi8-assembly1.cif.gz_C cryo-em structure of adp-bound, filamentous beta-actin harboring the r183w mutation 0.8536 64 89
8oid-assembly1.cif.gz_C cryo-em structure of adp-bound, filamentous beta-actin harboring the n111s mutation 0.8507 64 89
4k42-assembly3.cif.gz_C crystal structure of actin in complex with synthetic aplc tail analogue sf01 [(3r,4s,5r,6s,10r,11r,12r)-11-(acetyloxy)-1-(benzyloxy)-14-[formyl(methyl)amino]-5-hydroxy-4,6,10,12-tetramethyl-9-oxotetradecan-3-yl propanoate] 0.8345 64 89
4k42-assembly1.cif.gz_A crystal structure of actin in complex with synthetic aplc tail analogue sf01 [(3r,4s,5r,6s,10r,11r,12r)-11-(acetyloxy)-1-(benzyloxy)-14-[formyl(methyl)amino]-5-hydroxy-4,6,10,12-tetramethyl-9-oxotetradecan-3-yl propanoate] 0.8344 64 89
ID Description Score Start End Superfamily
af_I1J4N8_26_113_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8614 40 91 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8155 22 106 3.30.300.130
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7843 9 107 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7813 22 106 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7431 10 107 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A3D5E1D2-F1-model_v4 Hydroxylase 0.9261 37 107
AF-A0A7X6DC52-F1-model_v4 Metal-sulfur cluster assembly factor 0.8999 2 107
AF-A0A832JNE1-F1-model_v4 DUF59 domain-containing protein 0.8961 37 106
AF-A0A069IHN9-F1-model_v4 Hydroxylase 0.8905 3 107
AF-A0A0Q7SN93-F1-model_v4 Hydroxylase 0.8885 1 107

Map