F431686

General Info

Members Datasets Scaffolds Average Seq Length
390 165 387 363

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100046169|Ga0068860_1000461691
Length 380
Sequence MKRYSQVRAMLAITKGSLRAIFRSPSAVIFSFAFPLIFILVFGFIGGGGFAVRVALTNPADTNNFLMKNGLLKNPSIRLVSGLTKEKATSEVGKGNIAAIIEIDSTPIDNGLYQYTLKTTTSSASMDRFPILQAQLGEVVRQADERIFPDRRTVAKIVREKDIPGRQYKTIDFILPGQLGFSLLSAGVFGVAFMFFSLRNTLVLKRFFATPIDRTFIILGEGLSRVLFSLITAVVIILIGYLFFGFTLVHGFETFLEMLVLSFIGLLVFMGFGFIVSGLATSDSSIPPFANLITLPQFLLSGTFFSISAFPNWLQIIAKILPLTYLNQAMRSVAFEGAHFWNVTTRINLFSHYYELPVIFILFLWMIIVYLVAVKVFRWE

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 0
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10166489 3300003316 Bacteria 2759
2 rootH2_10012395 3300003320 Bacteria 5269
3 rootH2_10021482 3300003320 Bacteria 15553
4 rootH2_10133772 3300003320 Bacteria 5458
5 rootL2_10019471 3300003322 Bacteria 8837
6 rootL2_10225036 3300003322 Unclassified 1542
7 rootH1_10192148 3300003323 Bacteria 4140
8 JGI25160J50197_1000882 3300003354 Bacteria 15787
9 Ga0070658_10073405 3300005327 Unclassified 2805
10 Ga0070658_10089230 3300005327 Bacteria 2539
11 Ga0070658_10120780 3300005327 Bacteria 2177
12 Ga0070658_10196196 3300005327 Bacteria 1702
13 Ga0070676_10073211 3300005328 Bacteria 2061
14 Ga0070670_100019947 3300005331 Bacteria 5755
15 Ga0070670_100162490 3300005331 Bacteria 1936
16 Ga0068869_100084106 3300005334 Bacteria 2381
17 Ga0068869_100245773 3300005334 Bacteria 1427
18 Ga0070666_10001393 3300005335 Bacteria 14622
19 Ga0070680_100005675 3300005336 Bacteria 9464
20 Ga0070680_100117646 3300005336 Bacteria 2216
21 Ga0070680_100196388 3300005336 Bacteria 1701
22 Ga0070682_100001134 3300005337 Bacteria 15189
23 Ga0068868_100003187 3300005338 Bacteria 11411
24 Ga0070660_100013094 3300005339 Bacteria 5939
25 Ga0070660_100072177 3300005339 Bacteria 2697
26 Ga0070660_100130377 3300005339 Bacteria 2011
27 Ga0070691_10002457 3300005341 Bacteria 8227
28 Ga0070691_10003801 3300005341 Bacteria 6818
29 Ga0070691_10040846 3300005341 Unclassified 2192
30 Ga0070687_100116618 3300005343 Bacteria 1520
31 Ga0070668_100000106 3300005347 Bacteria 51244
32 Ga0070675_100014690 3300005354 Bacteria 6176
33 Ga0070675_100059639 3300005354 Bacteria 3148
34 Ga0070673_100000229 3300005364 Bacteria 28088
35 Ga0070659_100006261 3300005366 Bacteria 8604
36 Ga0070659_100021670 3300005366 Bacteria 4898
37 Ga0070659_100039321 3300005366 Bacteria 3692
38 Ga0070667_100009450 3300005367 Bacteria 8088
39 Ga0070667_100129991 3300005367 Bacteria 2197
40 Ga0070667_100158638 3300005367 Bacteria 1991
41 Ga0070700_100111220 3300005441 Bacteria 1821
42 Ga0070663_100120373 3300005455 Unclassified 1982
43 Ga0070662_100009238 3300005457 Bacteria 6440
44 Ga0070681_10011992 3300005458 Bacteria 8592
45 Ga0070681_10017042 3300005458 Bacteria 7260
46 Ga0070681_10056735 3300005458 Unclassified 3897
47 Ga0070681_10206690 3300005458 Bacteria 1880
48 Ga0068867_100009241 3300005459 Bacteria 6956
49 Ga0070698_100000658 3300005471 Bacteria 36954
50 Ga0070679_100000723 3300005530 Bacteria 28502
51 Ga0070679_100018724 3300005530 Bacteria 6721
52 Ga0070679_100023360 3300005530 Bacteria 6050
53 Ga0070679_100025591 3300005530 Bacteria 5793
54 Ga0070679_100307073 3300005530 Bacteria 1537
55 Ga0070684_100064472 3300005535 Bacteria 3214
56 Ga0068853_100005763 3300005539 Bacteria 9753
57 Ga0068853_100019671 3300005539 Bacteria 5604
58 Ga0068853_100263135 3300005539 Bacteria 1586
59 Ga0070672_100000325 3300005543 Bacteria 27226
60 Ga0070686_100252920 3300005544 Bacteria 1288
61 Ga0070693_100017700 3300005547 Unclassified 3710
62 Ga0070693_100170482 3300005547 Bacteria 1394
63 Ga0070665_100000009 3300005548 Bacteria 562640
64 Ga0070665_100000570 3300005548 Bacteria 51526
65 Ga0068855_100004502 3300005563 Bacteria 17023
66 Ga0068855_100006679 3300005563 Bacteria 14007
67 Ga0068855_100017655 3300005563 Bacteria 8580
68 Ga0068855_100070970 3300005563 Bacteria 4051
69 Ga0068855_100149716 3300005563 Unclassified 2654
70 Ga0068855_100386185 3300005563 Bacteria 1536
71 Ga0070664_100162384 3300005564 Unclassified 1977
72 Ga0068854_100017635 3300005578 Bacteria 4780
73 Ga0068854_100086023 3300005578 Unclassified 2330
74 Ga0068856_100015173 3300005614 Bacteria 7442
75 Ga0068856_100020502 3300005614 Bacteria 6420
76 Ga0068856_100049037 3300005614 Bacteria 4162
77 Ga0068856_100168417 3300005614 Bacteria 2202
78 Ga0068852_100001619 3300005616 Bacteria 15360
79 Ga0068852_100002840 3300005616 Bacteria 12011
80 Ga0068852_100006007 3300005616 Bacteria 8746
81 Ga0068859_100262138 3300005617 Unclassified 1820
82 Ga0068864_100001209 3300005618 Bacteria 21452
83 Ga0068864_100158411 3300005618 Bacteria 2056
84 Ga0068851_10000082 3300005834 Bacteria 52889
85 Ga0068863_100306689 3300005841 Unclassified 1540
86 Ga0068858_100001219 3300005842 Bacteria 26708
87 Ga0068860_100000078 3300005843 Bacteria 171062
88 Ga0068860_100001310 3300005843 Bacteria 27050
89 Ga0068860_100002017 3300005843 Bacteria 21427
90 Ga0068860_100005302 3300005843 Bacteria 13092
91 Ga0068860_100014141 3300005843 Bacteria 7828
92 Ga0068860_100046169 3300005843 Bacteria 4153
93 Ga0068862_100016782 3300005844 Bacteria 6097
94 Ga0081540_1003562 3300005983 Bacteria 12251
95 Ga0097621_100000143 3300006237 Bacteria 43193
96 Ga0097621_100015299 3300006237 Bacteria 5770
97 Ga0097621_100074467 3300006237 Bacteria 2812
98 Ga0068871_100000741 3300006358 Bacteria 22178
99 Ga0068871_100002881 3300006358 Bacteria 11796
100 Ga0068871_100006140 3300006358 Bacteria 8467
101 Ga0075428_100023322 3300006844 Bacteria 6847
102 Ga0075428_100095019 3300006844 Unclassified 3249
103 Ga0075428_100139810 3300006844 Unclassified 2632
104 Ga0075431_100006834 3300006847 Bacteria 11331
105 Ga0075431_100012347 3300006847 Bacteria 8619
106 Ga0075431_100168360 3300006847 Unclassified 2252
107 Ga0075429_100001575 3300006880 Bacteria 18743
108 Ga0075429_100027951 3300006880 Bacteria 4896
109 Ga0075429_100258107 3300006880 Bacteria 1526
110 Ga0068865_100000299 3300006881 Bacteria 27298
111 Ga0097620_100262107 3300006931 Unclassified 1820
112 Ga0105240_10000263 3300009093 Bacteria 103973
113 Ga0105240_10000281 3300009093 Bacteria 100881
114 Ga0105240_10002290 3300009093 Bacteria 31019
115 Ga0105240_10014873 3300009093 Bacteria 10605
116 Ga0105240_10024146 3300009093 Bacteria 8023
117 Ga0105240_10029485 3300009093 Bacteria 7148
118 Ga0105240_10061859 3300009093 Bacteria 4663
119 Ga0105240_10076274 3300009093 Bacteria 4133
120 Ga0111539_10188209 3300009094 Bacteria 2409
121 Ga0105245_10198392 3300009098 Bacteria 1926
122 Ga0114129_10260396 3300009147 Bacteria 2325
123 Ga0114129_10332116 3300009147 Unclassified 2018
124 Ga0114129_10418749 3300009147 Bacteria 1762
125 Ga0105241_10000384 3300009174 Bacteria 33496
126 Ga0105241_10005706 3300009174 Bacteria 9188
127 Ga0105241_10089403 3300009174 Bacteria 2426
128 Ga0105241_10171992 3300009174 Bacteria 1790
129 Ga0105237_10000261 3300009545 Bacteria 74745
130 Ga0105237_10001123 3300009545 Bacteria 35881
131 Ga0105237_10012911 3300009545 Bacteria 8777
132 Ga0105237_10084532 3300009545 Bacteria 3164
133 Ga0105237_10126805 3300009545 Bacteria 2547
134 Ga0105238_10000536 3300009551 Bacteria 39756
135 Ga0105249_10002830 3300009553 Bacteria 14965
136 Ga0105239_10001028 3300010375 Bacteria 38962
137 Ga0105239_10004319 3300010375 Bacteria 17042
138 Ga0105239_10019999 3300010375 Bacteria 7388
139 Ga0105239_10022156 3300010375 Bacteria 7002
140 Ga0105239_10038531 3300010375 Bacteria 5238
141 Ga0105239_10054729 3300010375 Bacteria 4377
142 Ga0105239_10131575 3300010375 Bacteria 2783
143 Ga0157373_10000489 3300013100 Bacteria 31312
144 Ga0157373_10009406 3300013100 Bacteria 7217
145 Ga0157373_10047340 3300013100 Bacteria 3067
146 Ga0157373_10225756 3300013100 Unclassified 1322
147 Ga0157371_10001216 3300013102 Bacteria 27432
148 Ga0157371_10001463 3300013102 Bacteria 24493
149 Ga0157371_10011281 3300013102 Bacteria 6899
150 Ga0157371_10018654 3300013102 Bacteria 5125
151 Ga0157371_10028046 3300013102 Bacteria 4080
152 Ga0157371_10028079 3300013102 Bacteria 4077
153 Ga0157371_10038224 3300013102 Bacteria 3434
154 Ga0157371_10082389 3300013102 Bacteria 2278
155 Ga0157371_10137317 3300013102 Bacteria 1741
156 Ga0157371_10248577 3300013102 Bacteria 1280
157 Ga0157370_10000716 3300013104 Bacteria 41551
158 Ga0157370_10001207 3300013104 Bacteria 32289
159 Ga0157370_10001887 3300013104 Bacteria 25802
160 Ga0157370_10013074 3300013104 Bacteria 8568
161 Ga0157370_10013898 3300013104 Bacteria 8266
162 Ga0157370_10060051 3300013104 Bacteria 3611
163 Ga0157370_10271446 3300013104 Bacteria 1567
164 Ga0157369_10003777 3300013105 Bacteria 18005
165 Ga0157369_10004105 3300013105 Bacteria 17247
166 Ga0157369_10005987 3300013105 Bacteria 14127
167 Ga0157369_10017775 3300013105 Bacteria 7984
168 Ga0157369_10035765 3300013105 Bacteria 5445
169 Ga0157369_10079090 3300013105 Bacteria 3522
170 Ga0157369_10112639 3300013105 Unclassified 2890
171 Ga0157369_10180367 3300013105 Bacteria 2222
172 Ga0157369_10284237 3300013105 Unclassified 1723
173 Ga0157369_10362812 3300013105 Bacteria 1504
174 Ga0157374_10000002 3300013296 Bacteria 1054226
175 Ga0157374_10000089 3300013296 Bacteria 89250
176 Ga0157378_10005286 3300013297 Bacteria 11339
177 Ga0157378_10017280 3300013297 Bacteria 6327
178 Ga0157378_10043107 3300013297 Bacteria 4006
179 Ga0163162_10000084 3300013306 Bacteria 86252
180 Ga0163162_10000624 3300013306 Bacteria 32874
181 Ga0163162_10002918 3300013306 Bacteria 16303
182 Ga0163162_10047286 3300013306 Unclassified 4312
183 Ga0163162_10080581 3300013306 Bacteria 3324
184 Ga0163162_10096055 3300013306 Unclassified 3051
185 Ga0157372_10001814 3300013307 Bacteria 23160
186 Ga0157372_10032299 3300013307 Bacteria 5739
187 Ga0157372_10039493 3300013307 Bacteria 5209
188 Ga0157372_10050856 3300013307 Bacteria 4609
189 Ga0157372_10055691 3300013307 Unclassified 4417
190 Ga0157372_10061605 3300013307 Bacteria 4202
191 Ga0157372_10098711 3300013307 Bacteria 3332
192 Ga0157372_10099262 3300013307 Bacteria 3321
193 Ga0157372_10104564 3300013307 Bacteria 3237
194 Ga0157372_10140471 3300013307 Unclassified 2782
195 Ga0157372_10145135 3300013307 Bacteria 2737
196 Ga0157372_10212610 3300013307 Unclassified 2241
197 Ga0157372_10251521 3300013307 Bacteria 2051
198 Ga0157372_10261827 3300013307 Bacteria 2008
199 Ga0157372_10329050 3300013307 Bacteria 1779
200 Ga0157375_10000057 3300013308 Bacteria 122654
201 Ga0157375_10166218 3300013308 Bacteria 2351
202 Ga0157375_10170253 3300013308 Bacteria 2325
203 Ga0157375_10264727 3300013308 Bacteria 1881
204 Ga0163163_10001267 3300014325 Bacteria 21322
205 Ga0163163_10027421 3300014325 Bacteria 5456
206 Ga0163163_10118997 3300014325 Bacteria 2674
207 Ga0157380_10013967 3300014326 Bacteria 5864
208 Ga0157380_10199286 3300014326 Bacteria 1775
209 Ga0157379_10000032 3300014968 Bacteria 83845
210 Ga0157379_10039547 3300014968 Bacteria 4207
211 Ga0157379_10069418 3300014968 Unclassified 3152
212 Ga0157376_10000191 3300014969 Bacteria 42509
213 Ga0157376_10000318 3300014969 Bacteria 32314
214 Ga0157376_10095850 3300014969 Bacteria 2581
215 Ga0157376_10101550 3300014969 Bacteria 2514
216 Ga0157376_10131959 3300014969 Unclassified 2230
217 Ga0157376_10236733 3300014969 Bacteria 1699
218 Ga0163161_10001232 3300017792 Bacteria 19196
219 Ga0163161_10032225 3300017792 Bacteria 3740
220 Ga0163161_10065167 3300017792 Bacteria 2658
221 Ga0213876_10038525 3300021384 Unclassified 2523
222 Ga0207426_1000032 3300025302 Bacteria 457997
223 Ga0207656_10000425 3300025321 Bacteria 14215
224 Ga0207680_10000845 3300025903 Bacteria 14475
225 Ga0207647_10000408 3300025904 Bacteria 35295
226 Ga0207647_10017923 3300025904 Bacteria 4803
227 Ga0207647_10029670 3300025904 Bacteria 3535
228 Ga0207645_10000638 3300025907 Bacteria 29117
229 Ga0207705_10000785 3300025909 Bacteria 26027
230 Ga0207705_10003600 3300025909 Bacteria 11804
231 Ga0207705_10171530 3300025909 Bacteria 1633
232 Ga0207654_10000887 3300025911 Bacteria 16589
233 Ga0207654_10011712 3300025911 Bacteria 4477
234 Ga0207654_10017955 3300025911 Unclassified 3708
235 Ga0207654_10137625 3300025911 Unclassified 1553
236 Ga0207707_10001194 3300025912 Bacteria 24438
237 Ga0207707_10046394 3300025912 Bacteria 3784
238 Ga0207695_10000016 3300025913 Bacteria 771991
239 Ga0207695_10000128 3300025913 Bacteria 226098
240 Ga0207695_10000296 3300025913 Bacteria 123322
241 Ga0207695_10004554 3300025913 Bacteria 18847
242 Ga0207695_10008476 3300025913 Bacteria 12865
243 Ga0207695_10030733 3300025913 Bacteria 5910
244 Ga0207695_10049777 3300025913 Unclassified 4413
245 Ga0207695_10054258 3300025913 Unclassified 4187
246 Ga0207671_10001944 3300025914 Bacteria 22809
247 Ga0207671_10008678 3300025914 Bacteria 8579
248 Ga0207671_10009779 3300025914 Bacteria 7980
249 Ga0207671_10075296 3300025914 Bacteria 2524
250 Ga0207671_10082656 3300025914 Unclassified 2410
251 Ga0207671_10109372 3300025914 Unclassified 2101
252 Ga0207660_10002188 3300025917 Bacteria 12937
253 Ga0207660_10122505 3300025917 Unclassified 1971
254 Ga0207657_10006248 3300025919 Bacteria 12387
255 Ga0207657_10018919 3300025919 Bacteria 6557
256 Ga0207657_10068182 3300025919 Bacteria 3022
257 Ga0207657_10098628 3300025919 Bacteria 2428
258 Ga0207657_10103455 3300025919 Unclassified 2360
259 Ga0207652_10000203 3300025921 Bacteria 62871
260 Ga0207652_10000546 3300025921 Bacteria 38083
261 Ga0207652_10002054 3300025921 Bacteria 17328
262 Ga0207652_10004631 3300025921 Bacteria 11145
263 Ga0207652_10063114 3300025921 Bacteria 3203
264 Ga0207652_10182465 3300025921 Bacteria 1886
265 Ga0207652_10273942 3300025921 Bacteria 1522
266 Ga0207694_10000720 3300025924 Bacteria 29711
267 Ga0207650_10024901 3300025925 Bacteria 4260
268 Ga0207659_10042455 3300025926 Unclassified 3189
269 Ga0207687_10067613 3300025927 Bacteria 2543
270 Ga0207706_10007388 3300025933 Bacteria 10158
271 Ga0207691_10000014 3300025940 Bacteria 142542
272 Ga0207689_10015088 3300025942 Bacteria 6550
273 Ga0207689_10164598 3300025942 Bacteria 1828
274 Ga0207661_10017692 3300025944 Bacteria 5282
275 Ga0207661_10246173 3300025944 Bacteria 1588
276 Ga0207667_10000180 3300025949 Bacteria 92094
277 Ga0207667_10002746 3300025949 Bacteria 21763
278 Ga0207667_10025354 3300025949 Bacteria 6491
279 Ga0207667_10037000 3300025949 Bacteria 5222
280 Ga0207667_10065232 3300025949 Unclassified 3798
281 Ga0207667_10381826 3300025949 Bacteria 1435
282 Ga0207651_10017471 3300025960 Bacteria 4241
283 Ga0207712_10003584 3300025961 Bacteria 9798
284 Ga0207668_10000124 3300025972 Bacteria 54437
285 Ga0207640_10066965 3300025981 Bacteria 2401
286 Ga0207640_10071737 3300025981 Unclassified 2334
287 Ga0207658_10000242 3300025986 Bacteria 57191
288 Ga0207658_10111099 3300025986 Bacteria 2167
289 Ga0207658_10187141 3300025986 Bacteria 1718
290 Ga0207677_10176177 3300026023 Unclassified 1677
291 Ga0207703_10019819 3300026035 Bacteria 5257
292 Ga0207639_10014136 3300026041 Bacteria 5605
293 Ga0207639_10024442 3300026041 Unclassified 4373
294 Ga0207639_10068712 3300026041 Unclassified 2762
295 Ga0207639_10077614 3300026041 Bacteria 2619
296 Ga0207639_10234004 3300026041 Bacteria 1594
297 Ga0207678_10009387 3300026067 Bacteria 8608
298 Ga0207702_10043271 3300026078 Bacteria 3781
299 Ga0207648_10051903 3300026089 Bacteria 3585
300 Ga0207648_10053830 3300026089 Bacteria 3516
301 Ga0207648_10119448 3300026089 Unclassified 2317
302 Ga0207648_10121719 3300026089 Bacteria 2294
303 Ga0207676_10044414 3300026095 Bacteria 3428
304 Ga0207674_10002304 3300026116 Bacteria 24174
305 Ga0207674_10054856 3300026116 Bacteria 4056
306 Ga0207674_10059616 3300026116 Bacteria 3861
307 Ga0207698_10003520 3300026142 Bacteria 9440
308 Ga0207698_10009518 3300026142 Bacteria 6200
309 Ga0207428_10106156 3300027907 Bacteria 2165
310 Ga0207428_10263342 3300027907 Unclassified 1283
311 Ga0268266_10000014 3300028379 Bacteria 644033
312 Ga0268264_10000105 3300028381 Bacteria 212531
313 Ga0268264_10003887 3300028381 Bacteria 12806
314 Ga0268264_10013975 3300028381 Bacteria 6602
315 Ga0268264_10014357 3300028381 Bacteria 6512
316 Ga0268264_10025351 3300028381 Bacteria 4844
317 Ga0307517_10000689 3300028786 Bacteria 58121
318 Ga0307511_10003511 3300030521 Bacteria 16103
319 Ga0265316_10103640 3300031344 Bacteria 2160
320 Ga0307516_10001379 3300031730 Bacteria 33641
321 Ga0307410_10039684 3300031852 Bacteria 3093
322 Ga0307415_100265521 3300032126 Bacteria 1403
323 Ga0307510_10003610 3300033180 Bacteria 18060
324 Ga0395899_0002567 3300037312 Bacteria 14680
325 Ga0395899_0016541 3300037312 Bacteria 5626
326 Ga0395899_0032031 3300037312 Bacteria 3949
327 Ga0395899_0039948 3300037312 Bacteria 3510
328 Ga0395900_0020435 3300037418 Bacteria 6759
329 Ga0395900_0030426 3300037418 Bacteria 5544
330 Ga0395900_0046659 3300037418 Bacteria 4461
331 Ga0395900_0102228 3300037418 Unclassified 2944
332 Ga0395900_0181928 3300037418 Bacteria 2135
333 Ga0395898_0001279 3300037466 Bacteria 37056
334 Ga0395898_0022398 3300037466 Bacteria 6398
335 Ga0395898_0034521 3300037466 Bacteria 5040
336 Ga0395905_0007212 3300037471 Bacteria 11085
337 Ga0395905_0101561 3300037471 Bacteria 2700
338 Ga0395901_0002450 3300038443 Bacteria 18818
339 Ga0395901_0076181 3300038443 Bacteria 3499
340 Ga0395901_0295060 3300038443 Bacteria 1681
341 Ga0436365_1052711 3300039437 Bacteria 25242
342 Ga0436365_1294008 3300039437 Bacteria 47166
343 Ga0439443_007622 3300042003 Unclassified 1511
344 Ga0439449_0026586 3300042007 Bacteria 2160
345 Ga0451577_0010098 3300042876 Bacteria 9045
346 Ga0451577_0441974 3300042876 Bacteria 1181
347 Ga0466972_0000024 3300044658 Bacteria 187985
348 Ga0466972_0003897 3300044658 Bacteria 7437
349 Ga0453683_0025687 3300044673 Bacteria 3739
350 Ga0466966_0120742 3300044684 Unclassified 1610
351 Ga0466961_0028106 3300044693 Bacteria 3616
352 Ga0466970_0000469 3300044765 Bacteria 19993
353 Ga0466959_0006865 3300045049 Bacteria 7940
354 Ga0466958_0036641 3300045836 Bacteria 2937
355 Ga0495648_0009134 3300046524 Bacteria 7730
356 Ga0495668_0000774 3300046616 Bacteria 37260
357 Ga0495611_0000983 3300046648 Bacteria 15159
358 Ga0495672_0032188 3300047320 Bacteria 3266
359 Ga0495687_000056 3300047443 Bacteria 188227
360 Ga0495686_0000016 3300047472 Bacteria 443701
361 Ga0501033_0073630 3300049570 Bacteria 2508
362 Ga0501033_0108812 3300049570 Bacteria 2019
363 Ga0501033_0135099 3300049570 Unclassified 1785
364 Ga0501034_0019547 3300049571 Bacteria 6926
365 Ga0501034_0019947 3300049571 Bacteria 6845
366 Ga0501034_0025186 3300049571 Bacteria 6055
367 Ga0501034_0076957 3300049571 Unclassified 3343
368 Ga0501034_0613984 3300049571 Unclassified 992
369 Ga0501036_0015703 3300049572 Bacteria 6324
370 Ga0501043_0034904 3300049579 Bacteria 3956
371 Ga0501043_0052600 3300049579 Bacteria 3198
372 Ga0501047_0008167 3300049581 Bacteria 9886
373 Ga0501221_016031 3300049704 Bacteria 1413
374 Ga0501225_0035168 3300049705 Bacteria 1379
375 Ga0501035_0111135 3300049822 Bacteria 2402
376 Ga0501044_0019524 3300049823 Bacteria 7248
377 nmdc:mga05p37_221195_c1 3300050507 Unclassified 2285
378 nmdc:mga05p37_233824_c1 3300050507 Bacteria 2213
379 nmdc:mga06r32_107561_c2 3300050510 Bacteria 2375
380 nmdc:mga06r32_77288_c1 3300050510 Unclassified 3233
381 nmdc:mga06r32_84935_c1 3300050510 Bacteria 3086
382 nmdc:mga08y16_155730_c1 3300050511 Bacteria 2374
383 nmdc:mga08y16_169039_c1 3300050511 Bacteria 2271
384 Ga0500583_0001266 3300053092 Bacteria 7213
385 Ga0500562_000007 3300053108 Bacteria 241755
386 Ga0500568_0023163 3300053139 Bacteria 2644
387 Ga0500622_0002683 3300053156 Bacteria 12605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100095019 Ga0075428_1000950194 294
2 3300006844 Ga0075428_100139810 Ga0075428_1001398103 311
3 3300049571 Ga0501034_0613984 Ga0501034_0613984_19_978 313
4 3300005547 Ga0070693_100170482 Ga0070693_1001704822 325
5 3300013105 Ga0157369_10180367 Ga0157369_101803672 330
6 3300006880 Ga0075429_100258107 Ga0075429_1002581071 331
7 3300005341 Ga0070691_10040846 Ga0070691_100408463 335
8 3300005441 Ga0070700_100111220 Ga0070700_1001112202 335
9 3300009093 Ga0105240_10000281 Ga0105240_1000028122 335
10 3300025913 Ga0207695_10000296 Ga0207695_1000029680 335
11 3300010375 Ga0105239_10001028 Ga0105239_1000102826 336
12 3300025913 Ga0207695_10000016 Ga0207695_1000001685 336
13 3300005471 Ga0070698_100000658 Ga0070698_1000006586 337
14 3300013104 Ga0157370_10001207 Ga0157370_1000120721 337
15 3300042007 Ga0439449_0026586 Ga0439449_0026586_823_1929 337
16 3300003322 rootL2_10019471 rootL2_100194715 339
17 3300006847 Ga0075431_100168360 Ga0075431_1001683602 339
18 3300026089 Ga0207648_10053830 Ga0207648_100538305 339
19 3300042876 Ga0451577_0441974 Ga0451577_0441974_94_1164 339
20 3300044673 Ga0453683_0025687 Ga0453683_0025687_325_1395 339
21 3300046616 Ga0495668_0000774 Ga0495668_0000774_7687_8796 339
22 3300050510 nmdc:mga06r32_77288_c1 nmdc:mga06r32_77288_c1_1385_2491 339
23 3300025961 Ga0207712_10003584 Ga0207712_100035847 340
24 3300003320 rootH2_10133772 rootH2_101337724 341
25 3300005539 Ga0068853_100019671 Ga0068853_1000196713 341
26 3300006847 Ga0075431_100006834 Ga0075431_10000683412 341
27 3300009147 Ga0114129_10418749 Ga0114129_104187492 341
28 3300013100 Ga0157373_10047340 Ga0157373_100473402 341
29 3300013105 Ga0157369_10003777 Ga0157369_1000377714 341
30 3300013307 Ga0157372_10261827 Ga0157372_102618272 341
31 3300025904 Ga0207647_10029670 Ga0207647_100296702 341
32 3300026041 Ga0207639_10014136 Ga0207639_100141363 341
33 3300042876 Ga0451577_0010098 Ga0451577_0010098_477_1583 341
34 3300026041 Ga0207639_10077614 Ga0207639_100776143 342
35 3300005339 Ga0070660_100130377 Ga0070660_1001303772 343
36 3300005366 Ga0070659_100039321 Ga0070659_1000393213 343
37 3300005530 Ga0070679_100307073 Ga0070679_1003070732 343
38 3300025909 Ga0207705_10171530 Ga0207705_101715301 343
39 3300025917 Ga0207660_10122505 Ga0207660_101225052 343
40 3300025921 Ga0207652_10273942 Ga0207652_102739422 343
41 3300025949 Ga0207667_10037000 Ga0207667_100370006 343
42 3300025986 Ga0207658_10187141 Ga0207658_101871412 343
43 3300026078 Ga0207702_10043271 Ga0207702_100432712 343
44 3300005339 Ga0070660_100013094 Ga0070660_1000130947 344
45 3300021384 Ga0213876_10038525 Ga0213876_100385251 344
46 3300025919 Ga0207657_10006248 Ga0207657_100062487 344
47 3300006844 Ga0075428_100023322 Ga0075428_1000233226 345
48 3300006880 Ga0075429_100001575 Ga0075429_10000157516 345
49 3300017792 Ga0163161_10065167 Ga0163161_100651672 345
50 3300026089 Ga0207648_10051903 Ga0207648_100519032 345
51 3300013100 Ga0157373_10000489 Ga0157373_1000048918 346
52 3300013102 Ga0157371_10018654 Ga0157371_100186546 346
53 3300013306 Ga0163162_10002918 Ga0163162_1000291813 346
54 3300013307 Ga0157372_10104564 Ga0157372_101045643 346
55 3300027907 Ga0207428_10263342 Ga0207428_102633422 346
56 3300037418 Ga0395900_0020435 Ga0395900_0020435_3600_4712 346
57 3300037471 Ga0395905_0101561 Ga0395905_0101561_65_1177 346
58 3300005841 Ga0068863_100306689 Ga0068863_1003066891 348
59 3300005843 Ga0068860_100005302 Ga0068860_1000053027 348
60 3300009147 Ga0114129_10260396 Ga0114129_102603962 349
61 3300042003 Ga0439443_007622 Ga0439443_007622_21_1127 349
62 3300047320 Ga0495672_0032188 Ga0495672_0032188_2119_3231 349
63 3300050507 nmdc:mga05p37_221195_c1 nmdc:mga05p37_221195_c1_920_2026 349
64 3300005327 Ga0070658_10120780 Ga0070658_101207802 350
65 3300005339 Ga0070660_100072177 Ga0070660_1000721773 350
66 3300005458 Ga0070681_10206690 Ga0070681_102066902 350
67 3300005563 Ga0068855_100386185 Ga0068855_1003861851 350
68 3300005618 Ga0068864_100158411 Ga0068864_1001584113 350
69 3300025919 Ga0207657_10068182 Ga0207657_100681822 350
70 3300025921 Ga0207652_10063114 Ga0207652_100631141 350
71 3300025949 Ga0207667_10381826 Ga0207667_103818262 350
72 3300026116 Ga0207674_10059616 Ga0207674_100596162 350
73 3300049570 Ga0501033_0135099 Ga0501033_0135099_644_1756 350
74 3300049571 Ga0501034_0076957 Ga0501034_0076957_814_1926 350
75 3300009553 Ga0105249_10002830 Ga0105249_100028307 351
76 3300010375 Ga0105239_10131575 Ga0105239_101315753 351
77 3300013102 Ga0157371_10248577 Ga0157371_102485771 351
78 3300013307 Ga0157372_10098711 Ga0157372_100987114 351
79 3300014326 Ga0157380_10013967 Ga0157380_100139675 351
80 3300026116 Ga0207674_10054856 Ga0207674_100548566 351
81 3300050507 nmdc:mga05p37_233824_c1 nmdc:mga05p37_233824_c1_145_1248 351
82 3300050510 nmdc:mga06r32_107561_c2 nmdc:mga06r32_107561_c2_838_1941 351
83 3300005327 Ga0070658_10196196 Ga0070658_101961961 352
84 3300005334 Ga0068869_100245773 Ga0068869_1002457732 352
85 3300005336 Ga0070680_100005675 Ga0070680_1000056759 352
86 3300005336 Ga0070680_100117646 Ga0070680_1001176462 352
87 3300005366 Ga0070659_100021670 Ga0070659_1000216701 352
88 3300005367 Ga0070667_100129991 Ga0070667_1001299912 352
89 3300005458 Ga0070681_10017042 Ga0070681_100170422 352
90 3300005530 Ga0070679_100000723 Ga0070679_10000072318 352
91 3300005530 Ga0070679_100018724 Ga0070679_1000187248 352
92 3300005563 Ga0068855_100004502 Ga0068855_10000450211 352
93 3300005563 Ga0068855_100006679 Ga0068855_1000066793 352
94 3300005614 Ga0068856_100020502 Ga0068856_1000205021 352
95 3300005843 Ga0068860_100001310 Ga0068860_10000131017 352
96 3300005844 Ga0068862_100016782 Ga0068862_1000167823 352
97 3300006237 Ga0097621_100074467 Ga0097621_1000744674 352
98 3300006358 Ga0068871_100006140 Ga0068871_1000061409 352
99 3300013102 Ga0157371_10001463 Ga0157371_1000146314 352
100 3300013102 Ga0157371_10011281 Ga0157371_100112813 352
101 3300013102 Ga0157371_10028046 Ga0157371_100280465 352
102 3300013102 Ga0157371_10038224 Ga0157371_100382241 352
103 3300013104 Ga0157370_10000716 Ga0157370_1000071627 352
104 3300013105 Ga0157369_10005987 Ga0157369_1000598714 352
105 3300013297 Ga0157378_10017280 Ga0157378_100172807 352
106 3300013297 Ga0157378_10043107 Ga0157378_100431072 352
107 3300013306 Ga0163162_10047286 Ga0163162_100472863 352
108 3300013307 Ga0157372_10032299 Ga0157372_100322996 352
109 3300013307 Ga0157372_10039493 Ga0157372_100394934 352
110 3300013307 Ga0157372_10050856 Ga0157372_100508566 352
111 3300013307 Ga0157372_10145135 Ga0157372_101451352 352
112 3300013307 Ga0157372_10212610 Ga0157372_102126102 352
113 3300013307 Ga0157372_10251521 Ga0157372_102515212 352
114 3300013308 Ga0157375_10166218 Ga0157375_101662183 352
115 3300013308 Ga0157375_10264727 Ga0157375_102647271 352
116 3300025904 Ga0207647_10017923 Ga0207647_100179236 352
117 3300025909 Ga0207705_10000785 Ga0207705_1000078513 352
118 3300025912 Ga0207707_10046394 Ga0207707_100463944 352
119 3300025917 Ga0207660_10002188 Ga0207660_100021882 352
120 3300025919 Ga0207657_10098628 Ga0207657_100986284 352
121 3300025921 Ga0207652_10000203 Ga0207652_100002037 352
122 3300025921 Ga0207652_10000546 Ga0207652_1000054618 352
123 3300025942 Ga0207689_10015088 Ga0207689_100150886 352
124 3300025949 Ga0207667_10000180 Ga0207667_1000018026 352
125 3300026067 Ga0207678_10009387 Ga0207678_100093874 352
126 3300028381 Ga0268264_10014357 Ga0268264_100143572 352
127 3300037312 Ga0395899_0002567 Ga0395899_0002567_13002_14114 352
128 3300037312 Ga0395899_0016541 Ga0395899_0016541_4496_5608 352
129 3300037312 Ga0395899_0032031 Ga0395899_0032031_1015_2127 352
130 3300037312 Ga0395899_0039948 Ga0395899_0039948_368_1480 352
131 3300037418 Ga0395900_0030426 Ga0395900_0030426_3930_5042 352
132 3300037418 Ga0395900_0046659 Ga0395900_0046659_1015_2127 352
133 3300037418 Ga0395900_0181928 Ga0395900_0181928_1005_2117 352
134 3300037466 Ga0395898_0022398 Ga0395898_0022398_2060_3172 352
135 3300037466 Ga0395898_0034521 Ga0395898_0034521_3833_4945 352
136 3300037471 Ga0395905_0007212 Ga0395905_0007212_5193_6305 352
137 3300038443 Ga0395901_0002450 Ga0395901_0002450_2188_3300 352
138 3300038443 Ga0395901_0295060 Ga0395901_0295060_345_1457 352
139 3300049570 Ga0501033_0073630 Ga0501033_0073630_1381_2493 352
140 3300049571 Ga0501034_0025186 Ga0501034_0025186_786_1898 352
141 3300049822 Ga0501035_0111135 Ga0501035_0111135_138_1250 352
142 3300003323 rootH1_10192148 rootH1_101921482 353
143 3300005843 Ga0068860_100002017 Ga0068860_1000020175 353
144 3300013102 Ga0157371_10082389 Ga0157371_100823892 353
145 3300013105 Ga0157369_10362812 Ga0157369_103628122 353
146 3300014969 Ga0157376_10101550 Ga0157376_101015502 353
147 3300025913 Ga0207695_10049777 Ga0207695_100497772 353
148 3300025914 Ga0207671_10082656 Ga0207671_100826564 353
149 3300025944 Ga0207661_10246173 Ga0207661_102461732 353
150 3300031730 Ga0307516_10001379 Ga0307516_1000137923 353
151 3300033180 Ga0307510_10003610 Ga0307510_1000361011 353
152 3300037418 Ga0395900_0102228 Ga0395900_0102228_1651_2802 353
153 3300037466 Ga0395898_0001279 Ga0395898_0001279_10013_11164 353
154 3300038443 Ga0395901_0076181 Ga0395901_0076181_987_2138 353
155 3300049571 Ga0501034_0019547 Ga0501034_0019547_3513_4619 353
156 3300049572 Ga0501036_0015703 Ga0501036_0015703_1912_3018 353
157 3300049579 Ga0501043_0034904 Ga0501043_0034904_1044_2150 353
158 3300049581 Ga0501047_0008167 Ga0501047_0008167_3383_4489 353
159 3300049823 Ga0501044_0019524 Ga0501044_0019524_5278_6384 353
160 3300005327 Ga0070658_10073405 Ga0070658_100734053 354
161 3300005327 Ga0070658_10089230 Ga0070658_100892302 354
162 3300005331 Ga0070670_100019947 Ga0070670_1000199475 354
163 3300005458 Ga0070681_10011992 Ga0070681_100119921 354
164 3300005535 Ga0070684_100064472 Ga0070684_1000644723 354
165 3300005563 Ga0068855_100070970 Ga0068855_1000709703 354
166 3300005578 Ga0068854_100017635 Ga0068854_1000176353 354
167 3300005614 Ga0068856_100049037 Ga0068856_1000490373 354
168 3300005616 Ga0068852_100001619 Ga0068852_1000016194 354
169 3300005616 Ga0068852_100006007 Ga0068852_1000060074 354
170 3300009174 Ga0105241_10171992 Ga0105241_101719922 354
171 3300013102 Ga0157371_10001216 Ga0157371_100012164 354
172 3300025911 Ga0207654_10011712 Ga0207654_100117121 354
173 3300025913 Ga0207695_10030733 Ga0207695_100307335 354
174 3300025914 Ga0207671_10075296 Ga0207671_100752962 354
175 3300025921 Ga0207652_10182465 Ga0207652_101824653 354
176 3300025949 Ga0207667_10025354 Ga0207667_100253544 354
177 3300025981 Ga0207640_10066965 Ga0207640_100669652 354
178 3300026041 Ga0207639_10068712 Ga0207639_100687121 354
179 3300039437 Ga0436365_1294008 Ga0436365_1294008_2447_3553 354
180 3300049704 Ga0501221_016031 Ga0501221_016031_315_1391 354
181 3300049705 Ga0501225_0035168 Ga0501225_0035168_221_1297 354
182 3300005983 Ga0081540_1003562 Ga0081540_10035628 355
183 3300039437 Ga0436365_1052711 Ga0436365_1052711_8143_9249 355
184 3300003320 rootH2_10012395 rootH2_100123951 357
185 3300005544 Ga0070686_100252920 Ga0070686_1002529201 357
186 3300014325 Ga0163163_10118997 Ga0163163_101189973 357
187 3300014326 Ga0157380_10199286 Ga0157380_101992862 357
188 3300049570 Ga0501033_0108812 Ga0501033_0108812_749_1855 357
189 3300049571 Ga0501034_0019947 Ga0501034_0019947_2426_3532 357
190 3300049579 Ga0501043_0052600 Ga0501043_0052600_289_1365 357
191 3300050511 nmdc:mga08y16_155730_c1 nmdc:mga08y16_155730_c1_251_1357 357
192 3300003320 rootH2_10021482 rootH2_100214823 358
193 3300005843 Ga0068860_100046169 Ga0068860_1000461691 360
194 3300013306 Ga0163162_10080581 Ga0163162_100805813 360
195 3300028381 Ga0268264_10013975 Ga0268264_100139754 360
196 3300005366 Ga0070659_100006261 Ga0070659_1000062613 361
197 3300013105 Ga0157369_10284237 Ga0157369_102842372 361
198 3300025904 Ga0207647_10000408 Ga0207647_1000040820 361
199 3300005334 Ga0068869_100084106 Ga0068869_1000841062 362
200 3300005335 Ga0070666_10001393 Ga0070666_1000139312 362
201 3300005338 Ga0068868_100003187 Ga0068868_1000031871 362
202 3300005347 Ga0070668_100000106 Ga0070668_10000010631 362
203 3300005354 Ga0070675_100059639 Ga0070675_1000596394 362
204 3300005364 Ga0070673_100000229 Ga0070673_10000022914 362
205 3300005367 Ga0070667_100158638 Ga0070667_1001586382 362
206 3300005455 Ga0070663_100120373 Ga0070663_1001203732 362
207 3300005457 Ga0070662_100009238 Ga0070662_1000092384 362
208 3300005459 Ga0068867_100009241 Ga0068867_1000092413 362
209 3300005543 Ga0070672_100000325 Ga0070672_10000032514 362
210 3300005548 Ga0070665_100000570 Ga0070665_10000057025 362
211 3300005564 Ga0070664_100162384 Ga0070664_1001623842 362
212 3300005618 Ga0068864_100001209 Ga0068864_10000120920 362
213 3300005834 Ga0068851_10000082 Ga0068851_100000823 362
214 3300005842 Ga0068858_100001219 Ga0068858_1000012192 362
215 3300005843 Ga0068860_100014141 Ga0068860_1000141418 362
216 3300006237 Ga0097621_100015299 Ga0097621_1000152992 362
217 3300006358 Ga0068871_100002881 Ga0068871_1000028819 362
218 3300006881 Ga0068865_100000299 Ga0068865_10000029914 362
219 3300009174 Ga0105241_10089403 Ga0105241_100894033 362
220 3300009545 Ga0105237_10084532 Ga0105237_100845322 362
221 3300010375 Ga0105239_10038531 Ga0105239_100385316 362
222 3300013296 Ga0157374_10000089 Ga0157374_1000008935 362
223 3300013297 Ga0157378_10005286 Ga0157378_100052864 362
224 3300013306 Ga0163162_10000084 Ga0163162_1000008420 362
225 3300013307 Ga0157372_10099262 Ga0157372_100992621 362
226 3300013307 Ga0157372_10329050 Ga0157372_103290502 362
227 3300013308 Ga0157375_10000057 Ga0157375_100000577 362
228 3300014968 Ga0157379_10000032 Ga0157379_1000003220 362
229 3300014969 Ga0157376_10000318 Ga0157376_100003188 362
230 3300017792 Ga0163161_10032225 Ga0163161_100322252 362
231 3300025321 Ga0207656_10000425 Ga0207656_100004253 362
232 3300025903 Ga0207680_10000845 Ga0207680_1000084510 362
233 3300025907 Ga0207645_10000638 Ga0207645_1000063810 362
234 3300025909 Ga0207705_10003600 Ga0207705_100036002 362
235 3300025911 Ga0207654_10137625 Ga0207654_101376252 362
236 3300025914 Ga0207671_10109372 Ga0207671_101093723 362
237 3300025927 Ga0207687_10067613 Ga0207687_100676132 362
238 3300025933 Ga0207706_10007388 Ga0207706_100073889 362
239 3300025940 Ga0207691_10000014 Ga0207691_1000001481 362
240 3300025960 Ga0207651_10017471 Ga0207651_100174715 362
241 3300025972 Ga0207668_10000124 Ga0207668_100001247 362
242 3300025986 Ga0207658_10000242 Ga0207658_1000024232 362
243 3300026023 Ga0207677_10176177 Ga0207677_101761772 362
244 3300026035 Ga0207703_10019819 Ga0207703_100198192 362
245 3300026089 Ga0207648_10121719 Ga0207648_101217193 362
246 3300026095 Ga0207676_10044414 Ga0207676_100444144 362
247 3300028381 Ga0268264_10025351 Ga0268264_100253512 362
248 3300003322 rootL2_10225036 rootL2_102250362 363
249 3300005336 Ga0070680_100196388 Ga0070680_1001963882 363
250 3300005337 Ga0070682_100001134 Ga0070682_1000011344 363
251 3300005341 Ga0070691_10002457 Ga0070691_100024574 363
252 3300005458 Ga0070681_10056735 Ga0070681_100567352 363
253 3300005530 Ga0070679_100023360 Ga0070679_1000233603 363
254 3300005530 Ga0070679_100025591 Ga0070679_1000255913 363
255 3300005539 Ga0068853_100005763 Ga0068853_1000057639 363
256 3300005547 Ga0070693_100017700 Ga0070693_1000177002 363
257 3300005548 Ga0070665_100000009 Ga0070665_100000009334 363
258 3300005563 Ga0068855_100149716 Ga0068855_1001497162 363
259 3300005614 Ga0068856_100015173 Ga0068856_1000151736 363
260 3300005614 Ga0068856_100168417 Ga0068856_1001684172 363
261 3300005616 Ga0068852_100002840 Ga0068852_1000028403 363
262 3300005843 Ga0068860_100000078 Ga0068860_10000007812 363
263 3300009093 Ga0105240_10000263 Ga0105240_100002639 363
264 3300009093 Ga0105240_10002290 Ga0105240_100022904 363
265 3300009093 Ga0105240_10014873 Ga0105240_100148738 363
266 3300009093 Ga0105240_10024146 Ga0105240_100241463 363
267 3300009093 Ga0105240_10029485 Ga0105240_100294857 363
268 3300009093 Ga0105240_10076274 Ga0105240_100762743 363
269 3300009174 Ga0105241_10000384 Ga0105241_100003849 363
270 3300009174 Ga0105241_10005706 Ga0105241_100057061 363
271 3300009545 Ga0105237_10000261 Ga0105237_100002615 363
272 3300009545 Ga0105237_10001123 Ga0105237_1000112315 363
273 3300009545 Ga0105237_10012911 Ga0105237_100129117 363
274 3300009545 Ga0105237_10126805 Ga0105237_101268053 363
275 3300009551 Ga0105238_10000536 Ga0105238_1000053622 363
276 3300010375 Ga0105239_10004319 Ga0105239_100043196 363
277 3300010375 Ga0105239_10019999 Ga0105239_100199995 363
278 3300010375 Ga0105239_10054729 Ga0105239_100547292 363
279 3300013100 Ga0157373_10009406 Ga0157373_100094063 363
280 3300013100 Ga0157373_10225756 Ga0157373_102257561 363
281 3300013102 Ga0157371_10028079 Ga0157371_100280792 363
282 3300013102 Ga0157371_10137317 Ga0157371_101373172 363
283 3300013104 Ga0157370_10001887 Ga0157370_1000188710 363
284 3300013104 Ga0157370_10013074 Ga0157370_100130746 363
285 3300013104 Ga0157370_10013898 Ga0157370_100138983 363
286 3300013104 Ga0157370_10060051 Ga0157370_100600513 363
287 3300013105 Ga0157369_10004105 Ga0157369_100041054 363
288 3300013105 Ga0157369_10017775 Ga0157369_100177758 363
289 3300013105 Ga0157369_10079090 Ga0157369_100790902 363
290 3300013105 Ga0157369_10112639 Ga0157369_101126392 363
291 3300013296 Ga0157374_10000002 Ga0157374_10000002250 363
292 3300013306 Ga0163162_10000624 Ga0163162_100006246 363
293 3300013307 Ga0157372_10001814 Ga0157372_100018147 363
294 3300013307 Ga0157372_10055691 Ga0157372_100556912 363
295 3300013307 Ga0157372_10061605 Ga0157372_100616053 363
296 3300014325 Ga0163163_10027421 Ga0163163_100274212 363
297 3300014968 Ga0157379_10039547 Ga0157379_100395472 363
298 3300014969 Ga0157376_10095850 Ga0157376_100958502 363
299 3300014969 Ga0157376_10236733 Ga0157376_102367332 363
300 3300025911 Ga0207654_10000887 Ga0207654_100008879 363
301 3300025911 Ga0207654_10017955 Ga0207654_100179552 363
302 3300025912 Ga0207707_10001194 Ga0207707_100011948 363
303 3300025913 Ga0207695_10004554 Ga0207695_100045548 363
304 3300025913 Ga0207695_10008476 Ga0207695_100084769 363
305 3300025913 Ga0207695_10054258 Ga0207695_100542584 363
306 3300025914 Ga0207671_10001944 Ga0207671_1000194414 363
307 3300025914 Ga0207671_10008678 Ga0207671_100086787 363
308 3300025914 Ga0207671_10009779 Ga0207671_100097796 363
309 3300025919 Ga0207657_10018919 Ga0207657_100189197 363
310 3300025919 Ga0207657_10103455 Ga0207657_101034552 363
311 3300025921 Ga0207652_10002054 Ga0207652_100020548 363
312 3300025921 Ga0207652_10004631 Ga0207652_100046319 363
313 3300025924 Ga0207694_10000720 Ga0207694_1000072022 363
314 3300025949 Ga0207667_10002746 Ga0207667_1000274614 363
315 3300025949 Ga0207667_10065232 Ga0207667_100652324 363
316 3300026041 Ga0207639_10024442 Ga0207639_100244423 363
317 3300026116 Ga0207674_10002304 Ga0207674_1000230415 363
318 3300026142 Ga0207698_10003520 Ga0207698_100035208 363
319 3300026142 Ga0207698_10009518 Ga0207698_100095183 363
320 3300028379 Ga0268266_10000014 Ga0268266_10000014338 363
321 3300028381 Ga0268264_10000105 Ga0268264_10000105170 363
322 3300028381 Ga0268264_10003887 Ga0268264_100038876 363
323 3300028786 Ga0307517_10000689 Ga0307517_1000068941 363
324 3300030521 Ga0307511_10003511 Ga0307511_100035112 363
325 3300044658 Ga0466972_0003897 Ga0466972_0003897_3933_5039 363
326 3300044684 Ga0466966_0120742 Ga0466966_0120742_49_1155 363
327 3300044693 Ga0466961_0028106 Ga0466961_0028106_1458_2564 363
328 3300045049 Ga0466959_0006865 Ga0466959_0006865_4945_6051 363
329 3300045836 Ga0466958_0036641 Ga0466958_0036641_1147_2253 363
330 3300046524 Ga0495648_0009134 Ga0495648_0009134_4759_5865 363
331 3300046648 Ga0495611_0000983 Ga0495611_0000983_2756_3862 363
332 3300047443 Ga0495687_000056 Ga0495687_000056_162631_163737 363
333 3300047472 Ga0495686_0000016 Ga0495686_0000016_136351_137457 363
334 3300053092 Ga0500583_0001266 Ga0500583_0001266_2165_3271 363
335 3300053139 Ga0500568_0023163 Ga0500568_0023163_1188_2294 363
336 iso_pu_bacteria 2818991444 2819590998 363
337 iso_pu_bacteria 2914759650 2914763368 363
338 iso_pu_bacteria 2929154850 2929156271 363
339 3300005367 Ga0070667_100009450 Ga0070667_1000094506 364
340 3300006237 Ga0097621_100000143 Ga0097621_10000014328 364
341 3300006358 Ga0068871_100000741 Ga0068871_1000007413 364
342 3300013306 Ga0163162_10096055 Ga0163162_100960552 364
343 3300013308 Ga0157375_10170253 Ga0157375_101702532 364
344 3300014325 Ga0163163_10001267 Ga0163163_100012675 364
345 3300014968 Ga0157379_10069418 Ga0157379_100694182 364
346 3300014969 Ga0157376_10000191 Ga0157376_100001912 364
347 3300014969 Ga0157376_10131959 Ga0157376_101319591 364
348 3300017792 Ga0163161_10001232 Ga0163161_100012329 364
349 3300025925 Ga0207650_10024901 Ga0207650_100249013 364
350 3300025986 Ga0207658_10111099 Ga0207658_101110992 364
351 3300026089 Ga0207648_10119448 Ga0207648_101194483 364
352 3300031344 Ga0265316_10103640 Ga0265316_101036403 364
353 3300031852 Ga0307410_10039684 Ga0307410_100396843 364
354 3300032126 Ga0307415_100265521 Ga0307415_1002655211 364
355 3300005341 Ga0070691_10003801 Ga0070691_100038014 365
356 3300005539 Ga0068853_100263135 Ga0068853_1002631352 365
357 3300005563 Ga0068855_100017655 Ga0068855_1000176555 365
358 3300005578 Ga0068854_100086023 Ga0068854_1000860232 365
359 3300009093 Ga0105240_10061859 Ga0105240_100618595 365
360 3300010375 Ga0105239_10022156 Ga0105239_100221567 365
361 3300013104 Ga0157370_10271446 Ga0157370_102714462 365
362 3300013105 Ga0157369_10035765 Ga0157369_100357655 365
363 3300013307 Ga0157372_10140471 Ga0157372_101404713 365
364 3300025913 Ga0207695_10000128 Ga0207695_1000012890 365
365 3300025944 Ga0207661_10017692 Ga0207661_100176924 365
366 3300025981 Ga0207640_10071737 Ga0207640_100717372 365
367 3300026041 Ga0207639_10234004 Ga0207639_102340042 365
368 3300003316 rootH1_10166489 rootH1_101664892 367
369 3300003354 JGI25160J50197_1000882 JGI25160J50197_10008825 367
370 3300005328 Ga0070676_10073211 Ga0070676_100732111 367
371 3300005331 Ga0070670_100162490 Ga0070670_1001624902 367
372 3300005343 Ga0070687_100116618 Ga0070687_1001166182 367
373 3300005354 Ga0070675_100014690 Ga0070675_1000146901 367
374 3300005617 Ga0068859_100262138 Ga0068859_1002621381 367
375 3300006847 Ga0075431_100012347 Ga0075431_1000123472 367
376 3300006880 Ga0075429_100027951 Ga0075429_1000279513 367
377 3300006931 Ga0097620_100262107 Ga0097620_1002621071 367
378 3300009094 Ga0111539_10188209 Ga0111539_101882092 367
379 3300009098 Ga0105245_10198392 Ga0105245_101983922 367
380 3300009147 Ga0114129_10332116 Ga0114129_103321162 367
381 3300025302 Ga0207426_1000032 Ga0207426_1000032405 367
382 3300025926 Ga0207659_10042455 Ga0207659_100424552 367
383 3300025942 Ga0207689_10164598 Ga0207689_101645982 367
384 3300027907 Ga0207428_10106156 Ga0207428_101061562 367
385 3300044658 Ga0466972_0000024 Ga0466972_0000024_151924_153042 367
386 3300044765 Ga0466970_0000469 Ga0466970_0000469_8248_9366 367
387 3300050510 nmdc:mga06r32_84935_c1 nmdc:mga06r32_84935_c1_61_1167 367
388 3300050511 nmdc:mga08y16_169039_c1 nmdc:mga08y16_169039_c1_1050_2156 367
389 3300053108 Ga0500562_000007 Ga0500562_000007_128878_129990 367
390 3300053156 Ga0500622_0002683 Ga0500622_0002683_6883_7995 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

137

335

0.89

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

25

375

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.7448 170 367
8i3c-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with chs 0.7437 170 365
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.742 171 367
8i39-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with aba 0.739 170 367
8i38-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in inward conformation 0.7312 170 367
ID Description Score Start End Superfamily
af_Q2G221_49_209_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6474 50 143 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6057 29 365 3.40.1710.10
2p0sA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5884 53 143 3.40.190.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5881 26 362 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5881 26 363 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A3D2JUV4-F1-model_v4 Transport permease protein 0.9279 162 366 GO:0043190
GO:0140359
AF-A0A7C1AJV9-F1-model_v4 Transport permease protein 0.9179 9 367 GO:0043190
GO:0140359
AF-A0A7C1AJV9-F1-model_v4 Transport permease protein 0.9106 9 367 GO:0043190
GO:0140359
AF-A0A7V2TWK0-F1-model_v4 Transport permease protein 0.9061 218 364 GO:0043190
GO:0140359
AF-A0A655XI99-F1-model_v4 Transport permease protein 0.9025 234 365 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
75.53 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map