F431586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 389 | 203 | 778 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300050511|nmdc:mga08y16_967847_c1|nmdc:mga08y16_967847_c1_278_700 |
| Length | 129 |
| Sequence | MLKIEHIGIAVRTLADSVPLFEMLLKSQCYKTELVESEKVNTAFFKTGDTGVISKFIDKKGEGLHHIAFEVEDIEAEMERLKNEGLILLNDKPKKGADNKLICFLHPKSTNGVLVELCQSIRTPSEEIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 134 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 136 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 147 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 185 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 186 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 187 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 188 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 194 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 195 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 196 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 197 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 198 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 199 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 200 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 201 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 202 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 203 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 0 |
| Isolates | 2.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.29 |
| Nodule | 0 |
| Rhizoplane | 1.29 |
| Rhizosphere | 94.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga08y16_967847_c1 | 3300050511 | Bacteria | 833 |
| 2 | rootH1_10089393 | 3300003316 | Bacteria | 2675 |
| 3 | rootL2_10181371 | 3300003322 | Bacteria | 2915 |
| 4 | rootL2_10214863 | 3300003322 | Bacteria | 1499 |
| 5 | Ga0055536_1013441 | 3300003781 | Bacteria | 2953 |
| 6 | Ga0065165_1000226 | 3300005262 | Bacteria | 99005 |
| 7 | Ga0065704_10273653 | 3300005289 | Bacteria | 937 |
| 8 | Ga0070658_10857005 | 3300005327 | Bacteria | 790 |
| 9 | Ga0070676_10039223 | 3300005328 | Unclassified | 2738 |
| 10 | Ga0070676_10052427 | 3300005328 | Unclassified | 2398 |
| 11 | Ga0070683_100644541 | 3300005329 | Bacteria | 1014 |
| 12 | Ga0070683_100780535 | 3300005329 | Unclassified | 916 |
| 13 | Ga0070683_100955880 | 3300005329 | Bacteria | 822 |
| 14 | Ga0070683_101037108 | 3300005329 | Unclassified | 787 |
| 15 | Ga0070690_100012114 | 3300005330 | Bacteria | 5067 |
| 16 | Ga0070670_100023205 | 3300005331 | Bacteria | 5339 |
| 17 | Ga0070670_100087914 | 3300005331 | Unclassified | 2671 |
| 18 | Ga0070670_100710524 | 3300005331 | Bacteria | 904 |
| 19 | Ga0070677_10222177 | 3300005333 | Bacteria | 923 |
| 20 | Ga0070677_10441070 | 3300005333 | Unclassified | 694 |
| 21 | Ga0068869_100003022 | 3300005334 | Bacteria | 10225 |
| 22 | Ga0068869_100013383 | 3300005334 | Bacteria | 5456 |
| 23 | Ga0068869_100087332 | 3300005334 | Bacteria | 2339 |
| 24 | Ga0070666_10111304 | 3300005335 | Unclassified | 1894 |
| 25 | Ga0070682_100376591 | 3300005337 | Bacteria | 1066 |
| 26 | Ga0068868_100044266 | 3300005338 | Bacteria | 3480 |
| 27 | Ga0068868_100093666 | 3300005338 | Viruses | 2422 |
| 28 | Ga0068868_100101174 | 3300005338 | Unclassified | 2332 |
| 29 | Ga0068868_100200747 | 3300005338 | Unclassified | 1662 |
| 30 | Ga0070689_100031358 | 3300005340 | Bacteria | 4038 |
| 31 | Ga0070691_10206990 | 3300005341 | Unclassified | 1033 |
| 32 | Ga0070691_10477062 | 3300005341 | Bacteria | 717 |
| 33 | Ga0070661_100739841 | 3300005344 | Bacteria | 803 |
| 34 | Ga0070668_100181093 | 3300005347 | Viruses | 1721 |
| 35 | Ga0070668_100455037 | 3300005347 | Unclassified | 1101 |
| 36 | Ga0070675_100202741 | 3300005354 | Unclassified | 1722 |
| 37 | Ga0070675_100284432 | 3300005354 | Unclassified | 1454 |
| 38 | Ga0070671_100028674 | 3300005355 | Unclassified | 4586 |
| 39 | Ga0070671_100304921 | 3300005355 | Unclassified | 1356 |
| 40 | Ga0070671_101313965 | 3300005355 | Unclassified | 638 |
| 41 | Ga0070674_100016004 | 3300005356 | Unclassified | 4696 |
| 42 | Ga0070673_100008486 | 3300005364 | Bacteria | 6833 |
| 43 | Ga0070673_100555009 | 3300005364 | Unclassified | 1044 |
| 44 | Ga0070688_100023626 | 3300005365 | Bacteria | 3617 |
| 45 | Ga0070688_100092541 | 3300005365 | Unclassified | 1978 |
| 46 | Ga0070688_100752707 | 3300005365 | Bacteria | 758 |
| 47 | Ga0070659_100008369 | 3300005366 | Bacteria | 7555 |
| 48 | Ga0070659_100832866 | 3300005366 | Unclassified | 803 |
| 49 | Ga0070667_100424708 | 3300005367 | Unclassified | 1212 |
| 50 | Ga0070667_100490662 | 3300005367 | Bacteria | 1125 |
| 51 | Ga0070700_100974775 | 3300005441 | Bacteria | 695 |
| 52 | Ga0070700_101494783 | 3300005441 | Bacteria | 574 |
| 53 | Ga0070678_100004456 | 3300005456 | Bacteria | 7947 |
| 54 | Ga0070678_100009387 | 3300005456 | Bacteria | 5924 |
| 55 | Ga0070678_101062106 | 3300005456 | Bacteria | 746 |
| 56 | Ga0070662_100029753 | 3300005457 | Unclassified | 3814 |
| 57 | Ga0070662_100102265 | 3300005457 | Bacteria | 2171 |
| 58 | Ga0070662_100110031 | 3300005457 | Unclassified | 2097 |
| 59 | Ga0070662_100213462 | 3300005457 | Unclassified | 1537 |
| 60 | Ga0068867_100060305 | 3300005459 | Bacteria | 2814 |
| 61 | Ga0068867_100160277 | 3300005459 | Unclassified | 1774 |
| 62 | Ga0068867_100191598 | 3300005459 | Bacteria | 1632 |
| 63 | Ga0068867_100583370 | 3300005459 | Bacteria | 973 |
| 64 | Ga0070685_10098356 | 3300005466 | Unclassified | 1783 |
| 65 | Ga0070684_100290240 | 3300005535 | Unclassified | 1500 |
| 66 | Ga0070684_100366411 | 3300005535 | Bacteria | 1326 |
| 67 | Ga0070684_100419647 | 3300005535 | Bacteria | 1235 |
| 68 | Ga0068853_100287263 | 3300005539 | Unclassified | 1517 |
| 69 | Ga0068853_100482874 | 3300005539 | Unclassified | 1168 |
| 70 | Ga0068853_101120137 | 3300005539 | Bacteria | 759 |
| 71 | Ga0068853_101476797 | 3300005539 | Bacteria | 658 |
| 72 | Ga0070672_100036847 | 3300005543 | Bacteria | 3729 |
| 73 | Ga0070672_100178508 | 3300005543 | Archaea | 1769 |
| 74 | Ga0070672_100912313 | 3300005543 | Unclassified | 776 |
| 75 | Ga0070686_100053728 | 3300005544 | Unclassified | 2574 |
| 76 | Ga0070686_100085604 | 3300005544 | Unclassified | 2097 |
| 77 | Ga0070693_100349847 | 3300005547 | Unclassified | 1011 |
| 78 | Ga0070665_100026863 | 3300005548 | Bacteria | 5798 |
| 79 | Ga0070665_100158174 | 3300005548 | Bacteria | 2268 |
| 80 | Ga0068855_101395681 | 3300005563 | Unclassified | 722 |
| 81 | Ga0070664_100072791 | 3300005564 | Unclassified | 2947 |
| 82 | Ga0070664_100119348 | 3300005564 | Unclassified | 2308 |
| 83 | Ga0070664_100672675 | 3300005564 | Bacteria | 963 |
| 84 | Ga0068857_100048266 | 3300005577 | Bacteria | 3780 |
| 85 | Ga0068857_100057192 | 3300005577 | Bacteria | 3461 |
| 86 | Ga0068854_100236351 | 3300005578 | Unclassified | 1453 |
| 87 | Ga0068854_100492648 | 3300005578 | Unclassified | 1031 |
| 88 | Ga0068854_101694996 | 3300005578 | Bacteria | 578 |
| 89 | Ga0068856_100302116 | 3300005614 | Bacteria | 1618 |
| 90 | Ga0068856_100822665 | 3300005614 | Bacteria | 948 |
| 91 | Ga0070702_100275197 | 3300005615 | Unclassified | 1153 |
| 92 | Ga0068852_100133938 | 3300005616 | Unclassified | 2285 |
| 93 | Ga0068852_100411083 | 3300005616 | Bacteria | 1333 |
| 94 | Ga0068852_100998230 | 3300005616 | Bacteria | 856 |
| 95 | Ga0068859_100035079 | 3300005617 | Bacteria | 5032 |
| 96 | Ga0068859_100253456 | 3300005617 | Bacteria | 1850 |
| 97 | Ga0068859_100628328 | 3300005617 | Unclassified | 1166 |
| 98 | Ga0068859_101149745 | 3300005617 | Unclassified | 854 |
| 99 | Ga0068864_100066651 | 3300005618 | Bacteria | 3125 |
| 100 | Ga0068864_100143665 | 3300005618 | Bacteria | 2155 |
| 101 | Ga0068866_10024145 | 3300005718 | Bacteria | 2837 |
| 102 | Ga0068866_10218569 | 3300005718 | Unclassified | 1148 |
| 103 | Ga0068866_10742269 | 3300005718 | Unclassified | 677 |
| 104 | Ga0068861_100210661 | 3300005719 | Unclassified | 1637 |
| 105 | Ga0068851_10419243 | 3300005834 | Unclassified | 790 |
| 106 | Ga0068870_10045623 | 3300005840 | Bacteria | 2295 |
| 107 | Ga0068870_10134417 | 3300005840 | Unclassified | 1440 |
| 108 | Ga0068870_10765192 | 3300005840 | Bacteria | 672 |
| 109 | Ga0068863_100129098 | 3300005841 | Bacteria | 2413 |
| 110 | Ga0068863_100155119 | 3300005841 | Bacteria | 2192 |
| 111 | Ga0068858_100394891 | 3300005842 | Archaea | 1328 |
| 112 | Ga0068858_101747055 | 3300005842 | Bacteria | 614 |
| 113 | Ga0068858_101940387 | 3300005842 | Unclassified | 582 |
| 114 | Ga0068860_100443069 | 3300005843 | Unclassified | 1290 |
| 115 | Ga0068860_100472590 | 3300005843 | Bacteria | 1249 |
| 116 | Ga0068862_100278093 | 3300005844 | Bacteria | 1533 |
| 117 | Ga0097621_100183907 | 3300006237 | Unclassified | 1807 |
| 118 | Ga0097621_100550107 | 3300006237 | Unclassified | 1050 |
| 119 | Ga0068871_100317234 | 3300006358 | Bacteria | 1371 |
| 120 | Ga0068871_100326908 | 3300006358 | Bacteria | 1352 |
| 121 | Ga0068865_100067473 | 3300006881 | Bacteria | 2527 |
| 122 | Ga0068865_100166361 | 3300006881 | Bacteria | 1687 |
| 123 | Ga0068865_100322817 | 3300006881 | Unclassified | 1242 |
| 124 | Ga0068865_100581626 | 3300006881 | Unclassified | 944 |
| 125 | Ga0097620_100035080 | 3300006931 | Bacteria | 5032 |
| 126 | Ga0097620_100253463 | 3300006931 | Bacteria | 1850 |
| 127 | Ga0097620_100628282 | 3300006931 | Unclassified | 1166 |
| 128 | Ga0097620_101149975 | 3300006931 | Unclassified | 854 |
| 129 | Ga0105240_10179786 | 3300009093 | Bacteria | 2497 |
| 130 | Ga0105240_10463930 | 3300009093 | Unclassified | 1415 |
| 131 | Ga0111539_11333247 | 3300009094 | Bacteria | 833 |
| 132 | Ga0105247_10305030 | 3300009101 | Bacteria | 1106 |
| 133 | Ga0105241_10104565 | 3300009174 | Unclassified | 2256 |
| 134 | Ga0105241_10539771 | 3300009174 | Unclassified | 1045 |
| 135 | Ga0105242_10079974 | 3300009176 | Bacteria | 2731 |
| 136 | Ga0105242_10105250 | 3300009176 | Unclassified | 2396 |
| 137 | Ga0105242_10109086 | 3300009176 | Unclassified | 2356 |
| 138 | Ga0105242_10353957 | 3300009176 | Bacteria | 1357 |
| 139 | Ga0105242_11074326 | 3300009176 | Bacteria | 817 |
| 140 | Ga0105248_10354849 | 3300009177 | Bacteria | 1651 |
| 141 | Ga0105248_10601455 | 3300009177 | Unclassified | 1241 |
| 142 | Ga0105248_10776157 | 3300009177 | Bacteria | 1081 |
| 143 | Ga0105248_10800682 | 3300009177 | Bacteria | 1064 |
| 144 | Ga0105249_10001887 | 3300009553 | Bacteria | 18138 |
| 145 | Ga0105249_10234517 | 3300009553 | Bacteria | 1811 |
| 146 | Ga0105239_10028027 | 3300010375 | Bacteria | 6198 |
| 147 | Ga0105239_10825533 | 3300010375 | Unclassified | 1062 |
| 148 | Ga0105246_10074145 | 3300011119 | Unclassified | 2405 |
| 149 | Ga0105246_10912980 | 3300011119 | Bacteria | 788 |
| 150 | Ga0157373_10877660 | 3300013100 | Bacteria | 665 |
| 151 | Ga0157371_10001213 | 3300013102 | Bacteria | 27466 |
| 152 | Ga0157371_10115562 | 3300013102 | Bacteria | 1906 |
| 153 | Ga0157371_10151585 | 3300013102 | Bacteria | 1654 |
| 154 | Ga0157370_10043964 | 3300013104 | Bacteria | 4297 |
| 155 | Ga0157370_10155240 | 3300013104 | Bacteria | 2129 |
| 156 | Ga0157370_10351484 | 3300013104 | Bacteria | 1359 |
| 157 | Ga0157369_10124437 | 3300013105 | Bacteria | 2735 |
| 158 | Ga0157369_10152586 | 3300013105 | Bacteria | 2441 |
| 159 | Ga0157369_10388677 | 3300013105 | Unclassified | 1448 |
| 160 | Ga0157369_11519571 | 3300013105 | Bacteria | 681 |
| 161 | Ga0157369_11884231 | 3300013105 | Bacteria | 607 |
| 162 | Ga0157374_10001762 | 3300013296 | Bacteria | 18209 |
| 163 | Ga0157374_10018577 | 3300013296 | Bacteria | 6139 |
| 164 | Ga0157374_10067378 | 3300013296 | Bacteria | 3365 |
| 165 | Ga0157374_10140158 | 3300013296 | Viruses | 2347 |
| 166 | Ga0157374_10465342 | 3300013296 | Unclassified | 1266 |
| 167 | Ga0157378_10071803 | 3300013297 | Unclassified | 3109 |
| 168 | Ga0157378_10292561 | 3300013297 | Bacteria | 1574 |
| 169 | Ga0163162_10001667 | 3300013306 | Bacteria | 20841 |
| 170 | Ga0163162_10162157 | 3300013306 | Bacteria | 2358 |
| 171 | Ga0163162_10331696 | 3300013306 | Bacteria | 1654 |
| 172 | Ga0163162_11048520 | 3300013306 | Bacteria | 923 |
| 173 | Ga0157372_10005711 | 3300013307 | Bacteria | 13244 |
| 174 | Ga0157372_10045873 | 3300013307 | Bacteria | 4850 |
| 175 | Ga0157372_10048744 | 3300013307 | Unclassified | 4708 |
| 176 | Ga0157372_10273706 | 3300013307 | Bacteria | 1962 |
| 177 | Ga0157375_10007784 | 3300013308 | Bacteria | 9374 |
| 178 | Ga0157375_10159706 | 3300013308 | Bacteria | 2395 |
| 179 | Ga0157375_10224555 | 3300013308 | Unclassified | 2037 |
| 180 | Ga0157375_10612172 | 3300013308 | Unclassified | 1248 |
| 181 | Ga0163163_10000469 | 3300014325 | Bacteria | 36859 |
| 182 | Ga0163163_10076447 | 3300014325 | Bacteria | 3343 |
| 183 | Ga0163163_11237660 | 3300014325 | Bacteria | 809 |
| 184 | Ga0157380_10879007 | 3300014326 | Unclassified | 920 |
| 185 | Ga0157380_10925283 | 3300014326 | Unclassified | 900 |
| 186 | Ga0157380_12832142 | 3300014326 | Unclassified | 551 |
| 187 | Ga0157377_10053114 | 3300014745 | Unclassified | 2290 |
| 188 | Ga0157377_10104283 | 3300014745 | Bacteria | 1695 |
| 189 | Ga0157377_10386766 | 3300014745 | Bacteria | 949 |
| 190 | Ga0157377_11482544 | 3300014745 | Unclassified | 538 |
| 191 | Ga0157379_10037332 | 3300014968 | Bacteria | 4331 |
| 192 | Ga0157379_10258255 | 3300014968 | Bacteria | 1583 |
| 193 | Ga0157379_10627692 | 3300014968 | Bacteria | 1005 |
| 194 | Ga0157379_11701822 | 3300014968 | Unclassified | 618 |
| 195 | Ga0157376_10046187 | 3300014969 | Bacteria | 3590 |
| 196 | Ga0157376_10467087 | 3300014969 | Bacteria | 1234 |
| 197 | Ga0157376_11807919 | 3300014969 | Unclassified | 647 |
| 198 | Ga0163161_10012604 | 3300017792 | Bacteria | 5874 |
| 199 | Ga0163161_10015717 | 3300017792 | Bacteria | 5278 |
| 200 | Ga0163161_10058469 | 3300017792 | Bacteria | 2802 |
| 201 | Ga0163161_10192491 | 3300017792 | Bacteria | 1569 |
| 202 | Ga0163161_10309307 | 3300017792 | Bacteria | 1246 |
| 203 | Ga0163161_10403675 | 3300017792 | Bacteria | 1096 |
| 204 | Ga0163161_10472782 | 3300017792 | Unclassified | 1016 |
| 205 | Ga0163161_11032322 | 3300017792 | Bacteria | 703 |
| 206 | Ga0213876_10004339 | 3300021384 | Bacteria | 7945 |
| 207 | Ga0209676_1001032 | 3300025292 | Bacteria | 32333 |
| 208 | Ga0207426_1136854 | 3300025302 | Unclassified | 587 |
| 209 | Ga0207697_10022545 | 3300025315 | Unclassified | 2580 |
| 210 | Ga0207682_10558315 | 3300025893 | Bacteria | 541 |
| 211 | Ga0207642_10006766 | 3300025899 | Bacteria | 3833 |
| 212 | Ga0207642_10352561 | 3300025899 | Unclassified | 868 |
| 213 | Ga0207710_10396216 | 3300025900 | Unclassified | 708 |
| 214 | Ga0207680_10201950 | 3300025903 | Archaea | 1355 |
| 215 | Ga0207647_10041865 | 3300025904 | Bacteria | 2877 |
| 216 | Ga0207647_10058300 | 3300025904 | Unclassified | 2365 |
| 217 | Ga0207685_10722075 | 3300025905 | Bacteria | 544 |
| 218 | Ga0207645_10016913 | 3300025907 | Bacteria | 4819 |
| 219 | Ga0207645_10035131 | 3300025907 | Unclassified | 3218 |
| 220 | Ga0207645_10297173 | 3300025907 | Bacteria | 1075 |
| 221 | Ga0207643_10061736 | 3300025908 | Unclassified | 2141 |
| 222 | Ga0207643_10144214 | 3300025908 | Unclassified | 1424 |
| 223 | Ga0207643_10306916 | 3300025908 | Unclassified | 988 |
| 224 | Ga0207654_10150519 | 3300025911 | Bacteria | 1493 |
| 225 | Ga0207695_10398457 | 3300025913 | Unclassified | 1261 |
| 226 | Ga0207649_10224567 | 3300025920 | Unclassified | 1340 |
| 227 | Ga0207649_10303858 | 3300025920 | Bacteria | 1167 |
| 228 | Ga0207649_11325171 | 3300025920 | Bacteria | 569 |
| 229 | Ga0207681_10180094 | 3300025923 | Unclassified | 1609 |
| 230 | Ga0207681_10458650 | 3300025923 | Unclassified | 1038 |
| 231 | Ga0207650_10067204 | 3300025925 | Bacteria | 2690 |
| 232 | Ga0207650_10214195 | 3300025925 | Bacteria | 1548 |
| 233 | Ga0207650_11278592 | 3300025925 | Unclassified | 624 |
| 234 | Ga0207659_10158159 | 3300025926 | Unclassified | 1776 |
| 235 | Ga0207644_10207586 | 3300025931 | Unclassified | 1547 |
| 236 | Ga0207644_10276998 | 3300025931 | Unclassified | 1346 |
| 237 | Ga0207690_10147829 | 3300025932 | Bacteria | 1739 |
| 238 | Ga0207690_10513879 | 3300025932 | Unclassified | 970 |
| 239 | Ga0207706_10001407 | 3300025933 | Bacteria | 24074 |
| 240 | Ga0207706_10051262 | 3300025933 | Unclassified | 3644 |
| 241 | Ga0207686_10235771 | 3300025934 | Unclassified | 1329 |
| 242 | Ga0207670_10100219 | 3300025936 | Bacteria | 2068 |
| 243 | Ga0207669_10134238 | 3300025937 | Bacteria | 1706 |
| 244 | Ga0207704_10126879 | 3300025938 | Unclassified | 1758 |
| 245 | Ga0207704_10436987 | 3300025938 | Unclassified | 1041 |
| 246 | Ga0207691_10036605 | 3300025940 | Bacteria | 4547 |
| 247 | Ga0207691_10036849 | 3300025940 | Unclassified | 4530 |
| 248 | Ga0207689_10010217 | 3300025942 | Bacteria | 8086 |
| 249 | Ga0207689_10030025 | 3300025942 | Unclassified | 4532 |
| 250 | Ga0207689_10100995 | 3300025942 | Bacteria | 2369 |
| 251 | Ga0207661_10009057 | 3300025944 | Bacteria | 7134 |
| 252 | Ga0207661_10359552 | 3300025944 | Bacteria | 1315 |
| 253 | Ga0207661_10382476 | 3300025944 | Unclassified | 1274 |
| 254 | Ga0207661_10432381 | 3300025944 | Bacteria | 1197 |
| 255 | Ga0207661_10640781 | 3300025944 | Bacteria | 976 |
| 256 | Ga0207679_10001076 | 3300025945 | Bacteria | 17378 |
| 257 | Ga0207679_10199490 | 3300025945 | Unclassified | 1670 |
| 258 | Ga0207679_10217418 | 3300025945 | Unclassified | 1606 |
| 259 | Ga0207667_10598304 | 3300025949 | Unclassified | 1112 |
| 260 | Ga0207651_10013089 | 3300025960 | Bacteria | 4731 |
| 261 | Ga0207651_10374060 | 3300025960 | Unclassified | 1206 |
| 262 | Ga0207651_10639059 | 3300025960 | Bacteria | 933 |
| 263 | Ga0207651_10727861 | 3300025960 | Bacteria | 876 |
| 264 | Ga0207712_10002828 | 3300025961 | Bacteria | 11120 |
| 265 | Ga0207712_10275287 | 3300025961 | Bacteria | 1371 |
| 266 | Ga0207712_11073450 | 3300025961 | Bacteria | 716 |
| 267 | Ga0207668_11317394 | 3300025972 | Unclassified | 650 |
| 268 | Ga0207640_10104919 | 3300025981 | Unclassified | 1990 |
| 269 | Ga0207640_10618432 | 3300025981 | Archaea | 919 |
| 270 | Ga0207658_10107583 | 3300025986 | Unclassified | 2198 |
| 271 | Ga0207658_10385663 | 3300025986 | Bacteria | 1228 |
| 272 | Ga0207658_10846089 | 3300025986 | Unclassified | 832 |
| 273 | Ga0207677_10036861 | 3300026023 | Bacteria | 3191 |
| 274 | Ga0207677_10120776 | 3300026023 | Bacteria | 1971 |
| 275 | Ga0207677_10233149 | 3300026023 | Unclassified | 1484 |
| 276 | Ga0207703_10278802 | 3300026035 | Archaea | 1517 |
| 277 | Ga0207703_10487026 | 3300026035 | Unclassified | 1156 |
| 278 | Ga0207703_10920241 | 3300026035 | Bacteria | 837 |
| 279 | Ga0207703_11168989 | 3300026035 | Unclassified | 739 |
| 280 | Ga0207639_10407851 | 3300026041 | Unclassified | 1226 |
| 281 | Ga0207639_10663637 | 3300026041 | Archaea | 965 |
| 282 | Ga0207639_10867984 | 3300026041 | Bacteria | 843 |
| 283 | Ga0207639_10977267 | 3300026041 | Bacteria | 793 |
| 284 | Ga0207639_11203134 | 3300026041 | Unclassified | 711 |
| 285 | Ga0207678_10992416 | 3300026067 | Bacteria | 743 |
| 286 | Ga0207702_10744088 | 3300026078 | Bacteria | 968 |
| 287 | Ga0207641_10090272 | 3300026088 | Bacteria | 2679 |
| 288 | Ga0207641_10587840 | 3300026088 | Unclassified | 1089 |
| 289 | Ga0207648_10004603 | 3300026089 | Bacteria | 14142 |
| 290 | Ga0207648_10055240 | 3300026089 | Unclassified | 3467 |
| 291 | Ga0207648_10055325 | 3300026089 | Bacteria | 3464 |
| 292 | Ga0207648_10236549 | 3300026089 | Bacteria | 1626 |
| 293 | Ga0207676_10001515 | 3300026095 | Bacteria | 17151 |
| 294 | Ga0207676_10041422 | 3300026095 | Bacteria | 3535 |
| 295 | Ga0207674_10074051 | 3300026116 | Bacteria | 3418 |
| 296 | Ga0207674_10424043 | 3300026116 | Bacteria | 1285 |
| 297 | Ga0207674_10424386 | 3300026116 | Unclassified | 1285 |
| 298 | Ga0207674_10546934 | 3300026116 | Archaea | 1118 |
| 299 | Ga0207675_100346505 | 3300026118 | Bacteria | 1455 |
| 300 | Ga0207675_100664098 | 3300026118 | Unclassified | 1049 |
| 301 | Ga0207683_10006065 | 3300026121 | Bacteria | 10348 |
| 302 | Ga0207683_10017857 | 3300026121 | Bacteria | 6050 |
| 303 | Ga0207698_10023574 | 3300026142 | Unclassified | 4302 |
| 304 | Ga0268265_10128977 | 3300028380 | Unclassified | 2098 |
| 305 | Ga0268265_10433737 | 3300028380 | Unclassified | 1223 |
| 306 | Ga0268264_10225228 | 3300028381 | Bacteria | 1728 |
| 307 | Ga0268264_10496967 | 3300028381 | Archaea | 1189 |
| 308 | Ga0307515_10065908 | 3300028794 | Bacteria | 5028 |
| 309 | Ga0265327_10023820 | 3300031251 | Bacteria | 3613 |
| 310 | Ga0265327_10490234 | 3300031251 | Unclassified | 530 |
| 311 | Ga0307509_10494227 | 3300031507 | Bacteria | 909 |
| 312 | Ga0316576_10089777 | 3300031727 | Bacteria | 2289 |
| 313 | Ga0307416_102493960 | 3300032002 | Bacteria | 616 |
| 314 | Ga0307414_10044310 | 3300032004 | Bacteria | 3037 |
| 315 | Ga0307414_10149929 | 3300032004 | Bacteria | 1838 |
| 316 | Ga0307414_10252133 | 3300032004 | Bacteria | 1468 |
| 317 | Ga0307414_10268637 | 3300032004 | Bacteria | 1427 |
| 318 | Ga0307414_10487263 | 3300032004 | Bacteria | 1088 |
| 319 | Ga0307414_10759505 | 3300032004 | Bacteria | 882 |
| 320 | Ga0307414_12052555 | 3300032004 | Bacteria | 534 |
| 321 | Ga0307414_12132670 | 3300032004 | Bacteria | 523 |
| 322 | Ga0307411_10061135 | 3300032005 | Bacteria | 2506 |
| 323 | Ga0307411_10429731 | 3300032005 | Bacteria | 1099 |
| 324 | Ga0373944_0179166 | 3300035089 | Bacteria | 759 |
| 325 | Ga0373943_0139293 | 3300035170 | Bacteria | 1306 |
| 326 | Ga0373924_0016317 | 3300035410 | Bacteria | 2834 |
| 327 | Ga0373933_0485307 | 3300035724 | Bacteria | 809 |
| 328 | Ga0373937_0013175 | 3300036401 | Bacteria | 7281 |
| 329 | Ga0436365_1251897 | 3300039437 | Bacteria | 24739 |
| 330 | Ga0451807_1263247 | 3300041486 | Unclassified | 540 |
| 331 | Ga0466959_0101348 | 3300045049 | Bacteria | 2061 |
| 332 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 333 | Ga0495627_027473 | 3300046453 | Bacteria | 1825 |
| 334 | Ga0495592_0021970 | 3300046454 | Bacteria | 4856 |
| 335 | Ga0495590_0268399 | 3300046457 | Bacteria | 637 |
| 336 | Ga0495650_0009451 | 3300046471 | Bacteria | 5540 |
| 337 | Ga0495580_0790264 | 3300046472 | Bacteria | 616 |
| 338 | Ga0495639_0545933 | 3300046475 | Unclassified | 594 |
| 339 | Ga0495664_0220655 | 3300046477 | Bacteria | 1148 |
| 340 | Ga0495608_0034250 | 3300046511 | Bacteria | 3429 |
| 341 | Ga0495618_0056205 | 3300046514 | Bacteria | 2492 |
| 342 | Ga0495628_0027525 | 3300046516 | Bacteria | 4625 |
| 343 | Ga0495630_0007976 | 3300046517 | Bacteria | 7601 |
| 344 | Ga0495630_0937682 | 3300046517 | Unclassified | 659 |
| 345 | Ga0495652_0489840 | 3300046529 | Bacteria | 854 |
| 346 | Ga0495586_0314416 | 3300046535 | Bacteria | 898 |
| 347 | Ga0495598_0199636 | 3300046537 | Bacteria | 722 |
| 348 | Ga0495621_0219763 | 3300046539 | Unclassified | 769 |
| 349 | Ga0495645_0720990 | 3300046543 | Bacteria | 604 |
| 350 | Ga0495667_0115916 | 3300046559 | Bacteria | 1731 |
| 351 | Ga0495669_0213503 | 3300046684 | Unclassified | 924 |
| 352 | Ga0495613_0072913 | 3300046689 | Bacteria | 2503 |
| 353 | Ga0495624_0407735 | 3300046690 | Bacteria | 816 |
| 354 | Ga0495670_0430206 | 3300046691 | Unclassified | 714 |
| 355 | Ga0495604_0371884 | 3300047317 | Unclassified | 946 |
| 356 | Ga0495674_0108767 | 3300047319 | Bacteria | 2352 |
| 357 | Ga0495680_0484937 | 3300047322 | Unclassified | 841 |
| 358 | Ga0495675_0839047 | 3300047444 | Bacteria | 506 |
| 359 | Ga0495684_0326785 | 3300047471 | Bacteria | 1095 |
| 360 | Ga0496100_0476166 | 3300048903 | Bacteria | 960 |
| 361 | Ga0496100_1502203 | 3300048903 | Bacteria | 532 |
| 362 | Ga0496106_1115593 | 3300048909 | Unclassified | 618 |
| 363 | Ga0496114_0044387 | 3300048917 | Unclassified | 3688 |
| 364 | Ga0496126_0015308 | 3300048929 | Bacteria | 7719 |
| 365 | Ga0501032_0062321 | 3300049569 | Bacteria | 2499 |
| 366 | Ga0501034_0025155 | 3300049571 | Bacteria | 6059 |
| 367 | Ga0501036_0038784 | 3300049572 | Bacteria | 4033 |
| 368 | Ga0501037_0034451 | 3300049573 | Bacteria | 3736 |
| 369 | Ga0501043_0469357 | 3300049579 | Bacteria | 943 |
| 370 | Ga0501235_152568 | 3300049669 | Bacteria | 599 |
| 371 | Ga0501249_110912 | 3300049679 | Bacteria | 663 |
| 372 | Ga0501253_073053 | 3300049683 | Bacteria | 761 |
| 373 | Ga0501221_215358 | 3300049704 | Bacteria | 539 |
| 374 | Ga0501080_0513561 | 3300049742 | Bacteria | 1070 |
| 375 | Ga0501035_0002418 | 3300049822 | Bacteria | 18265 |
| 376 | Ga0501044_0032748 | 3300049823 | Bacteria | 5463 |
| 377 | nmdc:mga0rr50_756436_c1 | 3300050513 | Bacteria | 829 |
| 378 | Ga0495619_0112154 | 3300053085 | Bacteria | 1864 |
| 379 | Ga0500622_0000151 | 3300053156 | Bacteria | 73392 |
| 380 | 2522547716 | 2522125168 | Bacteria | 7376607 |
| 381 | 2739644737 | 2739367663 | Bacteria | 5040914 |
| 382 | 2819677379 | 2818991460 | Bacteria | 7595395 |
| 383 | 2839992368 | 2839989709 | Bacteria | 3773432 |
| 384 | 2852627577 | 2852627209 | Bacteria | 5896285 |
| 385 | 2857628736 | 2857627736 | Bacteria | 5625397 |
| 386 | 2881956203 | 2881955468 | Bacteria | 3545609 |
| 387 | 2884797305 | 2884791551 | Bacteria | 8511252 |
| 388 | 2902051262 | 2902048731 | Bacteria | 4976191 |
| 389 | 8036738872 | 8036736890 | Bacteria | 2944828 |
| 390 | nmdc:mga08y16_967847_c1 | |||
| 391 | rootH1_10089393 | |||
| 392 | rootL2_10181371 | |||
| 393 | rootL2_10214863 | |||
| 394 | Ga0055536_1013441 | |||
| 395 | Ga0065165_1000226 | |||
| 396 | Ga0065704_10273653 | |||
| 397 | Ga0070658_10857005 | |||
| 398 | Ga0070676_10039223 | |||
| 399 | Ga0070676_10052427 | |||
| 400 | Ga0070683_100644541 | |||
| 401 | Ga0070683_100780535 | |||
| 402 | Ga0070683_100955880 | |||
| 403 | Ga0070683_101037108 | |||
| 404 | Ga0070690_100012114 | |||
| 405 | Ga0070670_100023205 | |||
| 406 | Ga0070670_100087914 | |||
| 407 | Ga0070670_100710524 | |||
| 408 | Ga0070677_10222177 | |||
| 409 | Ga0070677_10441070 | |||
| 410 | Ga0068869_100003022 | |||
| 411 | Ga0068869_100013383 | |||
| 412 | Ga0068869_100087332 | |||
| 413 | Ga0070666_10111304 | |||
| 414 | Ga0070682_100376591 | |||
| 415 | Ga0068868_100044266 | |||
| 416 | Ga0068868_100093666 | |||
| 417 | Ga0068868_100101174 | |||
| 418 | Ga0068868_100200747 | |||
| 419 | Ga0070689_100031358 | |||
| 420 | Ga0070691_10206990 | |||
| 421 | Ga0070691_10477062 | |||
| 422 | Ga0070661_100739841 | |||
| 423 | Ga0070668_100181093 | |||
| 424 | Ga0070668_100455037 | |||
| 425 | Ga0070675_100202741 | |||
| 426 | Ga0070675_100284432 | |||
| 427 | Ga0070671_100028674 | |||
| 428 | Ga0070671_100304921 | |||
| 429 | Ga0070671_101313965 | |||
| 430 | Ga0070674_100016004 | |||
| 431 | Ga0070673_100008486 | |||
| 432 | Ga0070673_100555009 | |||
| 433 | Ga0070688_100023626 | |||
| 434 | Ga0070688_100092541 | |||
| 435 | Ga0070688_100752707 | |||
| 436 | Ga0070659_100008369 | |||
| 437 | Ga0070659_100832866 | |||
| 438 | Ga0070667_100424708 | |||
| 439 | Ga0070667_100490662 | |||
| 440 | Ga0070700_100974775 | |||
| 441 | Ga0070700_101494783 | |||
| 442 | Ga0070678_100004456 | |||
| 443 | Ga0070678_100009387 | |||
| 444 | Ga0070678_101062106 | |||
| 445 | Ga0070662_100029753 | |||
| 446 | Ga0070662_100102265 | |||
| 447 | Ga0070662_100110031 | |||
| 448 | Ga0070662_100213462 | |||
| 449 | Ga0068867_100060305 | |||
| 450 | Ga0068867_100160277 | |||
| 451 | Ga0068867_100191598 | |||
| 452 | Ga0068867_100583370 | |||
| 453 | Ga0070685_10098356 | |||
| 454 | Ga0070684_100290240 | |||
| 455 | Ga0070684_100366411 | |||
| 456 | Ga0070684_100419647 | |||
| 457 | Ga0068853_100287263 | |||
| 458 | Ga0068853_100482874 | |||
| 459 | Ga0068853_101120137 | |||
| 460 | Ga0068853_101476797 | |||
| 461 | Ga0070672_100036847 | |||
| 462 | Ga0070672_100178508 | |||
| 463 | Ga0070672_100912313 | |||
| 464 | Ga0070686_100053728 | |||
| 465 | Ga0070686_100085604 | |||
| 466 | Ga0070693_100349847 | |||
| 467 | Ga0070665_100026863 | |||
| 468 | Ga0070665_100158174 | |||
| 469 | Ga0068855_101395681 | |||
| 470 | Ga0070664_100072791 | |||
| 471 | Ga0070664_100119348 | |||
| 472 | Ga0070664_100672675 | |||
| 473 | Ga0068857_100048266 | |||
| 474 | Ga0068857_100057192 | |||
| 475 | Ga0068854_100236351 | |||
| 476 | Ga0068854_100492648 | |||
| 477 | Ga0068854_101694996 | |||
| 478 | Ga0068856_100302116 | |||
| 479 | Ga0068856_100822665 | |||
| 480 | Ga0070702_100275197 | |||
| 481 | Ga0068852_100133938 | |||
| 482 | Ga0068852_100411083 | |||
| 483 | Ga0068852_100998230 | |||
| 484 | Ga0068859_100035079 | |||
| 485 | Ga0068859_100253456 | |||
| 486 | Ga0068859_100628328 | |||
| 487 | Ga0068859_101149745 | |||
| 488 | Ga0068864_100066651 | |||
| 489 | Ga0068864_100143665 | |||
| 490 | Ga0068866_10024145 | |||
| 491 | Ga0068866_10218569 | |||
| 492 | Ga0068866_10742269 | |||
| 493 | Ga0068861_100210661 | |||
| 494 | Ga0068851_10419243 | |||
| 495 | Ga0068870_10045623 | |||
| 496 | Ga0068870_10134417 | |||
| 497 | Ga0068870_10765192 | |||
| 498 | Ga0068863_100129098 | |||
| 499 | Ga0068863_100155119 | |||
| 500 | Ga0068858_100394891 | |||
| 501 | Ga0068858_101747055 | |||
| 502 | Ga0068858_101940387 | |||
| 503 | Ga0068860_100443069 | |||
| 504 | Ga0068860_100472590 | |||
| 505 | Ga0068862_100278093 | |||
| 506 | Ga0097621_100183907 | |||
| 507 | Ga0097621_100550107 | |||
| 508 | Ga0068871_100317234 | |||
| 509 | Ga0068871_100326908 | |||
| 510 | Ga0068865_100067473 | |||
| 511 | Ga0068865_100166361 | |||
| 512 | Ga0068865_100322817 | |||
| 513 | Ga0068865_100581626 | |||
| 514 | Ga0097620_100035080 | |||
| 515 | Ga0097620_100253463 | |||
| 516 | Ga0097620_100628282 | |||
| 517 | Ga0097620_101149975 | |||
| 518 | Ga0105240_10179786 | |||
| 519 | Ga0105240_10463930 | |||
| 520 | Ga0111539_11333247 | |||
| 521 | Ga0105247_10305030 | |||
| 522 | Ga0105241_10104565 | |||
| 523 | Ga0105241_10539771 | |||
| 524 | Ga0105242_10079974 | |||
| 525 | Ga0105242_10105250 | |||
| 526 | Ga0105242_10109086 | |||
| 527 | Ga0105242_10353957 | |||
| 528 | Ga0105242_11074326 | |||
| 529 | Ga0105248_10354849 | |||
| 530 | Ga0105248_10601455 | |||
| 531 | Ga0105248_10776157 | |||
| 532 | Ga0105248_10800682 | |||
| 533 | Ga0105249_10001887 | |||
| 534 | Ga0105249_10234517 | |||
| 535 | Ga0105239_10028027 | |||
| 536 | Ga0105239_10825533 | |||
| 537 | Ga0105246_10074145 | |||
| 538 | Ga0105246_10912980 | |||
| 539 | Ga0157373_10877660 | |||
| 540 | Ga0157371_10001213 | |||
| 541 | Ga0157371_10115562 | |||
| 542 | Ga0157371_10151585 | |||
| 543 | Ga0157370_10043964 | |||
| 544 | Ga0157370_10155240 | |||
| 545 | Ga0157370_10351484 | |||
| 546 | Ga0157369_10124437 | |||
| 547 | Ga0157369_10152586 | |||
| 548 | Ga0157369_10388677 | |||
| 549 | Ga0157369_11519571 | |||
| 550 | Ga0157369_11884231 | |||
| 551 | Ga0157374_10001762 | |||
| 552 | Ga0157374_10018577 | |||
| 553 | Ga0157374_10067378 | |||
| 554 | Ga0157374_10140158 | |||
| 555 | Ga0157374_10465342 | |||
| 556 | Ga0157378_10071803 | |||
| 557 | Ga0157378_10292561 | |||
| 558 | Ga0163162_10001667 | |||
| 559 | Ga0163162_10162157 | |||
| 560 | Ga0163162_10331696 | |||
| 561 | Ga0163162_11048520 | |||
| 562 | Ga0157372_10005711 | |||
| 563 | Ga0157372_10045873 | |||
| 564 | Ga0157372_10048744 | |||
| 565 | Ga0157372_10273706 | |||
| 566 | Ga0157375_10007784 | |||
| 567 | Ga0157375_10159706 | |||
| 568 | Ga0157375_10224555 | |||
| 569 | Ga0157375_10612172 | |||
| 570 | Ga0163163_10000469 | |||
| 571 | Ga0163163_10076447 | |||
| 572 | Ga0163163_11237660 | |||
| 573 | Ga0157380_10879007 | |||
| 574 | Ga0157380_10925283 | |||
| 575 | Ga0157380_12832142 | |||
| 576 | Ga0157377_10053114 | |||
| 577 | Ga0157377_10104283 | |||
| 578 | Ga0157377_10386766 | |||
| 579 | Ga0157377_11482544 | |||
| 580 | Ga0157379_10037332 | |||
| 581 | Ga0157379_10258255 | |||
| 582 | Ga0157379_10627692 | |||
| 583 | Ga0157379_11701822 | |||
| 584 | Ga0157376_10046187 | |||
| 585 | Ga0157376_10467087 | |||
| 586 | Ga0157376_11807919 | |||
| 587 | Ga0163161_10012604 | |||
| 588 | Ga0163161_10015717 | |||
| 589 | Ga0163161_10058469 | |||
| 590 | Ga0163161_10192491 | |||
| 591 | Ga0163161_10309307 | |||
| 592 | Ga0163161_10403675 | |||
| 593 | Ga0163161_10472782 | |||
| 594 | Ga0163161_11032322 | |||
| 595 | Ga0213876_10004339 | |||
| 596 | Ga0209676_1001032 | |||
| 597 | Ga0207426_1136854 | |||
| 598 | Ga0207697_10022545 | |||
| 599 | Ga0207682_10558315 | |||
| 600 | Ga0207642_10006766 | |||
| 601 | Ga0207642_10352561 | |||
| 602 | Ga0207710_10396216 | |||
| 603 | Ga0207680_10201950 | |||
| 604 | Ga0207647_10041865 | |||
| 605 | Ga0207647_10058300 | |||
| 606 | Ga0207685_10722075 | |||
| 607 | Ga0207645_10016913 | |||
| 608 | Ga0207645_10035131 | |||
| 609 | Ga0207645_10297173 | |||
| 610 | Ga0207643_10061736 | |||
| 611 | Ga0207643_10144214 | |||
| 612 | Ga0207643_10306916 | |||
| 613 | Ga0207654_10150519 | |||
| 614 | Ga0207695_10398457 | |||
| 615 | Ga0207649_10224567 | |||
| 616 | Ga0207649_10303858 | |||
| 617 | Ga0207649_11325171 | |||
| 618 | Ga0207681_10180094 | |||
| 619 | Ga0207681_10458650 | |||
| 620 | Ga0207650_10067204 | |||
| 621 | Ga0207650_10214195 | |||
| 622 | Ga0207650_11278592 | |||
| 623 | Ga0207659_10158159 | |||
| 624 | Ga0207644_10207586 | |||
| 625 | Ga0207644_10276998 | |||
| 626 | Ga0207690_10147829 | |||
| 627 | Ga0207690_10513879 | |||
| 628 | Ga0207706_10001407 | |||
| 629 | Ga0207706_10051262 | |||
| 630 | Ga0207686_10235771 | |||
| 631 | Ga0207670_10100219 | |||
| 632 | Ga0207669_10134238 | |||
| 633 | Ga0207704_10126879 | |||
| 634 | Ga0207704_10436987 | |||
| 635 | Ga0207691_10036605 | |||
| 636 | Ga0207691_10036849 | |||
| 637 | Ga0207689_10010217 | |||
| 638 | Ga0207689_10030025 | |||
| 639 | Ga0207689_10100995 | |||
| 640 | Ga0207661_10009057 | |||
| 641 | Ga0207661_10359552 | |||
| 642 | Ga0207661_10382476 | |||
| 643 | Ga0207661_10432381 | |||
| 644 | Ga0207661_10640781 | |||
| 645 | Ga0207679_10001076 | |||
| 646 | Ga0207679_10199490 | |||
| 647 | Ga0207679_10217418 | |||
| 648 | Ga0207667_10598304 | |||
| 649 | Ga0207651_10013089 | |||
| 650 | Ga0207651_10374060 | |||
| 651 | Ga0207651_10639059 | |||
| 652 | Ga0207651_10727861 | |||
| 653 | Ga0207712_10002828 | |||
| 654 | Ga0207712_10275287 | |||
| 655 | Ga0207712_11073450 | |||
| 656 | Ga0207668_11317394 | |||
| 657 | Ga0207640_10104919 | |||
| 658 | Ga0207640_10618432 | |||
| 659 | Ga0207658_10107583 | |||
| 660 | Ga0207658_10385663 | |||
| 661 | Ga0207658_10846089 | |||
| 662 | Ga0207677_10036861 | |||
| 663 | Ga0207677_10120776 | |||
| 664 | Ga0207677_10233149 | |||
| 665 | Ga0207703_10278802 | |||
| 666 | Ga0207703_10487026 | |||
| 667 | Ga0207703_10920241 | |||
| 668 | Ga0207703_11168989 | |||
| 669 | Ga0207639_10407851 | |||
| 670 | Ga0207639_10663637 | |||
| 671 | Ga0207639_10867984 | |||
| 672 | Ga0207639_10977267 | |||
| 673 | Ga0207639_11203134 | |||
| 674 | Ga0207678_10992416 | |||
| 675 | Ga0207702_10744088 | |||
| 676 | Ga0207641_10090272 | |||
| 677 | Ga0207641_10587840 | |||
| 678 | Ga0207648_10004603 | |||
| 679 | Ga0207648_10055240 | |||
| 680 | Ga0207648_10055325 | |||
| 681 | Ga0207648_10236549 | |||
| 682 | Ga0207676_10001515 | |||
| 683 | Ga0207676_10041422 | |||
| 684 | Ga0207674_10074051 | |||
| 685 | Ga0207674_10424043 | |||
| 686 | Ga0207674_10424386 | |||
| 687 | Ga0207674_10546934 | |||
| 688 | Ga0207675_100346505 | |||
| 689 | Ga0207675_100664098 | |||
| 690 | Ga0207683_10006065 | |||
| 691 | Ga0207683_10017857 | |||
| 692 | Ga0207698_10023574 | |||
| 693 | Ga0268265_10128977 | |||
| 694 | Ga0268265_10433737 | |||
| 695 | Ga0268264_10225228 | |||
| 696 | Ga0268264_10496967 | |||
| 697 | Ga0307515_10065908 | |||
| 698 | Ga0265327_10023820 | |||
| 699 | Ga0265327_10490234 | |||
| 700 | Ga0307509_10494227 | |||
| 701 | Ga0316576_10089777 | |||
| 702 | Ga0307416_102493960 | |||
| 703 | Ga0307414_10044310 | |||
| 704 | Ga0307414_10149929 | |||
| 705 | Ga0307414_10252133 | |||
| 706 | Ga0307414_10268637 | |||
| 707 | Ga0307414_10487263 | |||
| 708 | Ga0307414_10759505 | |||
| 709 | Ga0307414_12052555 | |||
| 710 | Ga0307414_12132670 | |||
| 711 | Ga0307411_10061135 | |||
| 712 | Ga0307411_10429731 | |||
| 713 | Ga0373944_0179166 | |||
| 714 | Ga0373943_0139293 | |||
| 715 | Ga0373924_0016317 | |||
| 716 | Ga0373933_0485307 | |||
| 717 | Ga0373937_0013175 | |||
| 718 | Ga0436365_1251897 | |||
| 719 | Ga0451807_1263247 | |||
| 720 | Ga0466959_0101348 | |||
| 721 | Ga0451576_0000003 | |||
| 722 | Ga0495627_027473 | |||
| 723 | Ga0495592_0021970 | |||
| 724 | Ga0495590_0268399 | |||
| 725 | Ga0495650_0009451 | |||
| 726 | Ga0495580_0790264 | |||
| 727 | Ga0495639_0545933 | |||
| 728 | Ga0495664_0220655 | |||
| 729 | Ga0495608_0034250 | |||
| 730 | Ga0495618_0056205 | |||
| 731 | Ga0495628_0027525 | |||
| 732 | Ga0495630_0007976 | |||
| 733 | Ga0495630_0937682 | |||
| 734 | Ga0495652_0489840 | |||
| 735 | Ga0495586_0314416 | |||
| 736 | Ga0495598_0199636 | |||
| 737 | Ga0495621_0219763 | |||
| 738 | Ga0495645_0720990 | |||
| 739 | Ga0495667_0115916 | |||
| 740 | Ga0495669_0213503 | |||
| 741 | Ga0495613_0072913 | |||
| 742 | Ga0495624_0407735 | |||
| 743 | Ga0495670_0430206 | |||
| 744 | Ga0495604_0371884 | |||
| 745 | Ga0495674_0108767 | |||
| 746 | Ga0495680_0484937 | |||
| 747 | Ga0495675_0839047 | |||
| 748 | Ga0495684_0326785 | |||
| 749 | Ga0496100_0476166 | |||
| 750 | Ga0496100_1502203 | |||
| 751 | Ga0496106_1115593 | |||
| 752 | Ga0496114_0044387 | |||
| 753 | Ga0496126_0015308 | |||
| 754 | Ga0501032_0062321 | |||
| 755 | Ga0501034_0025155 | |||
| 756 | Ga0501036_0038784 | |||
| 757 | Ga0501037_0034451 | |||
| 758 | Ga0501043_0469357 | |||
| 759 | Ga0501235_152568 | |||
| 760 | Ga0501249_110912 | |||
| 761 | Ga0501253_073053 | |||
| 762 | Ga0501221_215358 | |||
| 763 | Ga0501080_0513561 | |||
| 764 | Ga0501035_0002418 | |||
| 765 | Ga0501044_0032748 | |||
| 766 | nmdc:mga0rr50_756436_c1 | |||
| 767 | Ga0495619_0112154 | |||
| 768 | Ga0500622_0000151 | |||
| 769 | 2522547716 | |||
| 770 | 2739644737 | |||
| 771 | 2819677379 | |||
| 772 | 2839992368 | |||
| 773 | 2852627577 | |||
| 774 | 2857628736 | |||
| 775 | 2881956203 | |||
| 776 | 2884797305 | |||
| 777 | 2902051262 | |||
| 778 | 8036738872 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vu9-assembly2.cif.gz_D | pholiota squarrosa lectin (phosl) in complex with fucose(alpha1-6)[glcnac(beta1-4)]glcnac | 0.7856 | 27 | 59 |
| 4hc5-assembly2.cif.gz_C | crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 | 0.7756 | 1 | 131 |
| 6fx2-assembly2.cif.gz_B | crystal structure of pholiota squarrosa lectin in complex with a decasaccharide | 0.7682 | 27 | 59 |
| 4hc5-assembly2.cif.gz_C | crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 | 0.7596 | 1 | 131 |
| 2p7l-assembly4.cif.gz_A | crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 | 0.7398 | 1 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8364 | 75 | 132 | 3.30.720.110 |
| af_A0A1X7YDR8_31_97_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7731 | 1 | 56 | 3.10.180.10 |
| 4hc5C00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.766 | 1 | 131 | 3.10.180.10 |
| 4hc5C00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7555 | 1 | 131 | 3.10.180.10 |
| af_I1JQG5_3_382_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7409 | 27 | 56 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2S5Y6-F1-model_v4 | Methylmalonyl-CoA epimerase | 0.9569 | 1 | 73 |
GO:0004493
GO:0046491 |
| AF-A0A3D2S5Y6-F1-model_v4 | Methylmalonyl-CoA epimerase | 0.9442 | 1 | 73 |
GO:0004493
GO:0046491 |
| AF-A0A519XW06-F1-model_v4 | Methylmalonyl-CoA epimerase | 0.9376 | 1 | 77 |
GO:0004493
GO:0046491 GO:0046872 |
| AF-A0A7W0SDR7-F1-model_v4 | Methylmalonyl Co-A mutase-associated GTPase MeaB | 0.9331 | 2 | 65 |
GO:0003924
GO:0005525 |
| AF-A0A7Y1XJW9-F1-model_v4 | Lactoylglutathione lyase | 0.923 | 2 | 74 |
GO:0016829
|