F432102

General Info

Members Datasets Scaffolds Average Seq Length
391 235 391 144

Family's Representative Sequence

Representative Sequence 3300041458|Ga0451798_0417413|Ga0451798_0417413_14_535
Length 173
Sequence VSQARLPFDGDERSIDEITIFCDGGSRGNPGPAAVGAVVLDATTDPPTRVASVSETIGVTTNNVAEYRALLLALDRAERRGASEVWIESDSLLLVEQILGRFRVKATHLQPLFAEALRRAKTFPKFAIRHVRREQNVDADRLANLGADESERLLAAATAGDASPWGGDTAPGR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 8.18
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100552762 3300005329 Bacteria 1101
2 Ga0070670_100017339 3300005331 Bacteria 6176
3 Ga0070677_10221476 3300005333 Bacteria 924
4 Ga0070666_10001310 3300005335 Bacteria 15070
5 Ga0070680_101186446 3300005336 Bacteria 660
6 Ga0070682_100143732 3300005337 Bacteria 1629
7 Ga0068868_100035138 3300005338 Bacteria 3873
8 Ga0070689_100128551 3300005340 Bacteria 2030
9 Ga0070689_100443807 3300005340 Bacteria 1103
10 Ga0070687_100836318 3300005343 Bacteria 655
11 Ga0070675_100076334 3300005354 Bacteria 2787
12 Ga0070671_100040229 3300005355 Bacteria 3882
13 Ga0070674_100044408 3300005356 Bacteria 3029
14 Ga0070674_100168970 3300005356 Bacteria 1666
15 Ga0070673_100607184 3300005364 Bacteria 998
16 Ga0070673_102100116 3300005364 Bacteria 537
17 Ga0070688_100077588 3300005365 Bacteria 2140
18 Ga0070667_100000501 3300005367 Bacteria 39630
19 Ga0070667_100218922 3300005367 Bacteria 1694
20 Ga0070667_100799566 3300005367 Bacteria 875
21 Ga0070709_10105725 3300005434 Bacteria 1883
22 Ga0070713_100189022 3300005436 Bacteria 1855
23 Ga0070713_100789919 3300005436 Bacteria 910
24 Ga0070713_100950349 3300005436 Bacteria 828
25 Ga0070710_10015936 3300005437 Bacteria 3813
26 Ga0070701_10510238 3300005438 Bacteria 782
27 Ga0070705_100076928 3300005440 Bacteria 2036
28 Ga0070705_100852864 3300005440 Bacteria 729
29 Ga0070700_100021860 3300005441 Bacteria 3723
30 Ga0070700_100099142 3300005441 Unclassified 1916
31 Ga0070708_100008308 3300005445 Bacteria 8336
32 Ga0070663_100005698 3300005455 Bacteria 7423
33 Ga0070663_100090740 3300005455 Bacteria 2263
34 Ga0070678_100026234 3300005456 Bacteria 3936
35 Ga0070678_100094210 3300005456 Bacteria 2305
36 Ga0070678_100391371 3300005456 Bacteria 1205
37 Ga0070662_100440646 3300005457 Bacteria 1080
38 Ga0068867_100005233 3300005459 Bacteria 9156
39 Ga0070706_100006037 3300005467 Bacteria 11445
40 Ga0070706_100042550 3300005467 Bacteria 4197
41 Ga0070707_100060973 3300005468 Bacteria 3618
42 Ga0070707_100157213 3300005468 Bacteria 2215
43 Ga0070707_100631328 3300005468 Bacteria 1034
44 Ga0070698_100059312 3300005471 Bacteria 3865
45 Ga0070698_100073448 3300005471 Bacteria 3427
46 Ga0070699_100016464 3300005518 Bacteria 6350
47 Ga0070679_101098686 3300005530 Bacteria 740
48 Ga0070684_100553810 3300005535 Bacteria 1067
49 Ga0070684_100666791 3300005535 Bacteria 969
50 Ga0070697_100046479 3300005536 Bacteria 3518
51 Ga0068853_100396993 3300005539 Bacteria 1290
52 Ga0070672_100003014 3300005543 Bacteria 10851
53 Ga0070672_100253182 3300005543 Bacteria 1483
54 Ga0070686_100079416 3300005544 Bacteria 2169
55 Ga0070686_100394983 3300005544 Bacteria 1050
56 Ga0070665_100046658 3300005548 Bacteria 4350
57 Ga0070665_101524638 3300005548 Bacteria 677
58 Ga0070704_100068012 3300005549 Bacteria 2575
59 Ga0070704_100217225 3300005549 Unclassified 1552
60 Ga0070664_100009123 3300005564 Bacteria 8052
61 Ga0070664_100367353 3300005564 Bacteria 1311
62 Ga0068856_100004897 3300005614 Bacteria 13255
63 Ga0068856_101659678 3300005614 Bacteria 652
64 Ga0070702_100050210 3300005615 Bacteria 2382
65 Ga0068859_100000791 3300005617 Bacteria 32046
66 Ga0068864_100040347 3300005618 Bacteria 3993
67 Ga0068864_101291201 3300005618 Unclassified 730
68 Ga0068866_10019852 3300005718 Bacteria 3068
69 Ga0068866_11431197 3300005718 Bacteria 506
70 Ga0068863_100161977 3300005841 Bacteria 2143
71 Ga0068863_100739971 3300005841 Bacteria 979
72 Ga0068863_101594304 3300005841 Bacteria 662
73 Ga0068858_100002206 3300005842 Bacteria 19715
74 Ga0068858_100423022 3300005842 Bacteria 1281
75 Ga0068858_100775515 3300005842 Bacteria 935
76 Ga0068860_100002468 3300005843 Bacteria 19416
77 Ga0068860_100726479 3300005843 Bacteria 1004
78 Ga0068860_100828656 3300005843 Bacteria 939
79 Ga0081455_10170103 3300005937 Bacteria 1661
80 Ga0070717_10046096 3300006028 Bacteria 3566
81 Ga0070717_10728650 3300006028 Bacteria 901
82 Ga0075368_10389337 3300006042 Bacteria 611
83 Ga0075363_100037185 3300006048 Bacteria 2556
84 Ga0075432_10106481 3300006058 Bacteria 1041
85 Ga0070712_100070607 3300006175 Bacteria 2496
86 Ga0075367_10287043 3300006178 Bacteria 1035
87 Ga0097621_100085277 3300006237 Bacteria 2634
88 Ga0097621_100280937 3300006237 Bacteria 1465
89 Ga0068871_100124951 3300006358 Bacteria 2177
90 Ga0075428_100028787 3300006844 Bacteria 6148
91 Ga0075428_100080758 3300006844 Bacteria 3549
92 Ga0075428_100167620 3300006844 Bacteria 2382
93 Ga0075430_100011703 3300006846 Bacteria 7467
94 Ga0075430_100146508 3300006846 Bacteria 1966
95 Ga0075430_100707235 3300006846 Bacteria 831
96 Ga0075430_101186349 3300006846 Bacteria 628
97 Ga0075431_100010606 3300006847 Bacteria 9267
98 Ga0075431_100627759 3300006847 Bacteria 1056
99 Ga0075431_100858541 3300006847 Unclassified 879
100 Ga0075433_10012899 3300006852 Bacteria 6773
101 Ga0075434_100285222 3300006871 Bacteria 1671
102 Ga0075429_100527529 3300006880 Bacteria 1035
103 Ga0068865_100027750 3300006881 Bacteria 3743
104 Ga0075436_100002602 3300006914 Bacteria 12397
105 Ga0097620_100000791 3300006931 Bacteria 32046
106 Ga0075435_100017441 3300007076 Bacteria 5437
107 Ga0075435_100548380 3300007076 Bacteria 1001
108 Ga0105240_10761935 3300009093 Bacteria 1051
109 Ga0111539_10184005 3300009094 Bacteria 2440
110 Ga0111539_10330232 3300009094 Archaea 1775
111 Ga0111539_10455533 3300009094 Bacteria 1490
112 Ga0111539_11087677 3300009094 Bacteria 929
113 Ga0111539_11372407 3300009094 Bacteria 820
114 Ga0105245_10032815 3300009098 Bacteria 4598
115 Ga0105245_10396536 3300009098 Bacteria 1378
116 Ga0105245_10584761 3300009098 Bacteria 1141
117 Ga0105245_11084734 3300009098 Bacteria 847
118 Ga0105245_11580923 3300009098 Bacteria 707
119 Ga0105247_10806380 3300009101 Bacteria 717
120 Ga0114129_10173887 3300009147 Bacteria 2934
121 Ga0114129_10330494 3300009147 Bacteria 2024
122 Ga0114129_10395486 3300009147 Bacteria 1822
123 Ga0114129_10901711 3300009147 Unclassified 1120
124 Ga0114129_11000185 3300009147 Bacteria 1053
125 Ga0105243_10110266 3300009148 Bacteria 2301
126 Ga0105243_10111302 3300009148 Bacteria 2292
127 Ga0105243_10297386 3300009148 Bacteria 1461
128 Ga0105242_10109790 3300009176 Bacteria 2349
129 Ga0105242_11422217 3300009176 Bacteria 722
130 Ga0105248_10001409 3300009177 Bacteria 26858
131 Ga0105248_10369653 3300009177 Bacteria 1614
132 Ga0105248_11079081 3300009177 Bacteria 907
133 Ga0105249_10183221 3300009553 Bacteria 2039
134 Ga0105249_10898772 3300009553 Bacteria 952
135 Ga0105249_11474206 3300009553 Archaea 753
136 Ga0105239_10482611 3300010375 Bacteria 1408
137 Ga0105246_10033177 3300011119 Bacteria 3430
138 Ga0157374_10008791 3300013296 Bacteria 8642
139 Ga0157378_10009416 3300013297 Bacteria 8510
140 Ga0157378_10030178 3300013297 Bacteria 4790
141 Ga0157375_10046892 3300013308 Bacteria 4216
142 Ga0157375_10176470 3300013308 Bacteria 2286
143 Ga0157375_11233881 3300013308 Bacteria 878
144 Ga0157375_11372597 3300013308 Bacteria 832
145 Ga0157375_11717391 3300013308 Archaea 743
146 Ga0157375_11949949 3300013308 Unclassified 698
147 Ga0163163_10102671 3300014325 Bacteria 2883
148 Ga0163163_10566633 3300014325 Bacteria 1199
149 Ga0163163_11223820 3300014325 Bacteria 813
150 Ga0163163_11651778 3300014325 Bacteria 701
151 Ga0157377_10205173 3300014745 Bacteria 1254
152 Ga0157377_10606685 3300014745 Archaea 781
153 Ga0157379_10000133 3300014968 Bacteria 52942
154 Ga0157379_11070470 3300014968 Bacteria 771
155 Ga0157376_10009389 3300014969 Bacteria 7105
156 Ga0157376_10138756 3300014969 Bacteria 2179
157 Ga0157376_10545818 3300014969 Bacteria 1146
158 Ga0157376_12162222 3300014969 Bacteria 595
159 Ga0163161_11182502 3300017792 Bacteria 660
160 Ga0206353_10074878 3300020082 Bacteria 1127
161 Ga0207710_10347161 3300025900 Bacteria 755
162 Ga0207680_10385018 3300025903 Bacteria 989
163 Ga0207685_10060143 3300025905 Bacteria 1501
164 Ga0207699_10051328 3300025906 Bacteria 2437
165 Ga0207684_10011021 3300025910 Bacteria 7924
166 Ga0207693_10654690 3300025915 Bacteria 816
167 Ga0207663_10756929 3300025916 Bacteria 772
168 Ga0207662_11008318 3300025918 Bacteria 591
169 Ga0207646_10503265 3300025922 Bacteria 1091
170 Ga0207650_10423229 3300025925 Bacteria 1105
171 Ga0207687_10148136 3300025927 Bacteria 1788
172 Ga0207687_10327140 3300025927 Bacteria 1242
173 Ga0207700_10180591 3300025928 Bacteria 1767
174 Ga0207644_10064011 3300025931 Bacteria 2671
175 Ga0207644_10358377 3300025931 Unclassified 1186
176 Ga0207690_10622269 3300025932 Bacteria 883
177 Ga0207686_10054979 3300025934 Bacteria 2495
178 Ga0207709_10346548 3300025935 Bacteria 1120
179 Ga0207709_10796016 3300025935 Bacteria 763
180 Ga0207670_10219314 3300025936 Bacteria 1455
181 Ga0207669_10142961 3300025937 Bacteria 1664
182 Ga0207704_10107378 3300025938 Bacteria 1878
183 Ga0207665_10160229 3300025939 Bacteria 1618
184 Ga0207691_10345576 3300025940 Archaea 1273
185 Ga0207651_11306074 3300025960 Bacteria 652
186 Ga0207712_10163557 3300025961 Bacteria 1732
187 Ga0207677_10066876 3300026023 Bacteria 2515
188 Ga0207703_10166208 3300026035 Unclassified 1936
189 Ga0207678_10058349 3300026067 Bacteria 3321
190 Ga0207708_10122790 3300026075 Unclassified 2024
191 Ga0207708_10588825 3300026075 Bacteria 941
192 Ga0207641_11212149 3300026088 Bacteria 754
193 Ga0207648_10450653 3300026089 Bacteria 1172
194 Ga0207676_10126753 3300026095 Bacteria 2163
195 Ga0207683_10033508 3300026121 Bacteria 4461
196 Ga0207683_10113597 3300026121 Bacteria 2426
197 Ga0207698_10395266 3300026142 Bacteria 1319
198 Ga0209813_10385888 3300027866 Bacteria 561
199 Ga0268266_10371748 3300028379 Bacteria 1346
200 Ga0268266_10501690 3300028379 Bacteria 1159
201 Ga0268266_10735123 3300028379 Bacteria 952
202 Ga0268264_11009014 3300028381 Bacteria 839
203 Ga0268264_11369394 3300028381 Bacteria 718
204 Ga0265338_10001315 3300028800 Bacteria 40706
205 Ga0265338_10329169 3300028800 Bacteria 1104
206 Ga0265325_10002817 3300031241 Bacteria 11598
207 Ga0265339_10008331 3300031249 Bacteria 6601
208 Ga0265339_10042711 3300031249 Bacteria 2510
209 Ga0265331_10150217 3300031250 Bacteria 1058
210 Ga0265327_10003836 3300031251 Bacteria 13876
211 Ga0265327_10033861 3300031251 Bacteria 2841
212 Ga0265327_10036653 3300031251 Bacteria 2693
213 Ga0265327_10051324 3300031251 Bacteria 2154
214 Ga0265327_10103403 3300031251 Bacteria 1371
215 Ga0265313_10001049 3300031595 Bacteria 26890
216 Ga0265313_10206170 3300031595 Bacteria 816
217 Ga0265314_10107654 3300031711 Bacteria 1778
218 Ga0265314_10112990 3300031711 Bacteria 1723
219 Ga0316577_10302693 3300031733 Bacteria 906
220 Ga0373944_0108839 3300035089 Bacteria 944
221 Ga0373944_0202651 3300035089 Bacteria 719
222 Ga0373923_0027399 3300035111 Bacteria 2274
223 Ga0373939_0236847 3300035114 Bacteria 705
224 Ga0373956_0326982 3300035119 Bacteria 731
225 Ga0373943_0156197 3300035170 Bacteria 1239
226 Ga0373946_0085560 3300035171 Unclassified 1388
227 Ga0373955_0081492 3300035172 Bacteria 1830
228 Ga0316574_0052565 3300035398 Bacteria 2541
229 Ga0373931_0038224 3300035691 Bacteria 2510
230 Ga0373935_0164695 3300035692 Bacteria 1513
231 Ga0373935_0251087 3300035692 Bacteria 1238
232 Ga0373927_0227264 3300035695 Bacteria 1226
233 Ga0373933_0236928 3300035724 Bacteria 1173
234 Ga0373947_0307923 3300035725 Bacteria 1057
235 Ga0373947_1042459 3300035725 Bacteria 558
236 Ga0373937_0782469 3300036401 Bacteria 902
237 Ga0373937_0860054 3300036401 Bacteria 855
238 Ga0316584_0501250 3300036712 Bacteria 853
239 Ga0373925_0376105 3300037068 Bacteria 1156
240 Ga0436365_1597653 3300039437 Unclassified 547
241 Ga0436365_1907222 3300039437 Bacteria 878
242 Ga0451798_0417413 3300041458 Bacteria 750
243 Ga0495592_0334753 3300046454 Bacteria 975
244 Ga0495603_0459355 3300046455 Archaea 729
245 Ga0495641_0518866 3300046461 Bacteria 544
246 Ga0495653_0976832 3300046463 Bacteria 502
247 Ga0495605_0396013 3300046474 Bacteria 575
248 Ga0495664_0951435 3300046477 Bacteria 501
249 Ga0495585_0389601 3300046492 Bacteria 672
250 Ga0495596_0202632 3300046500 Bacteria 771
251 Ga0495583_0280217 3300046506 Bacteria 665
252 Ga0495608_0289059 3300046511 Bacteria 1016
253 Ga0495608_0444885 3300046511 Bacteria 789
254 Ga0495630_0604692 3300046517 Bacteria 840
255 Ga0495630_0642083 3300046517 Bacteria 813
256 Ga0495666_0357820 3300046526 Bacteria 657
257 Ga0495640_0224774 3300046533 Bacteria 1183
258 Ga0495586_0422407 3300046535 Bacteria 768
259 Ga0495622_0452340 3300046557 Bacteria 551
260 Ga0495667_0254014 3300046559 Bacteria 1119
261 Ga0495668_0144530 3300046616 Bacteria 1302
262 Ga0495668_0525483 3300046616 Bacteria 653
263 Ga0495634_0417856 3300046642 Bacteria 795
264 Ga0495635_0135301 3300046663 Bacteria 1680
265 Ga0495635_0182833 3300046663 Bacteria 1424
266 Ga0495657_0309396 3300046675 Bacteria 941
267 Ga0495647_0105446 3300046681 Archaea 1171
268 Ga0495647_0298672 3300046681 Bacteria 726
269 Ga0495658_0207500 3300046683 Unclassified 1223
270 Ga0495613_0210129 3300046689 Unclassified 1369
271 Ga0495613_0938223 3300046689 Bacteria 558
272 Ga0495670_0101400 3300046691 Bacteria 1483
273 Ga0495600_0556997 3300046809 Bacteria 700
274 Ga0495581_0305825 3300047315 Bacteria 929
275 Ga0495604_0309921 3300047317 Bacteria 1058
276 Ga0495674_0138370 3300047319 Bacteria 2048
277 Ga0495674_0534270 3300047319 Bacteria 935
278 Ga0495674_0741737 3300047319 Unclassified 768
279 Ga0495672_0292152 3300047320 Bacteria 775
280 Ga0495676_0048540 3300047321 Bacteria 3422
281 Ga0495676_0054307 3300047321 Archaea 3186
282 Ga0495676_0215164 3300047321 Bacteria 1327
283 Ga0495680_0277002 3300047322 Bacteria 1183
284 Ga0495684_0239730 3300047471 Bacteria 1323
285 Ga0496101_0017087 3300048904 Bacteria 4914
286 Ga0496102_0072310 3300048905 Bacteria 3169
287 Ga0496102_1181667 3300048905 Bacteria 684
288 Ga0496102_1350648 3300048905 Archaea 632
289 Ga0496103_0202923 3300048906 Bacteria 1275
290 Ga0496103_0795427 3300048906 Unclassified 597
291 Ga0496104_0028154 3300048907 Bacteria 5207
292 Ga0496104_0192225 3300048907 Bacteria 1953
293 Ga0496104_0437005 3300048907 Bacteria 1220
294 Ga0496105_0015649 3300048908 Bacteria 6050
295 Ga0496105_0026117 3300048908 Bacteria 4760
296 Ga0496105_0127297 3300048908 Bacteria 2100
297 Ga0496107_0024874 3300048910 Bacteria 4238
298 Ga0496108_0003643 3300048911 Bacteria 12350
299 Ga0496108_0387198 3300048911 Unclassified 1221
300 Ga0496109_0169990 3300048912 Bacteria 2044
301 Ga0496109_0216536 3300048912 Bacteria 1801
302 Ga0496109_0843475 3300048912 Bacteria 854
303 Ga0496109_1365572 3300048912 Bacteria 644
304 Ga0496109_1998907 3300048912 Bacteria 512
305 Ga0496110_0021032 3300048913 Bacteria 5515
306 Ga0496110_0383603 3300048913 Bacteria 1281
307 Ga0496110_1310614 3300048913 Unclassified 633
308 Ga0496111_0827507 3300048914 Bacteria 669
309 Ga0496112_0019209 3300048915 Bacteria 6446
310 Ga0496112_0047528 3300048915 Bacteria 4210
311 Ga0496112_0178081 3300048915 Bacteria 2090
312 Ga0496112_0331758 3300048915 Bacteria 1465
313 Ga0496114_0023931 3300048917 Bacteria 4984
314 Ga0496115_0004858 3300048918 Bacteria 9751
315 Ga0496115_0088253 3300048918 Bacteria 2532
316 Ga0501032_0241807 3300049569 Bacteria 1173
317 Ga0501034_0140544 3300049571 Bacteria 2394
318 Ga0501034_0338905 3300049571 Bacteria 1434
319 Ga0501034_0619508 3300049571 Bacteria 986
320 Ga0501034_1148132 3300049571 Bacteria 657
321 Ga0501036_0814621 3300049572 Bacteria 768
322 Ga0501036_0842180 3300049572 Bacteria 754
323 Ga0501037_0736834 3300049573 Bacteria 654
324 Ga0501038_0370582 3300049574 Bacteria 1112
325 Ga0501039_0153214 3300049575 Bacteria 1811
326 Ga0501040_0209920 3300049576 Unclassified 1384
327 Ga0501040_0807839 3300049576 Bacteria 679
328 Ga0501040_0967863 3300049576 Bacteria 617
329 Ga0501043_0605638 3300049579 Bacteria 809
330 Ga0501046_0092412 3300049580 Bacteria 2326
331 Ga0501047_0028736 3300049581 Bacteria 5362
332 Ga0501047_0259472 3300049581 Bacteria 1586
333 Ga0501047_0472603 3300049581 Bacteria 1082
334 Ga0501048_0188908 3300049582 Bacteria 1460
335 Ga0501068_0174422 3300049584 Bacteria 1358
336 Ga0501070_0098033 3300049586 Bacteria 2424
337 Ga0501071_0114750 3300049587 Bacteria 1993
338 Ga0501071_0262756 3300049587 Bacteria 1304
339 Ga0501072_0268579 3300049588 Bacteria 1357
340 Ga0501073_0068083 3300049589 Bacteria 2482
341 Ga0501073_0779253 3300049589 Bacteria 659
342 Ga0501074_0803029 3300049590 Bacteria 663
343 Ga0501075_0017140 3300049591 Bacteria 5229
344 Ga0501075_0733454 3300049591 Unclassified 752
345 Ga0501077_0102010 3300049593 Bacteria 1818
346 Ga0501079_0045283 3300049741 Bacteria 3395
347 Ga0501079_1087187 3300049741 Bacteria 630
348 Ga0501080_0019807 3300049742 Bacteria 6229
349 Ga0501081_0492695 3300049743 Bacteria 913
350 Ga0501083_0564058 3300049744 Bacteria 741
351 Ga0501044_0045988 3300049823 Bacteria 4521
352 Ga0501045_0664033 3300049824 Unclassified 770
353 Ga0501045_0882180 3300049824 Bacteria 657
354 nmdc:mga03n38_261521_c1 3300050490 Bacteria 917
355 nmdc:mga06z11_244818_c1 3300050494 Bacteria 1054
356 nmdc:mga05p37_100384_c1 3300050507 Bacteria 3565
357 nmdc:mga05p37_141047_c1 3300050507 Bacteria 2953
358 nmdc:mga05p37_398066_c1 3300050507 Bacteria 1608
359 nmdc:mga05p37_835491_c1 3300050507 Unclassified 1002
360 nmdc:mga09592_19061_c1 3300050508 Bacteria 5630
361 nmdc:mga09592_309027_c1 3300050508 Bacteria 1370
362 nmdc:mga09592_513917_c1 3300050508 Bacteria 1030
363 nmdc:mga0qj67_134519_c1 3300050509 Bacteria 2003
364 nmdc:mga0qj67_18654_c1 3300050509 Bacteria 5289
365 nmdc:mga0qj67_291149_c1 3300050509 Bacteria 1323
366 nmdc:mga0qj67_55185_c1 3300050509 Bacteria 3147
367 nmdc:mga0qj67_573849_c1 3300050509 Bacteria 904
368 nmdc:mga06r32_1243291_c1 3300050510 Bacteria 690
369 nmdc:mga06r32_807117_c1 3300050510 Bacteria 899
370 nmdc:mga08y16_1348037_c1 3300050511 Bacteria 678
371 nmdc:mga08y16_457224_c1 3300050511 Unclassified 1301
372 nmdc:mga08y16_793582_c1 3300050511 Archaea 940
373 nmdc:mga0n895_657039_c1 3300050512 Bacteria 1047
374 nmdc:mga0rr50_337345_c1 3300050513 Bacteria 1266
375 nmdc:mga0rr50_420100_c1 3300050513 Bacteria 1131
376 nmdc:mga0rr50_54581_c1 3300050513 Bacteria 2978
377 nmdc:mga08x19_43711_c1 3300050514 Bacteria 2858
378 nmdc:mga0a205_256126_c1 3300050515 Bacteria 1629
379 nmdc:mga0a205_292254_c1 3300050515 Unclassified 1504
380 Ga0495601_0022086 3300053077 Bacteria 3905
381 Ga0495612_0246050 3300053078 Archaea 795
382 Ga0495595_0048465 3300053084 Bacteria 1962
383 Ga0495619_0069972 3300053085 Bacteria 2346
384 Ga0495619_0189808 3300053085 Bacteria 1422
385 Ga0495619_0342860 3300053085 Bacteria 1034
386 Ga0501084_0115971 3300054114 Bacteria 2251
387 Ga0501084_0465758 3300054114 Bacteria 1068
388 Ga0501082_0050405 3300060353 Bacteria 3590
389 Ga0501082_0491457 3300060353 Bacteria 1073
390 Ga0530510_0027961 3300061734 Bacteria 4042
391 Ga0530510_0044999 3300061734 Unclassified 3189

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_11949949 Ga0157375_119499492 126
2 3300049571 Ga0501034_1148132 Ga0501034_1148132_29_418 127
3 3300049573 Ga0501037_0736834 Ga0501037_0736834_151_540 127
4 3300049574 Ga0501038_0370582 Ga0501038_0370582_679_1068 127
5 3300049575 Ga0501039_0153214 Ga0501039_0153214_579_968 127
6 3300049576 Ga0501040_0209920 Ga0501040_0209920_808_1197 127
7 3300049587 Ga0501071_0114750 Ga0501071_0114750_95_484 127
8 3300049588 Ga0501072_0268579 Ga0501072_0268579_945_1334 127
9 3300049591 Ga0501075_0017140 Ga0501075_0017140_916_1305 127
10 3300049593 Ga0501077_0102010 Ga0501077_0102010_133_522 127
11 3300049741 Ga0501079_0045283 Ga0501079_0045283_1264_1653 127
12 3300049743 Ga0501081_0492695 Ga0501081_0492695_267_656 127
13 3300054114 Ga0501084_0115971 Ga0501084_0115971_1669_2058 127
14 3300060353 Ga0501082_0050405 Ga0501082_0050405_2520_2909 127
15 3300061734 Ga0530510_0027961 Ga0530510_0027961_2517_2906 127
16 3300009101 Ga0105247_10806380 Ga0105247_108063802 130
17 3300014968 Ga0157379_11070470 Ga0157379_110704702 130
18 3300025900 Ga0207710_10347161 Ga0207710_103471612 130
19 3300005331 Ga0070670_100017339 Ga0070670_1000173395 131
20 3300005333 Ga0070677_10221476 Ga0070677_102214761 131
21 3300005335 Ga0070666_10001310 Ga0070666_100013106 131
22 3300005338 Ga0068868_100035138 Ga0068868_1000351384 131
23 3300005340 Ga0070689_100128551 Ga0070689_1001285512 131
24 3300005354 Ga0070675_100076334 Ga0070675_1000763344 131
25 3300005355 Ga0070671_100040229 Ga0070671_1000402294 131
26 3300005356 Ga0070674_100044408 Ga0070674_1000444084 131
27 3300005364 Ga0070673_102100116 Ga0070673_1021001161 131
28 3300005365 Ga0070688_100077588 Ga0070688_1000775882 131
29 3300005367 Ga0070667_100000501 Ga0070667_1000005013 131
30 3300005367 Ga0070667_100218922 Ga0070667_1002189222 131
31 3300005367 Ga0070667_100799566 Ga0070667_1007995662 131
32 3300005455 Ga0070663_100005698 Ga0070663_1000056985 131
33 3300005455 Ga0070663_100090740 Ga0070663_1000907401 131
34 3300005456 Ga0070678_100026234 Ga0070678_1000262342 131
35 3300005457 Ga0070662_100440646 Ga0070662_1004406461 131
36 3300005459 Ga0068867_100005233 Ga0068867_1000052338 131
37 3300005539 Ga0068853_100396993 Ga0068853_1003969932 131
38 3300005543 Ga0070672_100003014 Ga0070672_1000030144 131
39 3300005543 Ga0070672_100253182 Ga0070672_1002531822 131
40 3300005544 Ga0070686_100079416 Ga0070686_1000794162 131
41 3300005548 Ga0070665_100046658 Ga0070665_1000466586 131
42 3300005549 Ga0070704_100217225 Ga0070704_1002172252 131
43 3300005564 Ga0070664_100009123 Ga0070664_1000091236 131
44 3300005564 Ga0070664_100367353 Ga0070664_1003673532 131
45 3300005614 Ga0068856_100004897 Ga0068856_1000048977 131
46 3300005615 Ga0070702_100050210 Ga0070702_1000502102 131
47 3300005617 Ga0068859_100000791 Ga0068859_10000079130 131
48 3300005618 Ga0068864_100040347 Ga0068864_1000403474 131
49 3300005618 Ga0068864_101291201 Ga0068864_1012912011 131
50 3300005718 Ga0068866_10019852 Ga0068866_100198522 131
51 3300005718 Ga0068866_11431197 Ga0068866_114311971 131
52 3300005841 Ga0068863_100161977 Ga0068863_1001619773 131
53 3300005842 Ga0068858_100002206 Ga0068858_1000022067 131
54 3300005842 Ga0068858_100423022 Ga0068858_1004230222 131
55 3300005843 Ga0068860_100002468 Ga0068860_1000024682 131
56 3300005843 Ga0068860_100726479 Ga0068860_1007264791 131
57 3300006237 Ga0097621_100085277 Ga0097621_1000852772 131
58 3300006237 Ga0097621_100280937 Ga0097621_1002809372 131
59 3300006358 Ga0068871_100124951 Ga0068871_1001249512 131
60 3300006881 Ga0068865_100027750 Ga0068865_1000277504 131
61 3300006931 Ga0097620_100000791 Ga0097620_1000007914 131
62 3300009148 Ga0105243_10110266 Ga0105243_101102664 131
63 3300009177 Ga0105248_10001409 Ga0105248_100014096 131
64 3300009177 Ga0105248_10369653 Ga0105248_103696532 131
65 3300009177 Ga0105248_11079081 Ga0105248_110790812 131
66 3300013296 Ga0157374_10008791 Ga0157374_100087918 131
67 3300013297 Ga0157378_10009416 Ga0157378_100094164 131
68 3300013297 Ga0157378_10030178 Ga0157378_100301782 131
69 3300013308 Ga0157375_10046892 Ga0157375_100468924 131
70 3300013308 Ga0157375_10176470 Ga0157375_101764702 131
71 3300013308 Ga0157375_11233881 Ga0157375_112338811 131
72 3300014325 Ga0163163_10102671 Ga0163163_101026712 131
73 3300014745 Ga0157377_10205173 Ga0157377_102051732 131
74 3300014968 Ga0157379_10000133 Ga0157379_1000013315 131
75 3300014969 Ga0157376_10009389 Ga0157376_100093893 131
76 3300014969 Ga0157376_10138756 Ga0157376_101387564 131
77 3300014969 Ga0157376_12162222 Ga0157376_121622222 131
78 3300025903 Ga0207680_10385018 Ga0207680_103850182 131
79 3300025925 Ga0207650_10423229 Ga0207650_104232292 131
80 3300025931 Ga0207644_10064011 Ga0207644_100640112 131
81 3300025931 Ga0207644_10358377 Ga0207644_103583772 131
82 3300025938 Ga0207704_10107378 Ga0207704_101073782 131
83 3300025960 Ga0207651_11306074 Ga0207651_113060742 131
84 3300026023 Ga0207677_10066876 Ga0207677_100668764 131
85 3300026067 Ga0207678_10058349 Ga0207678_100583494 131
86 3300026088 Ga0207641_11212149 Ga0207641_112121492 131
87 3300026089 Ga0207648_10450653 Ga0207648_104506532 131
88 3300026095 Ga0207676_10126753 Ga0207676_101267534 131
89 3300026121 Ga0207683_10033508 Ga0207683_100335084 131
90 3300026142 Ga0207698_10395266 Ga0207698_103952662 131
91 3300028379 Ga0268266_10371748 Ga0268266_103717482 131
92 3300035089 Ga0373944_0202651 Ga0373944_0202651_66_530 131
93 3300009147 Ga0114129_11000185 Ga0114129_110001852 133
94 3300049576 Ga0501040_0807839 Ga0501040_0807839_107_568 133
95 3300026035 Ga0207703_10166208 Ga0207703_101662082 134
96 3300049571 Ga0501034_0619508 Ga0501034_0619508_535_957 134
97 3300049581 Ga0501047_0259472 Ga0501047_0259472_751_1173 134
98 3300009094 Ga0111539_11087677 Ga0111539_110876772 135
99 3300014325 Ga0163163_11223820 Ga0163163_112238202 135
100 3300014969 Ga0157376_10545818 Ga0157376_105458182 135
101 3300035170 Ga0373943_0156197 Ga0373943_0156197_42_452 135
102 3300035725 Ga0373947_1042459 Ga0373947_1042459_48_458 135
103 3300046681 Ga0495647_0105446 Ga0495647_0105446_737_1147 135
104 3300046689 Ga0495613_0938223 Ga0495613_0938223_12_428 135
105 3300047315 Ga0495581_0305825 Ga0495581_0305825_134_544 135
106 3300047321 Ga0495676_0215164 Ga0495676_0215164_336_746 135
107 3300049587 Ga0501071_0262756 Ga0501071_0262756_261_677 135
108 3300005337 Ga0070682_100143732 Ga0070682_1001437322 136
109 3300005440 Ga0070705_100076928 Ga0070705_1000769282 136
110 3300005468 Ga0070707_100631328 Ga0070707_1006313282 136
111 3300005548 Ga0070665_101524638 Ga0070665_1015246382 136
112 3300005549 Ga0070704_100068012 Ga0070704_1000680122 136
113 3300005614 Ga0068856_101659678 Ga0068856_1016596781 136
114 3300005842 Ga0068858_100775515 Ga0068858_1007755152 136
115 3300005937 Ga0081455_10170103 Ga0081455_101701033 136
116 3300006871 Ga0075434_100285222 Ga0075434_1002852222 136
117 3300007076 Ga0075435_100548380 Ga0075435_1005483802 136
118 3300009093 Ga0105240_10761935 Ga0105240_107619352 136
119 3300009098 Ga0105245_10032815 Ga0105245_100328153 136
120 3300009098 Ga0105245_11084734 Ga0105245_110847342 136
121 3300009148 Ga0105243_10297386 Ga0105243_102973862 136
122 3300009176 Ga0105242_10109790 Ga0105242_101097903 136
123 3300010375 Ga0105239_10482611 Ga0105239_104826112 136
124 3300025927 Ga0207687_10148136 Ga0207687_101481363 136
125 3300025934 Ga0207686_10054979 Ga0207686_100549794 136
126 3300025935 Ga0207709_10346548 Ga0207709_103465482 136
127 3300028379 Ga0268266_10501690 Ga0268266_105016902 136
128 3300028381 Ga0268264_11369394 Ga0268264_113693942 136
129 3300028800 Ga0265338_10001315 Ga0265338_1000131521 136
130 3300031241 Ga0265325_10002817 Ga0265325_100028173 136
131 3300031249 Ga0265339_10008331 Ga0265339_100083314 136
132 3300031249 Ga0265339_10042711 Ga0265339_100427113 136
133 3300031250 Ga0265331_10150217 Ga0265331_101502172 136
134 3300031251 Ga0265327_10036653 Ga0265327_100366535 136
135 3300031595 Ga0265313_10001049 Ga0265313_1000104921 136
136 3300031595 Ga0265313_10206170 Ga0265313_102061701 136
137 3300031711 Ga0265314_10107654 Ga0265314_101076543 136
138 3300031711 Ga0265314_10112990 Ga0265314_101129901 136
139 3300031733 Ga0316577_10302693 Ga0316577_103026932 136
140 3300035089 Ga0373944_0108839 Ga0373944_0108839_271_720 136
141 3300035111 Ga0373923_0027399 Ga0373923_0027399_745_1194 136
142 3300035172 Ga0373955_0081492 Ga0373955_0081492_1218_1667 136
143 3300035398 Ga0316574_0052565 Ga0316574_0052565_744_1223 136
144 3300035692 Ga0373935_0164695 Ga0373935_0164695_898_1347 136
145 3300035695 Ga0373927_0227264 Ga0373927_0227264_535_984 136
146 3300035724 Ga0373933_0236928 Ga0373933_0236928_141_590 136
147 3300036712 Ga0316584_0501250 Ga0316584_0501250_253_732 136
148 3300037068 Ga0373925_0376105 Ga0373925_0376105_173_622 136
149 3300046461 Ga0495641_0518866 Ga0495641_0518866_69_518 136
150 3300046533 Ga0495640_0224774 Ga0495640_0224774_274_723 136
151 3300046663 Ga0495635_0182833 Ga0495635_0182833_491_940 136
152 3300047319 Ga0495674_0138370 Ga0495674_0138370_1179_1628 136
153 3300047319 Ga0495674_0741737 Ga0495674_0741737_145_588 136
154 3300047321 Ga0495676_0048540 Ga0495676_0048540_2129_2578 136
155 3300047471 Ga0495684_0239730 Ga0495684_0239730_631_1080 136
156 3300048905 Ga0496102_0072310 Ga0496102_0072310_1471_1893 136
157 3300048906 Ga0496103_0795427 Ga0496103_0795427_47_463 136
158 3300048911 Ga0496108_0387198 Ga0496108_0387198_333_791 136
159 3300048912 Ga0496109_0843475 Ga0496109_0843475_297_755 136
160 3300048913 Ga0496110_1310614 Ga0496110_1310614_145_567 136
161 3300048915 Ga0496112_0047528 Ga0496112_0047528_2135_2593 136
162 3300048918 Ga0496115_0088253 Ga0496115_0088253_1577_1999 136
163 3300049576 Ga0501040_0967863 Ga0501040_0967863_44_454 136
164 3300049589 Ga0501073_0779253 Ga0501073_0779253_59_505 136
165 3300049824 Ga0501045_0664033 Ga0501045_0664033_170_595 136
166 3300050512 nmdc:mga0n895_657039_c1 nmdc:mga0n895_657039_c1_529_975 136
167 3300050513 nmdc:mga0rr50_420100_c1 nmdc:mga0rr50_420100_c1_40_489 136
168 3300005329 Ga0070683_100552762 Ga0070683_1005527621 137
169 3300005336 Ga0070680_101186446 Ga0070680_1011864461 137
170 3300005340 Ga0070689_100443807 Ga0070689_1004438072 137
171 3300005343 Ga0070687_100836318 Ga0070687_1008363181 137
172 3300005356 Ga0070674_100168970 Ga0070674_1001689703 137
173 3300005364 Ga0070673_100607184 Ga0070673_1006071842 137
174 3300005434 Ga0070709_10105725 Ga0070709_101057251 137
175 3300005436 Ga0070713_100189022 Ga0070713_1001890222 137
176 3300005436 Ga0070713_100789919 Ga0070713_1007899192 137
177 3300005436 Ga0070713_100950349 Ga0070713_1009503491 137
178 3300005437 Ga0070710_10015936 Ga0070710_100159362 137
179 3300005438 Ga0070701_10510238 Ga0070701_105102381 137
180 3300005440 Ga0070705_100852864 Ga0070705_1008528642 137
181 3300005441 Ga0070700_100021860 Ga0070700_1000218604 137
182 3300005441 Ga0070700_100099142 Ga0070700_1000991422 137
183 3300005445 Ga0070708_100008308 Ga0070708_1000083084 137
184 3300005456 Ga0070678_100094210 Ga0070678_1000942103 137
185 3300005456 Ga0070678_100391371 Ga0070678_1003913712 137
186 3300005467 Ga0070706_100006037 Ga0070706_1000060373 137
187 3300005467 Ga0070706_100042550 Ga0070706_1000425503 137
188 3300005468 Ga0070707_100060973 Ga0070707_1000609735 137
189 3300005468 Ga0070707_100157213 Ga0070707_1001572133 137
190 3300005471 Ga0070698_100059312 Ga0070698_1000593123 137
191 3300005471 Ga0070698_100073448 Ga0070698_1000734483 137
192 3300005518 Ga0070699_100016464 Ga0070699_1000164643 137
193 3300005530 Ga0070679_101098686 Ga0070679_1010986861 137
194 3300005535 Ga0070684_100553810 Ga0070684_1005538102 137
195 3300005535 Ga0070684_100666791 Ga0070684_1006667912 137
196 3300005536 Ga0070697_100046479 Ga0070697_1000464792 137
197 3300005544 Ga0070686_100394983 Ga0070686_1003949832 137
198 3300005841 Ga0068863_100739971 Ga0068863_1007399712 137
199 3300005841 Ga0068863_101594304 Ga0068863_1015943042 137
200 3300005843 Ga0068860_100828656 Ga0068860_1008286562 137
201 3300006028 Ga0070717_10046096 Ga0070717_100460962 137
202 3300006028 Ga0070717_10728650 Ga0070717_107286502 137
203 3300006042 Ga0075368_10389337 Ga0075368_103893371 137
204 3300006048 Ga0075363_100037185 Ga0075363_1000371853 137
205 3300006058 Ga0075432_10106481 Ga0075432_101064812 137
206 3300006175 Ga0070712_100070607 Ga0070712_1000706072 137
207 3300006178 Ga0075367_10287043 Ga0075367_102870432 137
208 3300006844 Ga0075428_100028787 Ga0075428_1000287873 137
209 3300006844 Ga0075428_100080758 Ga0075428_1000807586 137
210 3300006844 Ga0075428_100167620 Ga0075428_1001676202 137
211 3300006846 Ga0075430_100011703 Ga0075430_1000117039 137
212 3300006846 Ga0075430_100146508 Ga0075430_1001465082 137
213 3300006846 Ga0075430_100707235 Ga0075430_1007072352 137
214 3300006846 Ga0075430_101186349 Ga0075430_1011863492 137
215 3300006847 Ga0075431_100010606 Ga0075431_10001060612 137
216 3300006847 Ga0075431_100627759 Ga0075431_1006277592 137
217 3300006847 Ga0075431_100858541 Ga0075431_1008585412 137
218 3300006852 Ga0075433_10012899 Ga0075433_100128993 137
219 3300006880 Ga0075429_100527529 Ga0075429_1005275292 137
220 3300006914 Ga0075436_100002602 Ga0075436_10000260213 137
221 3300007076 Ga0075435_100017441 Ga0075435_1000174415 137
222 3300009094 Ga0111539_10184005 Ga0111539_101840053 137
223 3300009094 Ga0111539_10330232 Ga0111539_103302323 137
224 3300009094 Ga0111539_10455533 Ga0111539_104555333 137
225 3300009094 Ga0111539_11372407 Ga0111539_113724072 137
226 3300009098 Ga0105245_10396536 Ga0105245_103965362 137
227 3300009098 Ga0105245_10584761 Ga0105245_105847612 137
228 3300009098 Ga0105245_11580923 Ga0105245_115809231 137
229 3300009147 Ga0114129_10173887 Ga0114129_101738873 137
230 3300009147 Ga0114129_10330494 Ga0114129_103304943 137
231 3300009147 Ga0114129_10395486 Ga0114129_103954863 137
232 3300009147 Ga0114129_10901711 Ga0114129_109017112 137
233 3300009148 Ga0105243_10111302 Ga0105243_101113024 137
234 3300009176 Ga0105242_11422217 Ga0105242_114222172 137
235 3300009553 Ga0105249_10183221 Ga0105249_101832213 137
236 3300009553 Ga0105249_10898772 Ga0105249_108987722 137
237 3300009553 Ga0105249_11474206 Ga0105249_114742061 137
238 3300011119 Ga0105246_10033177 Ga0105246_100331772 137
239 3300013308 Ga0157375_11372597 Ga0157375_113725971 137
240 3300013308 Ga0157375_11717391 Ga0157375_117173911 137
241 3300014325 Ga0163163_10566633 Ga0163163_105666332 137
242 3300014325 Ga0163163_11651778 Ga0163163_116517781 137
243 3300014745 Ga0157377_10606685 Ga0157377_106066851 137
244 3300017792 Ga0163161_11182502 Ga0163161_111825021 137
245 3300020082 Ga0206353_10074878 Ga0206353_100748782 137
246 3300025905 Ga0207685_10060143 Ga0207685_100601432 137
247 3300025906 Ga0207699_10051328 Ga0207699_100513283 137
248 3300025910 Ga0207684_10011021 Ga0207684_100110216 137
249 3300025915 Ga0207693_10654690 Ga0207693_106546901 137
250 3300025916 Ga0207663_10756929 Ga0207663_107569292 137
251 3300025918 Ga0207662_11008318 Ga0207662_110083181 137
252 3300025922 Ga0207646_10503265 Ga0207646_105032652 137
253 3300025927 Ga0207687_10327140 Ga0207687_103271402 137
254 3300025928 Ga0207700_10180591 Ga0207700_101805912 137
255 3300025932 Ga0207690_10622269 Ga0207690_106222692 137
256 3300025935 Ga0207709_10796016 Ga0207709_107960162 137
257 3300025936 Ga0207670_10219314 Ga0207670_102193142 137
258 3300025937 Ga0207669_10142961 Ga0207669_101429612 137
259 3300025939 Ga0207665_10160229 Ga0207665_101602292 137
260 3300025940 Ga0207691_10345576 Ga0207691_103455762 137
261 3300025961 Ga0207712_10163557 Ga0207712_101635573 137
262 3300026075 Ga0207708_10122790 Ga0207708_101227902 137
263 3300026075 Ga0207708_10588825 Ga0207708_105888252 137
264 3300026121 Ga0207683_10113597 Ga0207683_101135973 137
265 3300027866 Ga0209813_10385888 Ga0209813_103858881 137
266 3300028379 Ga0268266_10735123 Ga0268266_107351232 137
267 3300028381 Ga0268264_11009014 Ga0268264_110090142 137
268 3300028800 Ga0265338_10329169 Ga0265338_103291692 137
269 3300031251 Ga0265327_10003836 Ga0265327_100038365 137
270 3300031251 Ga0265327_10033861 Ga0265327_100338612 137
271 3300031251 Ga0265327_10051324 Ga0265327_100513243 137
272 3300031251 Ga0265327_10103403 Ga0265327_101034033 137
273 3300035114 Ga0373939_0236847 Ga0373939_0236847_252_665 137
274 3300035119 Ga0373956_0326982 Ga0373956_0326982_280_717 137
275 3300035171 Ga0373946_0085560 Ga0373946_0085560_124_543 137
276 3300035691 Ga0373931_0038224 Ga0373931_0038224_1413_1826 137
277 3300035692 Ga0373935_0251087 Ga0373935_0251087_443_880 137
278 3300035725 Ga0373947_0307923 Ga0373947_0307923_395_814 137
279 3300036401 Ga0373937_0782469 Ga0373937_0782469_368_781 137
280 3300036401 Ga0373937_0860054 Ga0373937_0860054_205_642 137
281 3300039437 Ga0436365_1597653 Ga0436365_1597653_82_510 137
282 3300039437 Ga0436365_1907222 Ga0436365_1907222_108_581 137
283 3300041458 Ga0451798_0417413 Ga0451798_0417413_14_535 137
284 3300046454 Ga0495592_0334753 Ga0495592_0334753_412_876 137
285 3300046455 Ga0495603_0459355 Ga0495603_0459355_18_431 137
286 3300046463 Ga0495653_0976832 Ga0495653_0976832_14_427 137
287 3300046474 Ga0495605_0396013 Ga0495605_0396013_60_473 137
288 3300046477 Ga0495664_0951435 Ga0495664_0951435_37_450 137
289 3300046492 Ga0495585_0389601 Ga0495585_0389601_70_489 137
290 3300046500 Ga0495596_0202632 Ga0495596_0202632_14_427 137
291 3300046506 Ga0495583_0280217 Ga0495583_0280217_59_490 137
292 3300046511 Ga0495608_0289059 Ga0495608_0289059_332_769 137
293 3300046511 Ga0495608_0444885 Ga0495608_0444885_363_776 137
294 3300046517 Ga0495630_0604692 Ga0495630_0604692_44_457 137
295 3300046517 Ga0495630_0642083 Ga0495630_0642083_232_645 137
296 3300046526 Ga0495666_0357820 Ga0495666_0357820_45_464 137
297 3300046535 Ga0495586_0422407 Ga0495586_0422407_39_560 137
298 3300046557 Ga0495622_0452340 Ga0495622_0452340_26_496 137
299 3300046559 Ga0495667_0254014 Ga0495667_0254014_129_542 137
300 3300046616 Ga0495668_0144530 Ga0495668_0144530_568_981 137
301 3300046616 Ga0495668_0525483 Ga0495668_0525483_74_487 137
302 3300046642 Ga0495634_0417856 Ga0495634_0417856_170_583 137
303 3300046663 Ga0495635_0135301 Ga0495635_0135301_832_1269 137
304 3300046675 Ga0495657_0309396 Ga0495657_0309396_62_499 137
305 3300046681 Ga0495647_0298672 Ga0495647_0298672_85_498 137
306 3300046683 Ga0495658_0207500 Ga0495658_0207500_716_1135 137
307 3300046689 Ga0495613_0210129 Ga0495613_0210129_269_688 137
308 3300046691 Ga0495670_0101400 Ga0495670_0101400_465_884 137
309 3300046809 Ga0495600_0556997 Ga0495600_0556997_130_543 137
310 3300047317 Ga0495604_0309921 Ga0495604_0309921_213_626 137
311 3300047319 Ga0495674_0534270 Ga0495674_0534270_261_698 137
312 3300047320 Ga0495672_0292152 Ga0495672_0292152_90_503 137
313 3300047321 Ga0495676_0054307 Ga0495676_0054307_1141_1560 137
314 3300047322 Ga0495680_0277002 Ga0495680_0277002_568_1005 137
315 3300048904 Ga0496101_0017087 Ga0496101_0017087_1026_1439 137
316 3300048905 Ga0496102_1181667 Ga0496102_1181667_91_504 137
317 3300048905 Ga0496102_1350648 Ga0496102_1350648_49_510 137
318 3300048906 Ga0496103_0202923 Ga0496103_0202923_827_1240 137
319 3300048907 Ga0496104_0028154 Ga0496104_0028154_563_976 137
320 3300048907 Ga0496104_0192225 Ga0496104_0192225_1181_1594 137
321 3300048907 Ga0496104_0437005 Ga0496104_0437005_699_1112 137
322 3300048908 Ga0496105_0015649 Ga0496105_0015649_3220_3633 137
323 3300048908 Ga0496105_0026117 Ga0496105_0026117_2459_2872 137
324 3300048908 Ga0496105_0127297 Ga0496105_0127297_1257_1700 137
325 3300048910 Ga0496107_0024874 Ga0496107_0024874_763_1176 137
326 3300048911 Ga0496108_0003643 Ga0496108_0003643_1811_2254 137
327 3300048912 Ga0496109_0169990 Ga0496109_0169990_35_478 137
328 3300048912 Ga0496109_0216536 Ga0496109_0216536_828_1241 137
329 3300048912 Ga0496109_1365572 Ga0496109_1365572_108_563 137
330 3300048912 Ga0496109_1998907 Ga0496109_1998907_48_461 137
331 3300048913 Ga0496110_0021032 Ga0496110_0021032_2155_2598 137
332 3300048913 Ga0496110_0383603 Ga0496110_0383603_549_962 137
333 3300048914 Ga0496111_0827507 Ga0496111_0827507_33_446 137
334 3300048915 Ga0496112_0019209 Ga0496112_0019209_3889_4332 137
335 3300048915 Ga0496112_0178081 Ga0496112_0178081_376_888 137
336 3300048915 Ga0496112_0331758 Ga0496112_0331758_1009_1422 137
337 3300048917 Ga0496114_0023931 Ga0496114_0023931_3308_3721 137
338 3300048918 Ga0496115_0004858 Ga0496115_0004858_3701_4114 137
339 3300049569 Ga0501032_0241807 Ga0501032_0241807_371_784 137
340 3300049571 Ga0501034_0140544 Ga0501034_0140544_1092_1505 137
341 3300049571 Ga0501034_0338905 Ga0501034_0338905_48_461 137
342 3300049572 Ga0501036_0814621 Ga0501036_0814621_293_706 137
343 3300049572 Ga0501036_0842180 Ga0501036_0842180_305_724 137
344 3300049579 Ga0501043_0605638 Ga0501043_0605638_251_664 137
345 3300049580 Ga0501046_0092412 Ga0501046_0092412_297_710 137
346 3300049581 Ga0501047_0028736 Ga0501047_0028736_2627_3040 137
347 3300049581 Ga0501047_0472603 Ga0501047_0472603_575_988 137
348 3300049582 Ga0501048_0188908 Ga0501048_0188908_617_1036 137
349 3300049584 Ga0501068_0174422 Ga0501068_0174422_669_1094 137
350 3300049586 Ga0501070_0098033 Ga0501070_0098033_479_892 137
351 3300049589 Ga0501073_0068083 Ga0501073_0068083_1381_1794 137
352 3300049590 Ga0501074_0803029 Ga0501074_0803029_223_636 137
353 3300049591 Ga0501075_0733454 Ga0501075_0733454_157_597 137
354 3300049741 Ga0501079_1087187 Ga0501079_1087187_18_491 137
355 3300049742 Ga0501080_0019807 Ga0501080_0019807_5642_6055 137
356 3300049744 Ga0501083_0564058 Ga0501083_0564058_105_599 137
357 3300049823 Ga0501044_0045988 Ga0501044_0045988_1579_1992 137
358 3300049824 Ga0501045_0882180 Ga0501045_0882180_205_624 137
359 3300050490 nmdc:mga03n38_261521_c1 nmdc:mga03n38_261521_c1_307_726 137
360 3300050494 nmdc:mga06z11_244818_c1 nmdc:mga06z11_244818_c1_374_793 137
361 3300050507 nmdc:mga05p37_100384_c1 nmdc:mga05p37_100384_c1_2781_3200 137
362 3300050507 nmdc:mga05p37_141047_c1 nmdc:mga05p37_141047_c1_2432_2851 137
363 3300050507 nmdc:mga05p37_398066_c1 nmdc:mga05p37_398066_c1_1006_1428 137
364 3300050507 nmdc:mga05p37_835491_c1 nmdc:mga05p37_835491_c1_103_522 137
365 3300050508 nmdc:mga09592_19061_c1 nmdc:mga09592_19061_c1_112_531 137
366 3300050508 nmdc:mga09592_309027_c1 nmdc:mga09592_309027_c1_872_1291 137
367 3300050508 nmdc:mga09592_513917_c1 nmdc:mga09592_513917_c1_179_601 137
368 3300050509 nmdc:mga0qj67_134519_c1 nmdc:mga0qj67_134519_c1_1124_1543 137
369 3300050509 nmdc:mga0qj67_18654_c1 nmdc:mga0qj67_18654_c1_548_1012 137
370 3300050509 nmdc:mga0qj67_291149_c1 nmdc:mga0qj67_291149_c1_419_838 137
371 3300050509 nmdc:mga0qj67_55185_c1 nmdc:mga0qj67_55185_c1_724_1188 137
372 3300050509 nmdc:mga0qj67_573849_c1 nmdc:mga0qj67_573849_c1_79_543 137
373 3300050510 nmdc:mga06r32_1243291_c1 nmdc:mga06r32_1243291_c1_118_537 137
374 3300050510 nmdc:mga06r32_807117_c1 nmdc:mga06r32_807117_c1_261_680 137
375 3300050511 nmdc:mga08y16_1348037_c1 nmdc:mga08y16_1348037_c1_112_534 137
376 3300050511 nmdc:mga08y16_457224_c1 nmdc:mga08y16_457224_c1_718_1188 137
377 3300050511 nmdc:mga08y16_793582_c1 nmdc:mga08y16_793582_c1_89_547 137
378 3300050513 nmdc:mga0rr50_337345_c1 nmdc:mga0rr50_337345_c1_295_708 137
379 3300050513 nmdc:mga0rr50_54581_c1 nmdc:mga0rr50_54581_c1_2463_2882 137
380 3300050514 nmdc:mga08x19_43711_c1 nmdc:mga08x19_43711_c1_502_921 137
381 3300050515 nmdc:mga0a205_256126_c1 nmdc:mga0a205_256126_c1_1171_1590 137
382 3300050515 nmdc:mga0a205_292254_c1 nmdc:mga0a205_292254_c1_46_465 137
383 3300053077 Ga0495601_0022086 Ga0495601_0022086_2823_3260 137
384 3300053078 Ga0495612_0246050 Ga0495612_0246050_368_781 137
385 3300053084 Ga0495595_0048465 Ga0495595_0048465_854_1267 137
386 3300053085 Ga0495619_0069972 Ga0495619_0069972_1748_2185 137
387 3300053085 Ga0495619_0189808 Ga0495619_0189808_200_613 137
388 3300053085 Ga0495619_0342860 Ga0495619_0342860_282_743 137
389 3300054114 Ga0501084_0465758 Ga0501084_0465758_69_563 137
390 3300060353 Ga0501082_0491457 Ga0501082_0491457_51_476 137
391 3300061734 Ga0530510_0044999 Ga0530510_0044999_1786_2205 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13456

RVT_3

Reverse transcriptase-like

21

146

0.91

PF00075

RNase_H

RNase H

16

148

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9741 4 135
3hst-assembly2.cif.gz_B n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9699 3 135
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9596 4 135
4e19-assembly2.cif.gz_B crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 0.9455 4 135
3hst-assembly2.cif.gz_B n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9217 3 135
ID Description Score Start End Superfamily
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9741 4 135 3.30.420.10
4e19A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.96 3 135 3.30.420.10
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9596 4 135 3.30.420.10
af_A0A0R0FBC1_213_345_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9362 5 137 3.30.420.10
4e19A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9321 3 135 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A523RAQ2-F1-model_v4 Ribonuclease HI family protein 0.9859 4 135 GO:0003676
GO:0004523
AF-A0A1H3PV32-F1-model_v4 Probable phosphoglycerate mutase 0.9812 4 135 GO:0003676
GO:0004523
GO:0005737
GO:0016791
AF-A0A2N3G5S0-F1-model_v4 RNase H type-1 domain-containing protein 0.9786 1 135 GO:0003676
GO:0004523
AF-A0A523TY04-F1-model_v4 Ribonuclease HI family protein 0.9779 3 134 GO:0003676
GO:0004523
AF-E0X768-F1-model_v4 Ribonuclease H (EC 3.1.26.4) 0.9777 2 135 GO:0003676
GO:0004523

Feature Viewer

pLDDT pTM Quality
97.05 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map