F432102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 391 | 235 | 391 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300041458|Ga0451798_0417413|Ga0451798_0417413_14_535 |
| Length | 173 |
| Sequence | VSQARLPFDGDERSIDEITIFCDGGSRGNPGPAAVGAVVLDATTDPPTRVASVSETIGVTTNNVAEYRALLLALDRAERRGASEVWIESDSLLLVEQILGRFRVKATHLQPLFAEALRRAKTFPKFAIRHVRREQNVDADRLANLGADESERLLAAATAGDASPWGGDTAPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 124 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 130 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 133 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 141 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 148 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 182 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 219 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.53 |
| Nodule | 0 |
| Rhizoplane | 8.18 |
| Rhizosphere | 89.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100552762 | 3300005329 | Bacteria | 1101 |
| 2 | Ga0070670_100017339 | 3300005331 | Bacteria | 6176 |
| 3 | Ga0070677_10221476 | 3300005333 | Bacteria | 924 |
| 4 | Ga0070666_10001310 | 3300005335 | Bacteria | 15070 |
| 5 | Ga0070680_101186446 | 3300005336 | Bacteria | 660 |
| 6 | Ga0070682_100143732 | 3300005337 | Bacteria | 1629 |
| 7 | Ga0068868_100035138 | 3300005338 | Bacteria | 3873 |
| 8 | Ga0070689_100128551 | 3300005340 | Bacteria | 2030 |
| 9 | Ga0070689_100443807 | 3300005340 | Bacteria | 1103 |
| 10 | Ga0070687_100836318 | 3300005343 | Bacteria | 655 |
| 11 | Ga0070675_100076334 | 3300005354 | Bacteria | 2787 |
| 12 | Ga0070671_100040229 | 3300005355 | Bacteria | 3882 |
| 13 | Ga0070674_100044408 | 3300005356 | Bacteria | 3029 |
| 14 | Ga0070674_100168970 | 3300005356 | Bacteria | 1666 |
| 15 | Ga0070673_100607184 | 3300005364 | Bacteria | 998 |
| 16 | Ga0070673_102100116 | 3300005364 | Bacteria | 537 |
| 17 | Ga0070688_100077588 | 3300005365 | Bacteria | 2140 |
| 18 | Ga0070667_100000501 | 3300005367 | Bacteria | 39630 |
| 19 | Ga0070667_100218922 | 3300005367 | Bacteria | 1694 |
| 20 | Ga0070667_100799566 | 3300005367 | Bacteria | 875 |
| 21 | Ga0070709_10105725 | 3300005434 | Bacteria | 1883 |
| 22 | Ga0070713_100189022 | 3300005436 | Bacteria | 1855 |
| 23 | Ga0070713_100789919 | 3300005436 | Bacteria | 910 |
| 24 | Ga0070713_100950349 | 3300005436 | Bacteria | 828 |
| 25 | Ga0070710_10015936 | 3300005437 | Bacteria | 3813 |
| 26 | Ga0070701_10510238 | 3300005438 | Bacteria | 782 |
| 27 | Ga0070705_100076928 | 3300005440 | Bacteria | 2036 |
| 28 | Ga0070705_100852864 | 3300005440 | Bacteria | 729 |
| 29 | Ga0070700_100021860 | 3300005441 | Bacteria | 3723 |
| 30 | Ga0070700_100099142 | 3300005441 | Unclassified | 1916 |
| 31 | Ga0070708_100008308 | 3300005445 | Bacteria | 8336 |
| 32 | Ga0070663_100005698 | 3300005455 | Bacteria | 7423 |
| 33 | Ga0070663_100090740 | 3300005455 | Bacteria | 2263 |
| 34 | Ga0070678_100026234 | 3300005456 | Bacteria | 3936 |
| 35 | Ga0070678_100094210 | 3300005456 | Bacteria | 2305 |
| 36 | Ga0070678_100391371 | 3300005456 | Bacteria | 1205 |
| 37 | Ga0070662_100440646 | 3300005457 | Bacteria | 1080 |
| 38 | Ga0068867_100005233 | 3300005459 | Bacteria | 9156 |
| 39 | Ga0070706_100006037 | 3300005467 | Bacteria | 11445 |
| 40 | Ga0070706_100042550 | 3300005467 | Bacteria | 4197 |
| 41 | Ga0070707_100060973 | 3300005468 | Bacteria | 3618 |
| 42 | Ga0070707_100157213 | 3300005468 | Bacteria | 2215 |
| 43 | Ga0070707_100631328 | 3300005468 | Bacteria | 1034 |
| 44 | Ga0070698_100059312 | 3300005471 | Bacteria | 3865 |
| 45 | Ga0070698_100073448 | 3300005471 | Bacteria | 3427 |
| 46 | Ga0070699_100016464 | 3300005518 | Bacteria | 6350 |
| 47 | Ga0070679_101098686 | 3300005530 | Bacteria | 740 |
| 48 | Ga0070684_100553810 | 3300005535 | Bacteria | 1067 |
| 49 | Ga0070684_100666791 | 3300005535 | Bacteria | 969 |
| 50 | Ga0070697_100046479 | 3300005536 | Bacteria | 3518 |
| 51 | Ga0068853_100396993 | 3300005539 | Bacteria | 1290 |
| 52 | Ga0070672_100003014 | 3300005543 | Bacteria | 10851 |
| 53 | Ga0070672_100253182 | 3300005543 | Bacteria | 1483 |
| 54 | Ga0070686_100079416 | 3300005544 | Bacteria | 2169 |
| 55 | Ga0070686_100394983 | 3300005544 | Bacteria | 1050 |
| 56 | Ga0070665_100046658 | 3300005548 | Bacteria | 4350 |
| 57 | Ga0070665_101524638 | 3300005548 | Bacteria | 677 |
| 58 | Ga0070704_100068012 | 3300005549 | Bacteria | 2575 |
| 59 | Ga0070704_100217225 | 3300005549 | Unclassified | 1552 |
| 60 | Ga0070664_100009123 | 3300005564 | Bacteria | 8052 |
| 61 | Ga0070664_100367353 | 3300005564 | Bacteria | 1311 |
| 62 | Ga0068856_100004897 | 3300005614 | Bacteria | 13255 |
| 63 | Ga0068856_101659678 | 3300005614 | Bacteria | 652 |
| 64 | Ga0070702_100050210 | 3300005615 | Bacteria | 2382 |
| 65 | Ga0068859_100000791 | 3300005617 | Bacteria | 32046 |
| 66 | Ga0068864_100040347 | 3300005618 | Bacteria | 3993 |
| 67 | Ga0068864_101291201 | 3300005618 | Unclassified | 730 |
| 68 | Ga0068866_10019852 | 3300005718 | Bacteria | 3068 |
| 69 | Ga0068866_11431197 | 3300005718 | Bacteria | 506 |
| 70 | Ga0068863_100161977 | 3300005841 | Bacteria | 2143 |
| 71 | Ga0068863_100739971 | 3300005841 | Bacteria | 979 |
| 72 | Ga0068863_101594304 | 3300005841 | Bacteria | 662 |
| 73 | Ga0068858_100002206 | 3300005842 | Bacteria | 19715 |
| 74 | Ga0068858_100423022 | 3300005842 | Bacteria | 1281 |
| 75 | Ga0068858_100775515 | 3300005842 | Bacteria | 935 |
| 76 | Ga0068860_100002468 | 3300005843 | Bacteria | 19416 |
| 77 | Ga0068860_100726479 | 3300005843 | Bacteria | 1004 |
| 78 | Ga0068860_100828656 | 3300005843 | Bacteria | 939 |
| 79 | Ga0081455_10170103 | 3300005937 | Bacteria | 1661 |
| 80 | Ga0070717_10046096 | 3300006028 | Bacteria | 3566 |
| 81 | Ga0070717_10728650 | 3300006028 | Bacteria | 901 |
| 82 | Ga0075368_10389337 | 3300006042 | Bacteria | 611 |
| 83 | Ga0075363_100037185 | 3300006048 | Bacteria | 2556 |
| 84 | Ga0075432_10106481 | 3300006058 | Bacteria | 1041 |
| 85 | Ga0070712_100070607 | 3300006175 | Bacteria | 2496 |
| 86 | Ga0075367_10287043 | 3300006178 | Bacteria | 1035 |
| 87 | Ga0097621_100085277 | 3300006237 | Bacteria | 2634 |
| 88 | Ga0097621_100280937 | 3300006237 | Bacteria | 1465 |
| 89 | Ga0068871_100124951 | 3300006358 | Bacteria | 2177 |
| 90 | Ga0075428_100028787 | 3300006844 | Bacteria | 6148 |
| 91 | Ga0075428_100080758 | 3300006844 | Bacteria | 3549 |
| 92 | Ga0075428_100167620 | 3300006844 | Bacteria | 2382 |
| 93 | Ga0075430_100011703 | 3300006846 | Bacteria | 7467 |
| 94 | Ga0075430_100146508 | 3300006846 | Bacteria | 1966 |
| 95 | Ga0075430_100707235 | 3300006846 | Bacteria | 831 |
| 96 | Ga0075430_101186349 | 3300006846 | Bacteria | 628 |
| 97 | Ga0075431_100010606 | 3300006847 | Bacteria | 9267 |
| 98 | Ga0075431_100627759 | 3300006847 | Bacteria | 1056 |
| 99 | Ga0075431_100858541 | 3300006847 | Unclassified | 879 |
| 100 | Ga0075433_10012899 | 3300006852 | Bacteria | 6773 |
| 101 | Ga0075434_100285222 | 3300006871 | Bacteria | 1671 |
| 102 | Ga0075429_100527529 | 3300006880 | Bacteria | 1035 |
| 103 | Ga0068865_100027750 | 3300006881 | Bacteria | 3743 |
| 104 | Ga0075436_100002602 | 3300006914 | Bacteria | 12397 |
| 105 | Ga0097620_100000791 | 3300006931 | Bacteria | 32046 |
| 106 | Ga0075435_100017441 | 3300007076 | Bacteria | 5437 |
| 107 | Ga0075435_100548380 | 3300007076 | Bacteria | 1001 |
| 108 | Ga0105240_10761935 | 3300009093 | Bacteria | 1051 |
| 109 | Ga0111539_10184005 | 3300009094 | Bacteria | 2440 |
| 110 | Ga0111539_10330232 | 3300009094 | Archaea | 1775 |
| 111 | Ga0111539_10455533 | 3300009094 | Bacteria | 1490 |
| 112 | Ga0111539_11087677 | 3300009094 | Bacteria | 929 |
| 113 | Ga0111539_11372407 | 3300009094 | Bacteria | 820 |
| 114 | Ga0105245_10032815 | 3300009098 | Bacteria | 4598 |
| 115 | Ga0105245_10396536 | 3300009098 | Bacteria | 1378 |
| 116 | Ga0105245_10584761 | 3300009098 | Bacteria | 1141 |
| 117 | Ga0105245_11084734 | 3300009098 | Bacteria | 847 |
| 118 | Ga0105245_11580923 | 3300009098 | Bacteria | 707 |
| 119 | Ga0105247_10806380 | 3300009101 | Bacteria | 717 |
| 120 | Ga0114129_10173887 | 3300009147 | Bacteria | 2934 |
| 121 | Ga0114129_10330494 | 3300009147 | Bacteria | 2024 |
| 122 | Ga0114129_10395486 | 3300009147 | Bacteria | 1822 |
| 123 | Ga0114129_10901711 | 3300009147 | Unclassified | 1120 |
| 124 | Ga0114129_11000185 | 3300009147 | Bacteria | 1053 |
| 125 | Ga0105243_10110266 | 3300009148 | Bacteria | 2301 |
| 126 | Ga0105243_10111302 | 3300009148 | Bacteria | 2292 |
| 127 | Ga0105243_10297386 | 3300009148 | Bacteria | 1461 |
| 128 | Ga0105242_10109790 | 3300009176 | Bacteria | 2349 |
| 129 | Ga0105242_11422217 | 3300009176 | Bacteria | 722 |
| 130 | Ga0105248_10001409 | 3300009177 | Bacteria | 26858 |
| 131 | Ga0105248_10369653 | 3300009177 | Bacteria | 1614 |
| 132 | Ga0105248_11079081 | 3300009177 | Bacteria | 907 |
| 133 | Ga0105249_10183221 | 3300009553 | Bacteria | 2039 |
| 134 | Ga0105249_10898772 | 3300009553 | Bacteria | 952 |
| 135 | Ga0105249_11474206 | 3300009553 | Archaea | 753 |
| 136 | Ga0105239_10482611 | 3300010375 | Bacteria | 1408 |
| 137 | Ga0105246_10033177 | 3300011119 | Bacteria | 3430 |
| 138 | Ga0157374_10008791 | 3300013296 | Bacteria | 8642 |
| 139 | Ga0157378_10009416 | 3300013297 | Bacteria | 8510 |
| 140 | Ga0157378_10030178 | 3300013297 | Bacteria | 4790 |
| 141 | Ga0157375_10046892 | 3300013308 | Bacteria | 4216 |
| 142 | Ga0157375_10176470 | 3300013308 | Bacteria | 2286 |
| 143 | Ga0157375_11233881 | 3300013308 | Bacteria | 878 |
| 144 | Ga0157375_11372597 | 3300013308 | Bacteria | 832 |
| 145 | Ga0157375_11717391 | 3300013308 | Archaea | 743 |
| 146 | Ga0157375_11949949 | 3300013308 | Unclassified | 698 |
| 147 | Ga0163163_10102671 | 3300014325 | Bacteria | 2883 |
| 148 | Ga0163163_10566633 | 3300014325 | Bacteria | 1199 |
| 149 | Ga0163163_11223820 | 3300014325 | Bacteria | 813 |
| 150 | Ga0163163_11651778 | 3300014325 | Bacteria | 701 |
| 151 | Ga0157377_10205173 | 3300014745 | Bacteria | 1254 |
| 152 | Ga0157377_10606685 | 3300014745 | Archaea | 781 |
| 153 | Ga0157379_10000133 | 3300014968 | Bacteria | 52942 |
| 154 | Ga0157379_11070470 | 3300014968 | Bacteria | 771 |
| 155 | Ga0157376_10009389 | 3300014969 | Bacteria | 7105 |
| 156 | Ga0157376_10138756 | 3300014969 | Bacteria | 2179 |
| 157 | Ga0157376_10545818 | 3300014969 | Bacteria | 1146 |
| 158 | Ga0157376_12162222 | 3300014969 | Bacteria | 595 |
| 159 | Ga0163161_11182502 | 3300017792 | Bacteria | 660 |
| 160 | Ga0206353_10074878 | 3300020082 | Bacteria | 1127 |
| 161 | Ga0207710_10347161 | 3300025900 | Bacteria | 755 |
| 162 | Ga0207680_10385018 | 3300025903 | Bacteria | 989 |
| 163 | Ga0207685_10060143 | 3300025905 | Bacteria | 1501 |
| 164 | Ga0207699_10051328 | 3300025906 | Bacteria | 2437 |
| 165 | Ga0207684_10011021 | 3300025910 | Bacteria | 7924 |
| 166 | Ga0207693_10654690 | 3300025915 | Bacteria | 816 |
| 167 | Ga0207663_10756929 | 3300025916 | Bacteria | 772 |
| 168 | Ga0207662_11008318 | 3300025918 | Bacteria | 591 |
| 169 | Ga0207646_10503265 | 3300025922 | Bacteria | 1091 |
| 170 | Ga0207650_10423229 | 3300025925 | Bacteria | 1105 |
| 171 | Ga0207687_10148136 | 3300025927 | Bacteria | 1788 |
| 172 | Ga0207687_10327140 | 3300025927 | Bacteria | 1242 |
| 173 | Ga0207700_10180591 | 3300025928 | Bacteria | 1767 |
| 174 | Ga0207644_10064011 | 3300025931 | Bacteria | 2671 |
| 175 | Ga0207644_10358377 | 3300025931 | Unclassified | 1186 |
| 176 | Ga0207690_10622269 | 3300025932 | Bacteria | 883 |
| 177 | Ga0207686_10054979 | 3300025934 | Bacteria | 2495 |
| 178 | Ga0207709_10346548 | 3300025935 | Bacteria | 1120 |
| 179 | Ga0207709_10796016 | 3300025935 | Bacteria | 763 |
| 180 | Ga0207670_10219314 | 3300025936 | Bacteria | 1455 |
| 181 | Ga0207669_10142961 | 3300025937 | Bacteria | 1664 |
| 182 | Ga0207704_10107378 | 3300025938 | Bacteria | 1878 |
| 183 | Ga0207665_10160229 | 3300025939 | Bacteria | 1618 |
| 184 | Ga0207691_10345576 | 3300025940 | Archaea | 1273 |
| 185 | Ga0207651_11306074 | 3300025960 | Bacteria | 652 |
| 186 | Ga0207712_10163557 | 3300025961 | Bacteria | 1732 |
| 187 | Ga0207677_10066876 | 3300026023 | Bacteria | 2515 |
| 188 | Ga0207703_10166208 | 3300026035 | Unclassified | 1936 |
| 189 | Ga0207678_10058349 | 3300026067 | Bacteria | 3321 |
| 190 | Ga0207708_10122790 | 3300026075 | Unclassified | 2024 |
| 191 | Ga0207708_10588825 | 3300026075 | Bacteria | 941 |
| 192 | Ga0207641_11212149 | 3300026088 | Bacteria | 754 |
| 193 | Ga0207648_10450653 | 3300026089 | Bacteria | 1172 |
| 194 | Ga0207676_10126753 | 3300026095 | Bacteria | 2163 |
| 195 | Ga0207683_10033508 | 3300026121 | Bacteria | 4461 |
| 196 | Ga0207683_10113597 | 3300026121 | Bacteria | 2426 |
| 197 | Ga0207698_10395266 | 3300026142 | Bacteria | 1319 |
| 198 | Ga0209813_10385888 | 3300027866 | Bacteria | 561 |
| 199 | Ga0268266_10371748 | 3300028379 | Bacteria | 1346 |
| 200 | Ga0268266_10501690 | 3300028379 | Bacteria | 1159 |
| 201 | Ga0268266_10735123 | 3300028379 | Bacteria | 952 |
| 202 | Ga0268264_11009014 | 3300028381 | Bacteria | 839 |
| 203 | Ga0268264_11369394 | 3300028381 | Bacteria | 718 |
| 204 | Ga0265338_10001315 | 3300028800 | Bacteria | 40706 |
| 205 | Ga0265338_10329169 | 3300028800 | Bacteria | 1104 |
| 206 | Ga0265325_10002817 | 3300031241 | Bacteria | 11598 |
| 207 | Ga0265339_10008331 | 3300031249 | Bacteria | 6601 |
| 208 | Ga0265339_10042711 | 3300031249 | Bacteria | 2510 |
| 209 | Ga0265331_10150217 | 3300031250 | Bacteria | 1058 |
| 210 | Ga0265327_10003836 | 3300031251 | Bacteria | 13876 |
| 211 | Ga0265327_10033861 | 3300031251 | Bacteria | 2841 |
| 212 | Ga0265327_10036653 | 3300031251 | Bacteria | 2693 |
| 213 | Ga0265327_10051324 | 3300031251 | Bacteria | 2154 |
| 214 | Ga0265327_10103403 | 3300031251 | Bacteria | 1371 |
| 215 | Ga0265313_10001049 | 3300031595 | Bacteria | 26890 |
| 216 | Ga0265313_10206170 | 3300031595 | Bacteria | 816 |
| 217 | Ga0265314_10107654 | 3300031711 | Bacteria | 1778 |
| 218 | Ga0265314_10112990 | 3300031711 | Bacteria | 1723 |
| 219 | Ga0316577_10302693 | 3300031733 | Bacteria | 906 |
| 220 | Ga0373944_0108839 | 3300035089 | Bacteria | 944 |
| 221 | Ga0373944_0202651 | 3300035089 | Bacteria | 719 |
| 222 | Ga0373923_0027399 | 3300035111 | Bacteria | 2274 |
| 223 | Ga0373939_0236847 | 3300035114 | Bacteria | 705 |
| 224 | Ga0373956_0326982 | 3300035119 | Bacteria | 731 |
| 225 | Ga0373943_0156197 | 3300035170 | Bacteria | 1239 |
| 226 | Ga0373946_0085560 | 3300035171 | Unclassified | 1388 |
| 227 | Ga0373955_0081492 | 3300035172 | Bacteria | 1830 |
| 228 | Ga0316574_0052565 | 3300035398 | Bacteria | 2541 |
| 229 | Ga0373931_0038224 | 3300035691 | Bacteria | 2510 |
| 230 | Ga0373935_0164695 | 3300035692 | Bacteria | 1513 |
| 231 | Ga0373935_0251087 | 3300035692 | Bacteria | 1238 |
| 232 | Ga0373927_0227264 | 3300035695 | Bacteria | 1226 |
| 233 | Ga0373933_0236928 | 3300035724 | Bacteria | 1173 |
| 234 | Ga0373947_0307923 | 3300035725 | Bacteria | 1057 |
| 235 | Ga0373947_1042459 | 3300035725 | Bacteria | 558 |
| 236 | Ga0373937_0782469 | 3300036401 | Bacteria | 902 |
| 237 | Ga0373937_0860054 | 3300036401 | Bacteria | 855 |
| 238 | Ga0316584_0501250 | 3300036712 | Bacteria | 853 |
| 239 | Ga0373925_0376105 | 3300037068 | Bacteria | 1156 |
| 240 | Ga0436365_1597653 | 3300039437 | Unclassified | 547 |
| 241 | Ga0436365_1907222 | 3300039437 | Bacteria | 878 |
| 242 | Ga0451798_0417413 | 3300041458 | Bacteria | 750 |
| 243 | Ga0495592_0334753 | 3300046454 | Bacteria | 975 |
| 244 | Ga0495603_0459355 | 3300046455 | Archaea | 729 |
| 245 | Ga0495641_0518866 | 3300046461 | Bacteria | 544 |
| 246 | Ga0495653_0976832 | 3300046463 | Bacteria | 502 |
| 247 | Ga0495605_0396013 | 3300046474 | Bacteria | 575 |
| 248 | Ga0495664_0951435 | 3300046477 | Bacteria | 501 |
| 249 | Ga0495585_0389601 | 3300046492 | Bacteria | 672 |
| 250 | Ga0495596_0202632 | 3300046500 | Bacteria | 771 |
| 251 | Ga0495583_0280217 | 3300046506 | Bacteria | 665 |
| 252 | Ga0495608_0289059 | 3300046511 | Bacteria | 1016 |
| 253 | Ga0495608_0444885 | 3300046511 | Bacteria | 789 |
| 254 | Ga0495630_0604692 | 3300046517 | Bacteria | 840 |
| 255 | Ga0495630_0642083 | 3300046517 | Bacteria | 813 |
| 256 | Ga0495666_0357820 | 3300046526 | Bacteria | 657 |
| 257 | Ga0495640_0224774 | 3300046533 | Bacteria | 1183 |
| 258 | Ga0495586_0422407 | 3300046535 | Bacteria | 768 |
| 259 | Ga0495622_0452340 | 3300046557 | Bacteria | 551 |
| 260 | Ga0495667_0254014 | 3300046559 | Bacteria | 1119 |
| 261 | Ga0495668_0144530 | 3300046616 | Bacteria | 1302 |
| 262 | Ga0495668_0525483 | 3300046616 | Bacteria | 653 |
| 263 | Ga0495634_0417856 | 3300046642 | Bacteria | 795 |
| 264 | Ga0495635_0135301 | 3300046663 | Bacteria | 1680 |
| 265 | Ga0495635_0182833 | 3300046663 | Bacteria | 1424 |
| 266 | Ga0495657_0309396 | 3300046675 | Bacteria | 941 |
| 267 | Ga0495647_0105446 | 3300046681 | Archaea | 1171 |
| 268 | Ga0495647_0298672 | 3300046681 | Bacteria | 726 |
| 269 | Ga0495658_0207500 | 3300046683 | Unclassified | 1223 |
| 270 | Ga0495613_0210129 | 3300046689 | Unclassified | 1369 |
| 271 | Ga0495613_0938223 | 3300046689 | Bacteria | 558 |
| 272 | Ga0495670_0101400 | 3300046691 | Bacteria | 1483 |
| 273 | Ga0495600_0556997 | 3300046809 | Bacteria | 700 |
| 274 | Ga0495581_0305825 | 3300047315 | Bacteria | 929 |
| 275 | Ga0495604_0309921 | 3300047317 | Bacteria | 1058 |
| 276 | Ga0495674_0138370 | 3300047319 | Bacteria | 2048 |
| 277 | Ga0495674_0534270 | 3300047319 | Bacteria | 935 |
| 278 | Ga0495674_0741737 | 3300047319 | Unclassified | 768 |
| 279 | Ga0495672_0292152 | 3300047320 | Bacteria | 775 |
| 280 | Ga0495676_0048540 | 3300047321 | Bacteria | 3422 |
| 281 | Ga0495676_0054307 | 3300047321 | Archaea | 3186 |
| 282 | Ga0495676_0215164 | 3300047321 | Bacteria | 1327 |
| 283 | Ga0495680_0277002 | 3300047322 | Bacteria | 1183 |
| 284 | Ga0495684_0239730 | 3300047471 | Bacteria | 1323 |
| 285 | Ga0496101_0017087 | 3300048904 | Bacteria | 4914 |
| 286 | Ga0496102_0072310 | 3300048905 | Bacteria | 3169 |
| 287 | Ga0496102_1181667 | 3300048905 | Bacteria | 684 |
| 288 | Ga0496102_1350648 | 3300048905 | Archaea | 632 |
| 289 | Ga0496103_0202923 | 3300048906 | Bacteria | 1275 |
| 290 | Ga0496103_0795427 | 3300048906 | Unclassified | 597 |
| 291 | Ga0496104_0028154 | 3300048907 | Bacteria | 5207 |
| 292 | Ga0496104_0192225 | 3300048907 | Bacteria | 1953 |
| 293 | Ga0496104_0437005 | 3300048907 | Bacteria | 1220 |
| 294 | Ga0496105_0015649 | 3300048908 | Bacteria | 6050 |
| 295 | Ga0496105_0026117 | 3300048908 | Bacteria | 4760 |
| 296 | Ga0496105_0127297 | 3300048908 | Bacteria | 2100 |
| 297 | Ga0496107_0024874 | 3300048910 | Bacteria | 4238 |
| 298 | Ga0496108_0003643 | 3300048911 | Bacteria | 12350 |
| 299 | Ga0496108_0387198 | 3300048911 | Unclassified | 1221 |
| 300 | Ga0496109_0169990 | 3300048912 | Bacteria | 2044 |
| 301 | Ga0496109_0216536 | 3300048912 | Bacteria | 1801 |
| 302 | Ga0496109_0843475 | 3300048912 | Bacteria | 854 |
| 303 | Ga0496109_1365572 | 3300048912 | Bacteria | 644 |
| 304 | Ga0496109_1998907 | 3300048912 | Bacteria | 512 |
| 305 | Ga0496110_0021032 | 3300048913 | Bacteria | 5515 |
| 306 | Ga0496110_0383603 | 3300048913 | Bacteria | 1281 |
| 307 | Ga0496110_1310614 | 3300048913 | Unclassified | 633 |
| 308 | Ga0496111_0827507 | 3300048914 | Bacteria | 669 |
| 309 | Ga0496112_0019209 | 3300048915 | Bacteria | 6446 |
| 310 | Ga0496112_0047528 | 3300048915 | Bacteria | 4210 |
| 311 | Ga0496112_0178081 | 3300048915 | Bacteria | 2090 |
| 312 | Ga0496112_0331758 | 3300048915 | Bacteria | 1465 |
| 313 | Ga0496114_0023931 | 3300048917 | Bacteria | 4984 |
| 314 | Ga0496115_0004858 | 3300048918 | Bacteria | 9751 |
| 315 | Ga0496115_0088253 | 3300048918 | Bacteria | 2532 |
| 316 | Ga0501032_0241807 | 3300049569 | Bacteria | 1173 |
| 317 | Ga0501034_0140544 | 3300049571 | Bacteria | 2394 |
| 318 | Ga0501034_0338905 | 3300049571 | Bacteria | 1434 |
| 319 | Ga0501034_0619508 | 3300049571 | Bacteria | 986 |
| 320 | Ga0501034_1148132 | 3300049571 | Bacteria | 657 |
| 321 | Ga0501036_0814621 | 3300049572 | Bacteria | 768 |
| 322 | Ga0501036_0842180 | 3300049572 | Bacteria | 754 |
| 323 | Ga0501037_0736834 | 3300049573 | Bacteria | 654 |
| 324 | Ga0501038_0370582 | 3300049574 | Bacteria | 1112 |
| 325 | Ga0501039_0153214 | 3300049575 | Bacteria | 1811 |
| 326 | Ga0501040_0209920 | 3300049576 | Unclassified | 1384 |
| 327 | Ga0501040_0807839 | 3300049576 | Bacteria | 679 |
| 328 | Ga0501040_0967863 | 3300049576 | Bacteria | 617 |
| 329 | Ga0501043_0605638 | 3300049579 | Bacteria | 809 |
| 330 | Ga0501046_0092412 | 3300049580 | Bacteria | 2326 |
| 331 | Ga0501047_0028736 | 3300049581 | Bacteria | 5362 |
| 332 | Ga0501047_0259472 | 3300049581 | Bacteria | 1586 |
| 333 | Ga0501047_0472603 | 3300049581 | Bacteria | 1082 |
| 334 | Ga0501048_0188908 | 3300049582 | Bacteria | 1460 |
| 335 | Ga0501068_0174422 | 3300049584 | Bacteria | 1358 |
| 336 | Ga0501070_0098033 | 3300049586 | Bacteria | 2424 |
| 337 | Ga0501071_0114750 | 3300049587 | Bacteria | 1993 |
| 338 | Ga0501071_0262756 | 3300049587 | Bacteria | 1304 |
| 339 | Ga0501072_0268579 | 3300049588 | Bacteria | 1357 |
| 340 | Ga0501073_0068083 | 3300049589 | Bacteria | 2482 |
| 341 | Ga0501073_0779253 | 3300049589 | Bacteria | 659 |
| 342 | Ga0501074_0803029 | 3300049590 | Bacteria | 663 |
| 343 | Ga0501075_0017140 | 3300049591 | Bacteria | 5229 |
| 344 | Ga0501075_0733454 | 3300049591 | Unclassified | 752 |
| 345 | Ga0501077_0102010 | 3300049593 | Bacteria | 1818 |
| 346 | Ga0501079_0045283 | 3300049741 | Bacteria | 3395 |
| 347 | Ga0501079_1087187 | 3300049741 | Bacteria | 630 |
| 348 | Ga0501080_0019807 | 3300049742 | Bacteria | 6229 |
| 349 | Ga0501081_0492695 | 3300049743 | Bacteria | 913 |
| 350 | Ga0501083_0564058 | 3300049744 | Bacteria | 741 |
| 351 | Ga0501044_0045988 | 3300049823 | Bacteria | 4521 |
| 352 | Ga0501045_0664033 | 3300049824 | Unclassified | 770 |
| 353 | Ga0501045_0882180 | 3300049824 | Bacteria | 657 |
| 354 | nmdc:mga03n38_261521_c1 | 3300050490 | Bacteria | 917 |
| 355 | nmdc:mga06z11_244818_c1 | 3300050494 | Bacteria | 1054 |
| 356 | nmdc:mga05p37_100384_c1 | 3300050507 | Bacteria | 3565 |
| 357 | nmdc:mga05p37_141047_c1 | 3300050507 | Bacteria | 2953 |
| 358 | nmdc:mga05p37_398066_c1 | 3300050507 | Bacteria | 1608 |
| 359 | nmdc:mga05p37_835491_c1 | 3300050507 | Unclassified | 1002 |
| 360 | nmdc:mga09592_19061_c1 | 3300050508 | Bacteria | 5630 |
| 361 | nmdc:mga09592_309027_c1 | 3300050508 | Bacteria | 1370 |
| 362 | nmdc:mga09592_513917_c1 | 3300050508 | Bacteria | 1030 |
| 363 | nmdc:mga0qj67_134519_c1 | 3300050509 | Bacteria | 2003 |
| 364 | nmdc:mga0qj67_18654_c1 | 3300050509 | Bacteria | 5289 |
| 365 | nmdc:mga0qj67_291149_c1 | 3300050509 | Bacteria | 1323 |
| 366 | nmdc:mga0qj67_55185_c1 | 3300050509 | Bacteria | 3147 |
| 367 | nmdc:mga0qj67_573849_c1 | 3300050509 | Bacteria | 904 |
| 368 | nmdc:mga06r32_1243291_c1 | 3300050510 | Bacteria | 690 |
| 369 | nmdc:mga06r32_807117_c1 | 3300050510 | Bacteria | 899 |
| 370 | nmdc:mga08y16_1348037_c1 | 3300050511 | Bacteria | 678 |
| 371 | nmdc:mga08y16_457224_c1 | 3300050511 | Unclassified | 1301 |
| 372 | nmdc:mga08y16_793582_c1 | 3300050511 | Archaea | 940 |
| 373 | nmdc:mga0n895_657039_c1 | 3300050512 | Bacteria | 1047 |
| 374 | nmdc:mga0rr50_337345_c1 | 3300050513 | Bacteria | 1266 |
| 375 | nmdc:mga0rr50_420100_c1 | 3300050513 | Bacteria | 1131 |
| 376 | nmdc:mga0rr50_54581_c1 | 3300050513 | Bacteria | 2978 |
| 377 | nmdc:mga08x19_43711_c1 | 3300050514 | Bacteria | 2858 |
| 378 | nmdc:mga0a205_256126_c1 | 3300050515 | Bacteria | 1629 |
| 379 | nmdc:mga0a205_292254_c1 | 3300050515 | Unclassified | 1504 |
| 380 | Ga0495601_0022086 | 3300053077 | Bacteria | 3905 |
| 381 | Ga0495612_0246050 | 3300053078 | Archaea | 795 |
| 382 | Ga0495595_0048465 | 3300053084 | Bacteria | 1962 |
| 383 | Ga0495619_0069972 | 3300053085 | Bacteria | 2346 |
| 384 | Ga0495619_0189808 | 3300053085 | Bacteria | 1422 |
| 385 | Ga0495619_0342860 | 3300053085 | Bacteria | 1034 |
| 386 | Ga0501084_0115971 | 3300054114 | Bacteria | 2251 |
| 387 | Ga0501084_0465758 | 3300054114 | Bacteria | 1068 |
| 388 | Ga0501082_0050405 | 3300060353 | Bacteria | 3590 |
| 389 | Ga0501082_0491457 | 3300060353 | Bacteria | 1073 |
| 390 | Ga0530510_0027961 | 3300061734 | Bacteria | 4042 |
| 391 | Ga0530510_0044999 | 3300061734 | Unclassified | 3189 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_11949949 | Ga0157375_119499492 | 126 |
| 2 | 3300049571 | Ga0501034_1148132 | Ga0501034_1148132_29_418 | 127 |
| 3 | 3300049573 | Ga0501037_0736834 | Ga0501037_0736834_151_540 | 127 |
| 4 | 3300049574 | Ga0501038_0370582 | Ga0501038_0370582_679_1068 | 127 |
| 5 | 3300049575 | Ga0501039_0153214 | Ga0501039_0153214_579_968 | 127 |
| 6 | 3300049576 | Ga0501040_0209920 | Ga0501040_0209920_808_1197 | 127 |
| 7 | 3300049587 | Ga0501071_0114750 | Ga0501071_0114750_95_484 | 127 |
| 8 | 3300049588 | Ga0501072_0268579 | Ga0501072_0268579_945_1334 | 127 |
| 9 | 3300049591 | Ga0501075_0017140 | Ga0501075_0017140_916_1305 | 127 |
| 10 | 3300049593 | Ga0501077_0102010 | Ga0501077_0102010_133_522 | 127 |
| 11 | 3300049741 | Ga0501079_0045283 | Ga0501079_0045283_1264_1653 | 127 |
| 12 | 3300049743 | Ga0501081_0492695 | Ga0501081_0492695_267_656 | 127 |
| 13 | 3300054114 | Ga0501084_0115971 | Ga0501084_0115971_1669_2058 | 127 |
| 14 | 3300060353 | Ga0501082_0050405 | Ga0501082_0050405_2520_2909 | 127 |
| 15 | 3300061734 | Ga0530510_0027961 | Ga0530510_0027961_2517_2906 | 127 |
| 16 | 3300009101 | Ga0105247_10806380 | Ga0105247_108063802 | 130 |
| 17 | 3300014968 | Ga0157379_11070470 | Ga0157379_110704702 | 130 |
| 18 | 3300025900 | Ga0207710_10347161 | Ga0207710_103471612 | 130 |
| 19 | 3300005331 | Ga0070670_100017339 | Ga0070670_1000173395 | 131 |
| 20 | 3300005333 | Ga0070677_10221476 | Ga0070677_102214761 | 131 |
| 21 | 3300005335 | Ga0070666_10001310 | Ga0070666_100013106 | 131 |
| 22 | 3300005338 | Ga0068868_100035138 | Ga0068868_1000351384 | 131 |
| 23 | 3300005340 | Ga0070689_100128551 | Ga0070689_1001285512 | 131 |
| 24 | 3300005354 | Ga0070675_100076334 | Ga0070675_1000763344 | 131 |
| 25 | 3300005355 | Ga0070671_100040229 | Ga0070671_1000402294 | 131 |
| 26 | 3300005356 | Ga0070674_100044408 | Ga0070674_1000444084 | 131 |
| 27 | 3300005364 | Ga0070673_102100116 | Ga0070673_1021001161 | 131 |
| 28 | 3300005365 | Ga0070688_100077588 | Ga0070688_1000775882 | 131 |
| 29 | 3300005367 | Ga0070667_100000501 | Ga0070667_1000005013 | 131 |
| 30 | 3300005367 | Ga0070667_100218922 | Ga0070667_1002189222 | 131 |
| 31 | 3300005367 | Ga0070667_100799566 | Ga0070667_1007995662 | 131 |
| 32 | 3300005455 | Ga0070663_100005698 | Ga0070663_1000056985 | 131 |
| 33 | 3300005455 | Ga0070663_100090740 | Ga0070663_1000907401 | 131 |
| 34 | 3300005456 | Ga0070678_100026234 | Ga0070678_1000262342 | 131 |
| 35 | 3300005457 | Ga0070662_100440646 | Ga0070662_1004406461 | 131 |
| 36 | 3300005459 | Ga0068867_100005233 | Ga0068867_1000052338 | 131 |
| 37 | 3300005539 | Ga0068853_100396993 | Ga0068853_1003969932 | 131 |
| 38 | 3300005543 | Ga0070672_100003014 | Ga0070672_1000030144 | 131 |
| 39 | 3300005543 | Ga0070672_100253182 | Ga0070672_1002531822 | 131 |
| 40 | 3300005544 | Ga0070686_100079416 | Ga0070686_1000794162 | 131 |
| 41 | 3300005548 | Ga0070665_100046658 | Ga0070665_1000466586 | 131 |
| 42 | 3300005549 | Ga0070704_100217225 | Ga0070704_1002172252 | 131 |
| 43 | 3300005564 | Ga0070664_100009123 | Ga0070664_1000091236 | 131 |
| 44 | 3300005564 | Ga0070664_100367353 | Ga0070664_1003673532 | 131 |
| 45 | 3300005614 | Ga0068856_100004897 | Ga0068856_1000048977 | 131 |
| 46 | 3300005615 | Ga0070702_100050210 | Ga0070702_1000502102 | 131 |
| 47 | 3300005617 | Ga0068859_100000791 | Ga0068859_10000079130 | 131 |
| 48 | 3300005618 | Ga0068864_100040347 | Ga0068864_1000403474 | 131 |
| 49 | 3300005618 | Ga0068864_101291201 | Ga0068864_1012912011 | 131 |
| 50 | 3300005718 | Ga0068866_10019852 | Ga0068866_100198522 | 131 |
| 51 | 3300005718 | Ga0068866_11431197 | Ga0068866_114311971 | 131 |
| 52 | 3300005841 | Ga0068863_100161977 | Ga0068863_1001619773 | 131 |
| 53 | 3300005842 | Ga0068858_100002206 | Ga0068858_1000022067 | 131 |
| 54 | 3300005842 | Ga0068858_100423022 | Ga0068858_1004230222 | 131 |
| 55 | 3300005843 | Ga0068860_100002468 | Ga0068860_1000024682 | 131 |
| 56 | 3300005843 | Ga0068860_100726479 | Ga0068860_1007264791 | 131 |
| 57 | 3300006237 | Ga0097621_100085277 | Ga0097621_1000852772 | 131 |
| 58 | 3300006237 | Ga0097621_100280937 | Ga0097621_1002809372 | 131 |
| 59 | 3300006358 | Ga0068871_100124951 | Ga0068871_1001249512 | 131 |
| 60 | 3300006881 | Ga0068865_100027750 | Ga0068865_1000277504 | 131 |
| 61 | 3300006931 | Ga0097620_100000791 | Ga0097620_1000007914 | 131 |
| 62 | 3300009148 | Ga0105243_10110266 | Ga0105243_101102664 | 131 |
| 63 | 3300009177 | Ga0105248_10001409 | Ga0105248_100014096 | 131 |
| 64 | 3300009177 | Ga0105248_10369653 | Ga0105248_103696532 | 131 |
| 65 | 3300009177 | Ga0105248_11079081 | Ga0105248_110790812 | 131 |
| 66 | 3300013296 | Ga0157374_10008791 | Ga0157374_100087918 | 131 |
| 67 | 3300013297 | Ga0157378_10009416 | Ga0157378_100094164 | 131 |
| 68 | 3300013297 | Ga0157378_10030178 | Ga0157378_100301782 | 131 |
| 69 | 3300013308 | Ga0157375_10046892 | Ga0157375_100468924 | 131 |
| 70 | 3300013308 | Ga0157375_10176470 | Ga0157375_101764702 | 131 |
| 71 | 3300013308 | Ga0157375_11233881 | Ga0157375_112338811 | 131 |
| 72 | 3300014325 | Ga0163163_10102671 | Ga0163163_101026712 | 131 |
| 73 | 3300014745 | Ga0157377_10205173 | Ga0157377_102051732 | 131 |
| 74 | 3300014968 | Ga0157379_10000133 | Ga0157379_1000013315 | 131 |
| 75 | 3300014969 | Ga0157376_10009389 | Ga0157376_100093893 | 131 |
| 76 | 3300014969 | Ga0157376_10138756 | Ga0157376_101387564 | 131 |
| 77 | 3300014969 | Ga0157376_12162222 | Ga0157376_121622222 | 131 |
| 78 | 3300025903 | Ga0207680_10385018 | Ga0207680_103850182 | 131 |
| 79 | 3300025925 | Ga0207650_10423229 | Ga0207650_104232292 | 131 |
| 80 | 3300025931 | Ga0207644_10064011 | Ga0207644_100640112 | 131 |
| 81 | 3300025931 | Ga0207644_10358377 | Ga0207644_103583772 | 131 |
| 82 | 3300025938 | Ga0207704_10107378 | Ga0207704_101073782 | 131 |
| 83 | 3300025960 | Ga0207651_11306074 | Ga0207651_113060742 | 131 |
| 84 | 3300026023 | Ga0207677_10066876 | Ga0207677_100668764 | 131 |
| 85 | 3300026067 | Ga0207678_10058349 | Ga0207678_100583494 | 131 |
| 86 | 3300026088 | Ga0207641_11212149 | Ga0207641_112121492 | 131 |
| 87 | 3300026089 | Ga0207648_10450653 | Ga0207648_104506532 | 131 |
| 88 | 3300026095 | Ga0207676_10126753 | Ga0207676_101267534 | 131 |
| 89 | 3300026121 | Ga0207683_10033508 | Ga0207683_100335084 | 131 |
| 90 | 3300026142 | Ga0207698_10395266 | Ga0207698_103952662 | 131 |
| 91 | 3300028379 | Ga0268266_10371748 | Ga0268266_103717482 | 131 |
| 92 | 3300035089 | Ga0373944_0202651 | Ga0373944_0202651_66_530 | 131 |
| 93 | 3300009147 | Ga0114129_11000185 | Ga0114129_110001852 | 133 |
| 94 | 3300049576 | Ga0501040_0807839 | Ga0501040_0807839_107_568 | 133 |
| 95 | 3300026035 | Ga0207703_10166208 | Ga0207703_101662082 | 134 |
| 96 | 3300049571 | Ga0501034_0619508 | Ga0501034_0619508_535_957 | 134 |
| 97 | 3300049581 | Ga0501047_0259472 | Ga0501047_0259472_751_1173 | 134 |
| 98 | 3300009094 | Ga0111539_11087677 | Ga0111539_110876772 | 135 |
| 99 | 3300014325 | Ga0163163_11223820 | Ga0163163_112238202 | 135 |
| 100 | 3300014969 | Ga0157376_10545818 | Ga0157376_105458182 | 135 |
| 101 | 3300035170 | Ga0373943_0156197 | Ga0373943_0156197_42_452 | 135 |
| 102 | 3300035725 | Ga0373947_1042459 | Ga0373947_1042459_48_458 | 135 |
| 103 | 3300046681 | Ga0495647_0105446 | Ga0495647_0105446_737_1147 | 135 |
| 104 | 3300046689 | Ga0495613_0938223 | Ga0495613_0938223_12_428 | 135 |
| 105 | 3300047315 | Ga0495581_0305825 | Ga0495581_0305825_134_544 | 135 |
| 106 | 3300047321 | Ga0495676_0215164 | Ga0495676_0215164_336_746 | 135 |
| 107 | 3300049587 | Ga0501071_0262756 | Ga0501071_0262756_261_677 | 135 |
| 108 | 3300005337 | Ga0070682_100143732 | Ga0070682_1001437322 | 136 |
| 109 | 3300005440 | Ga0070705_100076928 | Ga0070705_1000769282 | 136 |
| 110 | 3300005468 | Ga0070707_100631328 | Ga0070707_1006313282 | 136 |
| 111 | 3300005548 | Ga0070665_101524638 | Ga0070665_1015246382 | 136 |
| 112 | 3300005549 | Ga0070704_100068012 | Ga0070704_1000680122 | 136 |
| 113 | 3300005614 | Ga0068856_101659678 | Ga0068856_1016596781 | 136 |
| 114 | 3300005842 | Ga0068858_100775515 | Ga0068858_1007755152 | 136 |
| 115 | 3300005937 | Ga0081455_10170103 | Ga0081455_101701033 | 136 |
| 116 | 3300006871 | Ga0075434_100285222 | Ga0075434_1002852222 | 136 |
| 117 | 3300007076 | Ga0075435_100548380 | Ga0075435_1005483802 | 136 |
| 118 | 3300009093 | Ga0105240_10761935 | Ga0105240_107619352 | 136 |
| 119 | 3300009098 | Ga0105245_10032815 | Ga0105245_100328153 | 136 |
| 120 | 3300009098 | Ga0105245_11084734 | Ga0105245_110847342 | 136 |
| 121 | 3300009148 | Ga0105243_10297386 | Ga0105243_102973862 | 136 |
| 122 | 3300009176 | Ga0105242_10109790 | Ga0105242_101097903 | 136 |
| 123 | 3300010375 | Ga0105239_10482611 | Ga0105239_104826112 | 136 |
| 124 | 3300025927 | Ga0207687_10148136 | Ga0207687_101481363 | 136 |
| 125 | 3300025934 | Ga0207686_10054979 | Ga0207686_100549794 | 136 |
| 126 | 3300025935 | Ga0207709_10346548 | Ga0207709_103465482 | 136 |
| 127 | 3300028379 | Ga0268266_10501690 | Ga0268266_105016902 | 136 |
| 128 | 3300028381 | Ga0268264_11369394 | Ga0268264_113693942 | 136 |
| 129 | 3300028800 | Ga0265338_10001315 | Ga0265338_1000131521 | 136 |
| 130 | 3300031241 | Ga0265325_10002817 | Ga0265325_100028173 | 136 |
| 131 | 3300031249 | Ga0265339_10008331 | Ga0265339_100083314 | 136 |
| 132 | 3300031249 | Ga0265339_10042711 | Ga0265339_100427113 | 136 |
| 133 | 3300031250 | Ga0265331_10150217 | Ga0265331_101502172 | 136 |
| 134 | 3300031251 | Ga0265327_10036653 | Ga0265327_100366535 | 136 |
| 135 | 3300031595 | Ga0265313_10001049 | Ga0265313_1000104921 | 136 |
| 136 | 3300031595 | Ga0265313_10206170 | Ga0265313_102061701 | 136 |
| 137 | 3300031711 | Ga0265314_10107654 | Ga0265314_101076543 | 136 |
| 138 | 3300031711 | Ga0265314_10112990 | Ga0265314_101129901 | 136 |
| 139 | 3300031733 | Ga0316577_10302693 | Ga0316577_103026932 | 136 |
| 140 | 3300035089 | Ga0373944_0108839 | Ga0373944_0108839_271_720 | 136 |
| 141 | 3300035111 | Ga0373923_0027399 | Ga0373923_0027399_745_1194 | 136 |
| 142 | 3300035172 | Ga0373955_0081492 | Ga0373955_0081492_1218_1667 | 136 |
| 143 | 3300035398 | Ga0316574_0052565 | Ga0316574_0052565_744_1223 | 136 |
| 144 | 3300035692 | Ga0373935_0164695 | Ga0373935_0164695_898_1347 | 136 |
| 145 | 3300035695 | Ga0373927_0227264 | Ga0373927_0227264_535_984 | 136 |
| 146 | 3300035724 | Ga0373933_0236928 | Ga0373933_0236928_141_590 | 136 |
| 147 | 3300036712 | Ga0316584_0501250 | Ga0316584_0501250_253_732 | 136 |
| 148 | 3300037068 | Ga0373925_0376105 | Ga0373925_0376105_173_622 | 136 |
| 149 | 3300046461 | Ga0495641_0518866 | Ga0495641_0518866_69_518 | 136 |
| 150 | 3300046533 | Ga0495640_0224774 | Ga0495640_0224774_274_723 | 136 |
| 151 | 3300046663 | Ga0495635_0182833 | Ga0495635_0182833_491_940 | 136 |
| 152 | 3300047319 | Ga0495674_0138370 | Ga0495674_0138370_1179_1628 | 136 |
| 153 | 3300047319 | Ga0495674_0741737 | Ga0495674_0741737_145_588 | 136 |
| 154 | 3300047321 | Ga0495676_0048540 | Ga0495676_0048540_2129_2578 | 136 |
| 155 | 3300047471 | Ga0495684_0239730 | Ga0495684_0239730_631_1080 | 136 |
| 156 | 3300048905 | Ga0496102_0072310 | Ga0496102_0072310_1471_1893 | 136 |
| 157 | 3300048906 | Ga0496103_0795427 | Ga0496103_0795427_47_463 | 136 |
| 158 | 3300048911 | Ga0496108_0387198 | Ga0496108_0387198_333_791 | 136 |
| 159 | 3300048912 | Ga0496109_0843475 | Ga0496109_0843475_297_755 | 136 |
| 160 | 3300048913 | Ga0496110_1310614 | Ga0496110_1310614_145_567 | 136 |
| 161 | 3300048915 | Ga0496112_0047528 | Ga0496112_0047528_2135_2593 | 136 |
| 162 | 3300048918 | Ga0496115_0088253 | Ga0496115_0088253_1577_1999 | 136 |
| 163 | 3300049576 | Ga0501040_0967863 | Ga0501040_0967863_44_454 | 136 |
| 164 | 3300049589 | Ga0501073_0779253 | Ga0501073_0779253_59_505 | 136 |
| 165 | 3300049824 | Ga0501045_0664033 | Ga0501045_0664033_170_595 | 136 |
| 166 | 3300050512 | nmdc:mga0n895_657039_c1 | nmdc:mga0n895_657039_c1_529_975 | 136 |
| 167 | 3300050513 | nmdc:mga0rr50_420100_c1 | nmdc:mga0rr50_420100_c1_40_489 | 136 |
| 168 | 3300005329 | Ga0070683_100552762 | Ga0070683_1005527621 | 137 |
| 169 | 3300005336 | Ga0070680_101186446 | Ga0070680_1011864461 | 137 |
| 170 | 3300005340 | Ga0070689_100443807 | Ga0070689_1004438072 | 137 |
| 171 | 3300005343 | Ga0070687_100836318 | Ga0070687_1008363181 | 137 |
| 172 | 3300005356 | Ga0070674_100168970 | Ga0070674_1001689703 | 137 |
| 173 | 3300005364 | Ga0070673_100607184 | Ga0070673_1006071842 | 137 |
| 174 | 3300005434 | Ga0070709_10105725 | Ga0070709_101057251 | 137 |
| 175 | 3300005436 | Ga0070713_100189022 | Ga0070713_1001890222 | 137 |
| 176 | 3300005436 | Ga0070713_100789919 | Ga0070713_1007899192 | 137 |
| 177 | 3300005436 | Ga0070713_100950349 | Ga0070713_1009503491 | 137 |
| 178 | 3300005437 | Ga0070710_10015936 | Ga0070710_100159362 | 137 |
| 179 | 3300005438 | Ga0070701_10510238 | Ga0070701_105102381 | 137 |
| 180 | 3300005440 | Ga0070705_100852864 | Ga0070705_1008528642 | 137 |
| 181 | 3300005441 | Ga0070700_100021860 | Ga0070700_1000218604 | 137 |
| 182 | 3300005441 | Ga0070700_100099142 | Ga0070700_1000991422 | 137 |
| 183 | 3300005445 | Ga0070708_100008308 | Ga0070708_1000083084 | 137 |
| 184 | 3300005456 | Ga0070678_100094210 | Ga0070678_1000942103 | 137 |
| 185 | 3300005456 | Ga0070678_100391371 | Ga0070678_1003913712 | 137 |
| 186 | 3300005467 | Ga0070706_100006037 | Ga0070706_1000060373 | 137 |
| 187 | 3300005467 | Ga0070706_100042550 | Ga0070706_1000425503 | 137 |
| 188 | 3300005468 | Ga0070707_100060973 | Ga0070707_1000609735 | 137 |
| 189 | 3300005468 | Ga0070707_100157213 | Ga0070707_1001572133 | 137 |
| 190 | 3300005471 | Ga0070698_100059312 | Ga0070698_1000593123 | 137 |
| 191 | 3300005471 | Ga0070698_100073448 | Ga0070698_1000734483 | 137 |
| 192 | 3300005518 | Ga0070699_100016464 | Ga0070699_1000164643 | 137 |
| 193 | 3300005530 | Ga0070679_101098686 | Ga0070679_1010986861 | 137 |
| 194 | 3300005535 | Ga0070684_100553810 | Ga0070684_1005538102 | 137 |
| 195 | 3300005535 | Ga0070684_100666791 | Ga0070684_1006667912 | 137 |
| 196 | 3300005536 | Ga0070697_100046479 | Ga0070697_1000464792 | 137 |
| 197 | 3300005544 | Ga0070686_100394983 | Ga0070686_1003949832 | 137 |
| 198 | 3300005841 | Ga0068863_100739971 | Ga0068863_1007399712 | 137 |
| 199 | 3300005841 | Ga0068863_101594304 | Ga0068863_1015943042 | 137 |
| 200 | 3300005843 | Ga0068860_100828656 | Ga0068860_1008286562 | 137 |
| 201 | 3300006028 | Ga0070717_10046096 | Ga0070717_100460962 | 137 |
| 202 | 3300006028 | Ga0070717_10728650 | Ga0070717_107286502 | 137 |
| 203 | 3300006042 | Ga0075368_10389337 | Ga0075368_103893371 | 137 |
| 204 | 3300006048 | Ga0075363_100037185 | Ga0075363_1000371853 | 137 |
| 205 | 3300006058 | Ga0075432_10106481 | Ga0075432_101064812 | 137 |
| 206 | 3300006175 | Ga0070712_100070607 | Ga0070712_1000706072 | 137 |
| 207 | 3300006178 | Ga0075367_10287043 | Ga0075367_102870432 | 137 |
| 208 | 3300006844 | Ga0075428_100028787 | Ga0075428_1000287873 | 137 |
| 209 | 3300006844 | Ga0075428_100080758 | Ga0075428_1000807586 | 137 |
| 210 | 3300006844 | Ga0075428_100167620 | Ga0075428_1001676202 | 137 |
| 211 | 3300006846 | Ga0075430_100011703 | Ga0075430_1000117039 | 137 |
| 212 | 3300006846 | Ga0075430_100146508 | Ga0075430_1001465082 | 137 |
| 213 | 3300006846 | Ga0075430_100707235 | Ga0075430_1007072352 | 137 |
| 214 | 3300006846 | Ga0075430_101186349 | Ga0075430_1011863492 | 137 |
| 215 | 3300006847 | Ga0075431_100010606 | Ga0075431_10001060612 | 137 |
| 216 | 3300006847 | Ga0075431_100627759 | Ga0075431_1006277592 | 137 |
| 217 | 3300006847 | Ga0075431_100858541 | Ga0075431_1008585412 | 137 |
| 218 | 3300006852 | Ga0075433_10012899 | Ga0075433_100128993 | 137 |
| 219 | 3300006880 | Ga0075429_100527529 | Ga0075429_1005275292 | 137 |
| 220 | 3300006914 | Ga0075436_100002602 | Ga0075436_10000260213 | 137 |
| 221 | 3300007076 | Ga0075435_100017441 | Ga0075435_1000174415 | 137 |
| 222 | 3300009094 | Ga0111539_10184005 | Ga0111539_101840053 | 137 |
| 223 | 3300009094 | Ga0111539_10330232 | Ga0111539_103302323 | 137 |
| 224 | 3300009094 | Ga0111539_10455533 | Ga0111539_104555333 | 137 |
| 225 | 3300009094 | Ga0111539_11372407 | Ga0111539_113724072 | 137 |
| 226 | 3300009098 | Ga0105245_10396536 | Ga0105245_103965362 | 137 |
| 227 | 3300009098 | Ga0105245_10584761 | Ga0105245_105847612 | 137 |
| 228 | 3300009098 | Ga0105245_11580923 | Ga0105245_115809231 | 137 |
| 229 | 3300009147 | Ga0114129_10173887 | Ga0114129_101738873 | 137 |
| 230 | 3300009147 | Ga0114129_10330494 | Ga0114129_103304943 | 137 |
| 231 | 3300009147 | Ga0114129_10395486 | Ga0114129_103954863 | 137 |
| 232 | 3300009147 | Ga0114129_10901711 | Ga0114129_109017112 | 137 |
| 233 | 3300009148 | Ga0105243_10111302 | Ga0105243_101113024 | 137 |
| 234 | 3300009176 | Ga0105242_11422217 | Ga0105242_114222172 | 137 |
| 235 | 3300009553 | Ga0105249_10183221 | Ga0105249_101832213 | 137 |
| 236 | 3300009553 | Ga0105249_10898772 | Ga0105249_108987722 | 137 |
| 237 | 3300009553 | Ga0105249_11474206 | Ga0105249_114742061 | 137 |
| 238 | 3300011119 | Ga0105246_10033177 | Ga0105246_100331772 | 137 |
| 239 | 3300013308 | Ga0157375_11372597 | Ga0157375_113725971 | 137 |
| 240 | 3300013308 | Ga0157375_11717391 | Ga0157375_117173911 | 137 |
| 241 | 3300014325 | Ga0163163_10566633 | Ga0163163_105666332 | 137 |
| 242 | 3300014325 | Ga0163163_11651778 | Ga0163163_116517781 | 137 |
| 243 | 3300014745 | Ga0157377_10606685 | Ga0157377_106066851 | 137 |
| 244 | 3300017792 | Ga0163161_11182502 | Ga0163161_111825021 | 137 |
| 245 | 3300020082 | Ga0206353_10074878 | Ga0206353_100748782 | 137 |
| 246 | 3300025905 | Ga0207685_10060143 | Ga0207685_100601432 | 137 |
| 247 | 3300025906 | Ga0207699_10051328 | Ga0207699_100513283 | 137 |
| 248 | 3300025910 | Ga0207684_10011021 | Ga0207684_100110216 | 137 |
| 249 | 3300025915 | Ga0207693_10654690 | Ga0207693_106546901 | 137 |
| 250 | 3300025916 | Ga0207663_10756929 | Ga0207663_107569292 | 137 |
| 251 | 3300025918 | Ga0207662_11008318 | Ga0207662_110083181 | 137 |
| 252 | 3300025922 | Ga0207646_10503265 | Ga0207646_105032652 | 137 |
| 253 | 3300025927 | Ga0207687_10327140 | Ga0207687_103271402 | 137 |
| 254 | 3300025928 | Ga0207700_10180591 | Ga0207700_101805912 | 137 |
| 255 | 3300025932 | Ga0207690_10622269 | Ga0207690_106222692 | 137 |
| 256 | 3300025935 | Ga0207709_10796016 | Ga0207709_107960162 | 137 |
| 257 | 3300025936 | Ga0207670_10219314 | Ga0207670_102193142 | 137 |
| 258 | 3300025937 | Ga0207669_10142961 | Ga0207669_101429612 | 137 |
| 259 | 3300025939 | Ga0207665_10160229 | Ga0207665_101602292 | 137 |
| 260 | 3300025940 | Ga0207691_10345576 | Ga0207691_103455762 | 137 |
| 261 | 3300025961 | Ga0207712_10163557 | Ga0207712_101635573 | 137 |
| 262 | 3300026075 | Ga0207708_10122790 | Ga0207708_101227902 | 137 |
| 263 | 3300026075 | Ga0207708_10588825 | Ga0207708_105888252 | 137 |
| 264 | 3300026121 | Ga0207683_10113597 | Ga0207683_101135973 | 137 |
| 265 | 3300027866 | Ga0209813_10385888 | Ga0209813_103858881 | 137 |
| 266 | 3300028379 | Ga0268266_10735123 | Ga0268266_107351232 | 137 |
| 267 | 3300028381 | Ga0268264_11009014 | Ga0268264_110090142 | 137 |
| 268 | 3300028800 | Ga0265338_10329169 | Ga0265338_103291692 | 137 |
| 269 | 3300031251 | Ga0265327_10003836 | Ga0265327_100038365 | 137 |
| 270 | 3300031251 | Ga0265327_10033861 | Ga0265327_100338612 | 137 |
| 271 | 3300031251 | Ga0265327_10051324 | Ga0265327_100513243 | 137 |
| 272 | 3300031251 | Ga0265327_10103403 | Ga0265327_101034033 | 137 |
| 273 | 3300035114 | Ga0373939_0236847 | Ga0373939_0236847_252_665 | 137 |
| 274 | 3300035119 | Ga0373956_0326982 | Ga0373956_0326982_280_717 | 137 |
| 275 | 3300035171 | Ga0373946_0085560 | Ga0373946_0085560_124_543 | 137 |
| 276 | 3300035691 | Ga0373931_0038224 | Ga0373931_0038224_1413_1826 | 137 |
| 277 | 3300035692 | Ga0373935_0251087 | Ga0373935_0251087_443_880 | 137 |
| 278 | 3300035725 | Ga0373947_0307923 | Ga0373947_0307923_395_814 | 137 |
| 279 | 3300036401 | Ga0373937_0782469 | Ga0373937_0782469_368_781 | 137 |
| 280 | 3300036401 | Ga0373937_0860054 | Ga0373937_0860054_205_642 | 137 |
| 281 | 3300039437 | Ga0436365_1597653 | Ga0436365_1597653_82_510 | 137 |
| 282 | 3300039437 | Ga0436365_1907222 | Ga0436365_1907222_108_581 | 137 |
| 283 | 3300041458 | Ga0451798_0417413 | Ga0451798_0417413_14_535 | 137 |
| 284 | 3300046454 | Ga0495592_0334753 | Ga0495592_0334753_412_876 | 137 |
| 285 | 3300046455 | Ga0495603_0459355 | Ga0495603_0459355_18_431 | 137 |
| 286 | 3300046463 | Ga0495653_0976832 | Ga0495653_0976832_14_427 | 137 |
| 287 | 3300046474 | Ga0495605_0396013 | Ga0495605_0396013_60_473 | 137 |
| 288 | 3300046477 | Ga0495664_0951435 | Ga0495664_0951435_37_450 | 137 |
| 289 | 3300046492 | Ga0495585_0389601 | Ga0495585_0389601_70_489 | 137 |
| 290 | 3300046500 | Ga0495596_0202632 | Ga0495596_0202632_14_427 | 137 |
| 291 | 3300046506 | Ga0495583_0280217 | Ga0495583_0280217_59_490 | 137 |
| 292 | 3300046511 | Ga0495608_0289059 | Ga0495608_0289059_332_769 | 137 |
| 293 | 3300046511 | Ga0495608_0444885 | Ga0495608_0444885_363_776 | 137 |
| 294 | 3300046517 | Ga0495630_0604692 | Ga0495630_0604692_44_457 | 137 |
| 295 | 3300046517 | Ga0495630_0642083 | Ga0495630_0642083_232_645 | 137 |
| 296 | 3300046526 | Ga0495666_0357820 | Ga0495666_0357820_45_464 | 137 |
| 297 | 3300046535 | Ga0495586_0422407 | Ga0495586_0422407_39_560 | 137 |
| 298 | 3300046557 | Ga0495622_0452340 | Ga0495622_0452340_26_496 | 137 |
| 299 | 3300046559 | Ga0495667_0254014 | Ga0495667_0254014_129_542 | 137 |
| 300 | 3300046616 | Ga0495668_0144530 | Ga0495668_0144530_568_981 | 137 |
| 301 | 3300046616 | Ga0495668_0525483 | Ga0495668_0525483_74_487 | 137 |
| 302 | 3300046642 | Ga0495634_0417856 | Ga0495634_0417856_170_583 | 137 |
| 303 | 3300046663 | Ga0495635_0135301 | Ga0495635_0135301_832_1269 | 137 |
| 304 | 3300046675 | Ga0495657_0309396 | Ga0495657_0309396_62_499 | 137 |
| 305 | 3300046681 | Ga0495647_0298672 | Ga0495647_0298672_85_498 | 137 |
| 306 | 3300046683 | Ga0495658_0207500 | Ga0495658_0207500_716_1135 | 137 |
| 307 | 3300046689 | Ga0495613_0210129 | Ga0495613_0210129_269_688 | 137 |
| 308 | 3300046691 | Ga0495670_0101400 | Ga0495670_0101400_465_884 | 137 |
| 309 | 3300046809 | Ga0495600_0556997 | Ga0495600_0556997_130_543 | 137 |
| 310 | 3300047317 | Ga0495604_0309921 | Ga0495604_0309921_213_626 | 137 |
| 311 | 3300047319 | Ga0495674_0534270 | Ga0495674_0534270_261_698 | 137 |
| 312 | 3300047320 | Ga0495672_0292152 | Ga0495672_0292152_90_503 | 137 |
| 313 | 3300047321 | Ga0495676_0054307 | Ga0495676_0054307_1141_1560 | 137 |
| 314 | 3300047322 | Ga0495680_0277002 | Ga0495680_0277002_568_1005 | 137 |
| 315 | 3300048904 | Ga0496101_0017087 | Ga0496101_0017087_1026_1439 | 137 |
| 316 | 3300048905 | Ga0496102_1181667 | Ga0496102_1181667_91_504 | 137 |
| 317 | 3300048905 | Ga0496102_1350648 | Ga0496102_1350648_49_510 | 137 |
| 318 | 3300048906 | Ga0496103_0202923 | Ga0496103_0202923_827_1240 | 137 |
| 319 | 3300048907 | Ga0496104_0028154 | Ga0496104_0028154_563_976 | 137 |
| 320 | 3300048907 | Ga0496104_0192225 | Ga0496104_0192225_1181_1594 | 137 |
| 321 | 3300048907 | Ga0496104_0437005 | Ga0496104_0437005_699_1112 | 137 |
| 322 | 3300048908 | Ga0496105_0015649 | Ga0496105_0015649_3220_3633 | 137 |
| 323 | 3300048908 | Ga0496105_0026117 | Ga0496105_0026117_2459_2872 | 137 |
| 324 | 3300048908 | Ga0496105_0127297 | Ga0496105_0127297_1257_1700 | 137 |
| 325 | 3300048910 | Ga0496107_0024874 | Ga0496107_0024874_763_1176 | 137 |
| 326 | 3300048911 | Ga0496108_0003643 | Ga0496108_0003643_1811_2254 | 137 |
| 327 | 3300048912 | Ga0496109_0169990 | Ga0496109_0169990_35_478 | 137 |
| 328 | 3300048912 | Ga0496109_0216536 | Ga0496109_0216536_828_1241 | 137 |
| 329 | 3300048912 | Ga0496109_1365572 | Ga0496109_1365572_108_563 | 137 |
| 330 | 3300048912 | Ga0496109_1998907 | Ga0496109_1998907_48_461 | 137 |
| 331 | 3300048913 | Ga0496110_0021032 | Ga0496110_0021032_2155_2598 | 137 |
| 332 | 3300048913 | Ga0496110_0383603 | Ga0496110_0383603_549_962 | 137 |
| 333 | 3300048914 | Ga0496111_0827507 | Ga0496111_0827507_33_446 | 137 |
| 334 | 3300048915 | Ga0496112_0019209 | Ga0496112_0019209_3889_4332 | 137 |
| 335 | 3300048915 | Ga0496112_0178081 | Ga0496112_0178081_376_888 | 137 |
| 336 | 3300048915 | Ga0496112_0331758 | Ga0496112_0331758_1009_1422 | 137 |
| 337 | 3300048917 | Ga0496114_0023931 | Ga0496114_0023931_3308_3721 | 137 |
| 338 | 3300048918 | Ga0496115_0004858 | Ga0496115_0004858_3701_4114 | 137 |
| 339 | 3300049569 | Ga0501032_0241807 | Ga0501032_0241807_371_784 | 137 |
| 340 | 3300049571 | Ga0501034_0140544 | Ga0501034_0140544_1092_1505 | 137 |
| 341 | 3300049571 | Ga0501034_0338905 | Ga0501034_0338905_48_461 | 137 |
| 342 | 3300049572 | Ga0501036_0814621 | Ga0501036_0814621_293_706 | 137 |
| 343 | 3300049572 | Ga0501036_0842180 | Ga0501036_0842180_305_724 | 137 |
| 344 | 3300049579 | Ga0501043_0605638 | Ga0501043_0605638_251_664 | 137 |
| 345 | 3300049580 | Ga0501046_0092412 | Ga0501046_0092412_297_710 | 137 |
| 346 | 3300049581 | Ga0501047_0028736 | Ga0501047_0028736_2627_3040 | 137 |
| 347 | 3300049581 | Ga0501047_0472603 | Ga0501047_0472603_575_988 | 137 |
| 348 | 3300049582 | Ga0501048_0188908 | Ga0501048_0188908_617_1036 | 137 |
| 349 | 3300049584 | Ga0501068_0174422 | Ga0501068_0174422_669_1094 | 137 |
| 350 | 3300049586 | Ga0501070_0098033 | Ga0501070_0098033_479_892 | 137 |
| 351 | 3300049589 | Ga0501073_0068083 | Ga0501073_0068083_1381_1794 | 137 |
| 352 | 3300049590 | Ga0501074_0803029 | Ga0501074_0803029_223_636 | 137 |
| 353 | 3300049591 | Ga0501075_0733454 | Ga0501075_0733454_157_597 | 137 |
| 354 | 3300049741 | Ga0501079_1087187 | Ga0501079_1087187_18_491 | 137 |
| 355 | 3300049742 | Ga0501080_0019807 | Ga0501080_0019807_5642_6055 | 137 |
| 356 | 3300049744 | Ga0501083_0564058 | Ga0501083_0564058_105_599 | 137 |
| 357 | 3300049823 | Ga0501044_0045988 | Ga0501044_0045988_1579_1992 | 137 |
| 358 | 3300049824 | Ga0501045_0882180 | Ga0501045_0882180_205_624 | 137 |
| 359 | 3300050490 | nmdc:mga03n38_261521_c1 | nmdc:mga03n38_261521_c1_307_726 | 137 |
| 360 | 3300050494 | nmdc:mga06z11_244818_c1 | nmdc:mga06z11_244818_c1_374_793 | 137 |
| 361 | 3300050507 | nmdc:mga05p37_100384_c1 | nmdc:mga05p37_100384_c1_2781_3200 | 137 |
| 362 | 3300050507 | nmdc:mga05p37_141047_c1 | nmdc:mga05p37_141047_c1_2432_2851 | 137 |
| 363 | 3300050507 | nmdc:mga05p37_398066_c1 | nmdc:mga05p37_398066_c1_1006_1428 | 137 |
| 364 | 3300050507 | nmdc:mga05p37_835491_c1 | nmdc:mga05p37_835491_c1_103_522 | 137 |
| 365 | 3300050508 | nmdc:mga09592_19061_c1 | nmdc:mga09592_19061_c1_112_531 | 137 |
| 366 | 3300050508 | nmdc:mga09592_309027_c1 | nmdc:mga09592_309027_c1_872_1291 | 137 |
| 367 | 3300050508 | nmdc:mga09592_513917_c1 | nmdc:mga09592_513917_c1_179_601 | 137 |
| 368 | 3300050509 | nmdc:mga0qj67_134519_c1 | nmdc:mga0qj67_134519_c1_1124_1543 | 137 |
| 369 | 3300050509 | nmdc:mga0qj67_18654_c1 | nmdc:mga0qj67_18654_c1_548_1012 | 137 |
| 370 | 3300050509 | nmdc:mga0qj67_291149_c1 | nmdc:mga0qj67_291149_c1_419_838 | 137 |
| 371 | 3300050509 | nmdc:mga0qj67_55185_c1 | nmdc:mga0qj67_55185_c1_724_1188 | 137 |
| 372 | 3300050509 | nmdc:mga0qj67_573849_c1 | nmdc:mga0qj67_573849_c1_79_543 | 137 |
| 373 | 3300050510 | nmdc:mga06r32_1243291_c1 | nmdc:mga06r32_1243291_c1_118_537 | 137 |
| 374 | 3300050510 | nmdc:mga06r32_807117_c1 | nmdc:mga06r32_807117_c1_261_680 | 137 |
| 375 | 3300050511 | nmdc:mga08y16_1348037_c1 | nmdc:mga08y16_1348037_c1_112_534 | 137 |
| 376 | 3300050511 | nmdc:mga08y16_457224_c1 | nmdc:mga08y16_457224_c1_718_1188 | 137 |
| 377 | 3300050511 | nmdc:mga08y16_793582_c1 | nmdc:mga08y16_793582_c1_89_547 | 137 |
| 378 | 3300050513 | nmdc:mga0rr50_337345_c1 | nmdc:mga0rr50_337345_c1_295_708 | 137 |
| 379 | 3300050513 | nmdc:mga0rr50_54581_c1 | nmdc:mga0rr50_54581_c1_2463_2882 | 137 |
| 380 | 3300050514 | nmdc:mga08x19_43711_c1 | nmdc:mga08x19_43711_c1_502_921 | 137 |
| 381 | 3300050515 | nmdc:mga0a205_256126_c1 | nmdc:mga0a205_256126_c1_1171_1590 | 137 |
| 382 | 3300050515 | nmdc:mga0a205_292254_c1 | nmdc:mga0a205_292254_c1_46_465 | 137 |
| 383 | 3300053077 | Ga0495601_0022086 | Ga0495601_0022086_2823_3260 | 137 |
| 384 | 3300053078 | Ga0495612_0246050 | Ga0495612_0246050_368_781 | 137 |
| 385 | 3300053084 | Ga0495595_0048465 | Ga0495595_0048465_854_1267 | 137 |
| 386 | 3300053085 | Ga0495619_0069972 | Ga0495619_0069972_1748_2185 | 137 |
| 387 | 3300053085 | Ga0495619_0189808 | Ga0495619_0189808_200_613 | 137 |
| 388 | 3300053085 | Ga0495619_0342860 | Ga0495619_0342860_282_743 | 137 |
| 389 | 3300054114 | Ga0501084_0465758 | Ga0501084_0465758_69_563 | 137 |
| 390 | 3300060353 | Ga0501082_0491457 | Ga0501082_0491457_51_476 | 137 |
| 391 | 3300061734 | Ga0530510_0044999 | Ga0530510_0044999_1786_2205 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hst-assembly4.cif.gz_D | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9741 | 4 | 135 |
| 3hst-assembly2.cif.gz_B | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9699 | 3 | 135 |
| 3hst-assembly4.cif.gz_D | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9596 | 4 | 135 |
| 4e19-assembly2.cif.gz_B | crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 | 0.9455 | 4 | 135 |
| 3hst-assembly2.cif.gz_B | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9217 | 3 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hstD00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9741 | 4 | 135 | 3.30.420.10 |
| 4e19A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.96 | 3 | 135 | 3.30.420.10 |
| 3hstD00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9596 | 4 | 135 | 3.30.420.10 |
| af_A0A0R0FBC1_213_345_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9362 | 5 | 137 | 3.30.420.10 |
| 4e19A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9321 | 3 | 135 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523RAQ2-F1-model_v4 | Ribonuclease HI family protein | 0.9859 | 4 | 135 |
GO:0003676
GO:0004523 |
| AF-A0A1H3PV32-F1-model_v4 | Probable phosphoglycerate mutase | 0.9812 | 4 | 135 |
GO:0003676
GO:0004523 GO:0005737 GO:0016791 |
| AF-A0A2N3G5S0-F1-model_v4 | RNase H type-1 domain-containing protein | 0.9786 | 1 | 135 |
GO:0003676
GO:0004523 |
| AF-A0A523TY04-F1-model_v4 | Ribonuclease HI family protein | 0.9779 | 3 | 134 |
GO:0003676
GO:0004523 |
| AF-E0X768-F1-model_v4 | Ribonuclease H (EC 3.1.26.4) | 0.9777 | 2 | 135 |
GO:0003676
GO:0004523 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar