F431586

General Info

Members Datasets Scaffolds Average Seq Length
389 203 778 134

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_967847_c1|nmdc:mga08y16_967847_c1_278_700
Length 129
Sequence MLKIEHIGIAVRTLADSVPLFEMLLKSQCYKTELVESEKVNTAFFKTGDTGVISKFIDKKGEGLHHIAFEVEDIEAEMERLKNEGLILLNDKPKKGADNKLICFLHPKSTNGVLVELCQSIRTPSEEIK

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
187 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
195 2739367663 Pedobacter sp. YR510 Isolate Unclassified
196 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
197 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
198 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
199 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
200 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
201 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
202 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
203 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 1.29
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 34.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_967847_c1 3300050511 Bacteria 833
2 rootH1_10089393 3300003316 Bacteria 2675
3 rootL2_10181371 3300003322 Bacteria 2915
4 rootL2_10214863 3300003322 Bacteria 1499
5 Ga0055536_1013441 3300003781 Bacteria 2953
6 Ga0065165_1000226 3300005262 Bacteria 99005
7 Ga0065704_10273653 3300005289 Bacteria 937
8 Ga0070658_10857005 3300005327 Bacteria 790
9 Ga0070676_10039223 3300005328 Unclassified 2738
10 Ga0070676_10052427 3300005328 Unclassified 2398
11 Ga0070683_100644541 3300005329 Bacteria 1014
12 Ga0070683_100780535 3300005329 Unclassified 916
13 Ga0070683_100955880 3300005329 Bacteria 822
14 Ga0070683_101037108 3300005329 Unclassified 787
15 Ga0070690_100012114 3300005330 Bacteria 5067
16 Ga0070670_100023205 3300005331 Bacteria 5339
17 Ga0070670_100087914 3300005331 Unclassified 2671
18 Ga0070670_100710524 3300005331 Bacteria 904
19 Ga0070677_10222177 3300005333 Bacteria 923
20 Ga0070677_10441070 3300005333 Unclassified 694
21 Ga0068869_100003022 3300005334 Bacteria 10225
22 Ga0068869_100013383 3300005334 Bacteria 5456
23 Ga0068869_100087332 3300005334 Bacteria 2339
24 Ga0070666_10111304 3300005335 Unclassified 1894
25 Ga0070682_100376591 3300005337 Bacteria 1066
26 Ga0068868_100044266 3300005338 Bacteria 3480
27 Ga0068868_100093666 3300005338 Viruses 2422
28 Ga0068868_100101174 3300005338 Unclassified 2332
29 Ga0068868_100200747 3300005338 Unclassified 1662
30 Ga0070689_100031358 3300005340 Bacteria 4038
31 Ga0070691_10206990 3300005341 Unclassified 1033
32 Ga0070691_10477062 3300005341 Bacteria 717
33 Ga0070661_100739841 3300005344 Bacteria 803
34 Ga0070668_100181093 3300005347 Viruses 1721
35 Ga0070668_100455037 3300005347 Unclassified 1101
36 Ga0070675_100202741 3300005354 Unclassified 1722
37 Ga0070675_100284432 3300005354 Unclassified 1454
38 Ga0070671_100028674 3300005355 Unclassified 4586
39 Ga0070671_100304921 3300005355 Unclassified 1356
40 Ga0070671_101313965 3300005355 Unclassified 638
41 Ga0070674_100016004 3300005356 Unclassified 4696
42 Ga0070673_100008486 3300005364 Bacteria 6833
43 Ga0070673_100555009 3300005364 Unclassified 1044
44 Ga0070688_100023626 3300005365 Bacteria 3617
45 Ga0070688_100092541 3300005365 Unclassified 1978
46 Ga0070688_100752707 3300005365 Bacteria 758
47 Ga0070659_100008369 3300005366 Bacteria 7555
48 Ga0070659_100832866 3300005366 Unclassified 803
49 Ga0070667_100424708 3300005367 Unclassified 1212
50 Ga0070667_100490662 3300005367 Bacteria 1125
51 Ga0070700_100974775 3300005441 Bacteria 695
52 Ga0070700_101494783 3300005441 Bacteria 574
53 Ga0070678_100004456 3300005456 Bacteria 7947
54 Ga0070678_100009387 3300005456 Bacteria 5924
55 Ga0070678_101062106 3300005456 Bacteria 746
56 Ga0070662_100029753 3300005457 Unclassified 3814
57 Ga0070662_100102265 3300005457 Bacteria 2171
58 Ga0070662_100110031 3300005457 Unclassified 2097
59 Ga0070662_100213462 3300005457 Unclassified 1537
60 Ga0068867_100060305 3300005459 Bacteria 2814
61 Ga0068867_100160277 3300005459 Unclassified 1774
62 Ga0068867_100191598 3300005459 Bacteria 1632
63 Ga0068867_100583370 3300005459 Bacteria 973
64 Ga0070685_10098356 3300005466 Unclassified 1783
65 Ga0070684_100290240 3300005535 Unclassified 1500
66 Ga0070684_100366411 3300005535 Bacteria 1326
67 Ga0070684_100419647 3300005535 Bacteria 1235
68 Ga0068853_100287263 3300005539 Unclassified 1517
69 Ga0068853_100482874 3300005539 Unclassified 1168
70 Ga0068853_101120137 3300005539 Bacteria 759
71 Ga0068853_101476797 3300005539 Bacteria 658
72 Ga0070672_100036847 3300005543 Bacteria 3729
73 Ga0070672_100178508 3300005543 Archaea 1769
74 Ga0070672_100912313 3300005543 Unclassified 776
75 Ga0070686_100053728 3300005544 Unclassified 2574
76 Ga0070686_100085604 3300005544 Unclassified 2097
77 Ga0070693_100349847 3300005547 Unclassified 1011
78 Ga0070665_100026863 3300005548 Bacteria 5798
79 Ga0070665_100158174 3300005548 Bacteria 2268
80 Ga0068855_101395681 3300005563 Unclassified 722
81 Ga0070664_100072791 3300005564 Unclassified 2947
82 Ga0070664_100119348 3300005564 Unclassified 2308
83 Ga0070664_100672675 3300005564 Bacteria 963
84 Ga0068857_100048266 3300005577 Bacteria 3780
85 Ga0068857_100057192 3300005577 Bacteria 3461
86 Ga0068854_100236351 3300005578 Unclassified 1453
87 Ga0068854_100492648 3300005578 Unclassified 1031
88 Ga0068854_101694996 3300005578 Bacteria 578
89 Ga0068856_100302116 3300005614 Bacteria 1618
90 Ga0068856_100822665 3300005614 Bacteria 948
91 Ga0070702_100275197 3300005615 Unclassified 1153
92 Ga0068852_100133938 3300005616 Unclassified 2285
93 Ga0068852_100411083 3300005616 Bacteria 1333
94 Ga0068852_100998230 3300005616 Bacteria 856
95 Ga0068859_100035079 3300005617 Bacteria 5032
96 Ga0068859_100253456 3300005617 Bacteria 1850
97 Ga0068859_100628328 3300005617 Unclassified 1166
98 Ga0068859_101149745 3300005617 Unclassified 854
99 Ga0068864_100066651 3300005618 Bacteria 3125
100 Ga0068864_100143665 3300005618 Bacteria 2155
101 Ga0068866_10024145 3300005718 Bacteria 2837
102 Ga0068866_10218569 3300005718 Unclassified 1148
103 Ga0068866_10742269 3300005718 Unclassified 677
104 Ga0068861_100210661 3300005719 Unclassified 1637
105 Ga0068851_10419243 3300005834 Unclassified 790
106 Ga0068870_10045623 3300005840 Bacteria 2295
107 Ga0068870_10134417 3300005840 Unclassified 1440
108 Ga0068870_10765192 3300005840 Bacteria 672
109 Ga0068863_100129098 3300005841 Bacteria 2413
110 Ga0068863_100155119 3300005841 Bacteria 2192
111 Ga0068858_100394891 3300005842 Archaea 1328
112 Ga0068858_101747055 3300005842 Bacteria 614
113 Ga0068858_101940387 3300005842 Unclassified 582
114 Ga0068860_100443069 3300005843 Unclassified 1290
115 Ga0068860_100472590 3300005843 Bacteria 1249
116 Ga0068862_100278093 3300005844 Bacteria 1533
117 Ga0097621_100183907 3300006237 Unclassified 1807
118 Ga0097621_100550107 3300006237 Unclassified 1050
119 Ga0068871_100317234 3300006358 Bacteria 1371
120 Ga0068871_100326908 3300006358 Bacteria 1352
121 Ga0068865_100067473 3300006881 Bacteria 2527
122 Ga0068865_100166361 3300006881 Bacteria 1687
123 Ga0068865_100322817 3300006881 Unclassified 1242
124 Ga0068865_100581626 3300006881 Unclassified 944
125 Ga0097620_100035080 3300006931 Bacteria 5032
126 Ga0097620_100253463 3300006931 Bacteria 1850
127 Ga0097620_100628282 3300006931 Unclassified 1166
128 Ga0097620_101149975 3300006931 Unclassified 854
129 Ga0105240_10179786 3300009093 Bacteria 2497
130 Ga0105240_10463930 3300009093 Unclassified 1415
131 Ga0111539_11333247 3300009094 Bacteria 833
132 Ga0105247_10305030 3300009101 Bacteria 1106
133 Ga0105241_10104565 3300009174 Unclassified 2256
134 Ga0105241_10539771 3300009174 Unclassified 1045
135 Ga0105242_10079974 3300009176 Bacteria 2731
136 Ga0105242_10105250 3300009176 Unclassified 2396
137 Ga0105242_10109086 3300009176 Unclassified 2356
138 Ga0105242_10353957 3300009176 Bacteria 1357
139 Ga0105242_11074326 3300009176 Bacteria 817
140 Ga0105248_10354849 3300009177 Bacteria 1651
141 Ga0105248_10601455 3300009177 Unclassified 1241
142 Ga0105248_10776157 3300009177 Bacteria 1081
143 Ga0105248_10800682 3300009177 Bacteria 1064
144 Ga0105249_10001887 3300009553 Bacteria 18138
145 Ga0105249_10234517 3300009553 Bacteria 1811
146 Ga0105239_10028027 3300010375 Bacteria 6198
147 Ga0105239_10825533 3300010375 Unclassified 1062
148 Ga0105246_10074145 3300011119 Unclassified 2405
149 Ga0105246_10912980 3300011119 Bacteria 788
150 Ga0157373_10877660 3300013100 Bacteria 665
151 Ga0157371_10001213 3300013102 Bacteria 27466
152 Ga0157371_10115562 3300013102 Bacteria 1906
153 Ga0157371_10151585 3300013102 Bacteria 1654
154 Ga0157370_10043964 3300013104 Bacteria 4297
155 Ga0157370_10155240 3300013104 Bacteria 2129
156 Ga0157370_10351484 3300013104 Bacteria 1359
157 Ga0157369_10124437 3300013105 Bacteria 2735
158 Ga0157369_10152586 3300013105 Bacteria 2441
159 Ga0157369_10388677 3300013105 Unclassified 1448
160 Ga0157369_11519571 3300013105 Bacteria 681
161 Ga0157369_11884231 3300013105 Bacteria 607
162 Ga0157374_10001762 3300013296 Bacteria 18209
163 Ga0157374_10018577 3300013296 Bacteria 6139
164 Ga0157374_10067378 3300013296 Bacteria 3365
165 Ga0157374_10140158 3300013296 Viruses 2347
166 Ga0157374_10465342 3300013296 Unclassified 1266
167 Ga0157378_10071803 3300013297 Unclassified 3109
168 Ga0157378_10292561 3300013297 Bacteria 1574
169 Ga0163162_10001667 3300013306 Bacteria 20841
170 Ga0163162_10162157 3300013306 Bacteria 2358
171 Ga0163162_10331696 3300013306 Bacteria 1654
172 Ga0163162_11048520 3300013306 Bacteria 923
173 Ga0157372_10005711 3300013307 Bacteria 13244
174 Ga0157372_10045873 3300013307 Bacteria 4850
175 Ga0157372_10048744 3300013307 Unclassified 4708
176 Ga0157372_10273706 3300013307 Bacteria 1962
177 Ga0157375_10007784 3300013308 Bacteria 9374
178 Ga0157375_10159706 3300013308 Bacteria 2395
179 Ga0157375_10224555 3300013308 Unclassified 2037
180 Ga0157375_10612172 3300013308 Unclassified 1248
181 Ga0163163_10000469 3300014325 Bacteria 36859
182 Ga0163163_10076447 3300014325 Bacteria 3343
183 Ga0163163_11237660 3300014325 Bacteria 809
184 Ga0157380_10879007 3300014326 Unclassified 920
185 Ga0157380_10925283 3300014326 Unclassified 900
186 Ga0157380_12832142 3300014326 Unclassified 551
187 Ga0157377_10053114 3300014745 Unclassified 2290
188 Ga0157377_10104283 3300014745 Bacteria 1695
189 Ga0157377_10386766 3300014745 Bacteria 949
190 Ga0157377_11482544 3300014745 Unclassified 538
191 Ga0157379_10037332 3300014968 Bacteria 4331
192 Ga0157379_10258255 3300014968 Bacteria 1583
193 Ga0157379_10627692 3300014968 Bacteria 1005
194 Ga0157379_11701822 3300014968 Unclassified 618
195 Ga0157376_10046187 3300014969 Bacteria 3590
196 Ga0157376_10467087 3300014969 Bacteria 1234
197 Ga0157376_11807919 3300014969 Unclassified 647
198 Ga0163161_10012604 3300017792 Bacteria 5874
199 Ga0163161_10015717 3300017792 Bacteria 5278
200 Ga0163161_10058469 3300017792 Bacteria 2802
201 Ga0163161_10192491 3300017792 Bacteria 1569
202 Ga0163161_10309307 3300017792 Bacteria 1246
203 Ga0163161_10403675 3300017792 Bacteria 1096
204 Ga0163161_10472782 3300017792 Unclassified 1016
205 Ga0163161_11032322 3300017792 Bacteria 703
206 Ga0213876_10004339 3300021384 Bacteria 7945
207 Ga0209676_1001032 3300025292 Bacteria 32333
208 Ga0207426_1136854 3300025302 Unclassified 587
209 Ga0207697_10022545 3300025315 Unclassified 2580
210 Ga0207682_10558315 3300025893 Bacteria 541
211 Ga0207642_10006766 3300025899 Bacteria 3833
212 Ga0207642_10352561 3300025899 Unclassified 868
213 Ga0207710_10396216 3300025900 Unclassified 708
214 Ga0207680_10201950 3300025903 Archaea 1355
215 Ga0207647_10041865 3300025904 Bacteria 2877
216 Ga0207647_10058300 3300025904 Unclassified 2365
217 Ga0207685_10722075 3300025905 Bacteria 544
218 Ga0207645_10016913 3300025907 Bacteria 4819
219 Ga0207645_10035131 3300025907 Unclassified 3218
220 Ga0207645_10297173 3300025907 Bacteria 1075
221 Ga0207643_10061736 3300025908 Unclassified 2141
222 Ga0207643_10144214 3300025908 Unclassified 1424
223 Ga0207643_10306916 3300025908 Unclassified 988
224 Ga0207654_10150519 3300025911 Bacteria 1493
225 Ga0207695_10398457 3300025913 Unclassified 1261
226 Ga0207649_10224567 3300025920 Unclassified 1340
227 Ga0207649_10303858 3300025920 Bacteria 1167
228 Ga0207649_11325171 3300025920 Bacteria 569
229 Ga0207681_10180094 3300025923 Unclassified 1609
230 Ga0207681_10458650 3300025923 Unclassified 1038
231 Ga0207650_10067204 3300025925 Bacteria 2690
232 Ga0207650_10214195 3300025925 Bacteria 1548
233 Ga0207650_11278592 3300025925 Unclassified 624
234 Ga0207659_10158159 3300025926 Unclassified 1776
235 Ga0207644_10207586 3300025931 Unclassified 1547
236 Ga0207644_10276998 3300025931 Unclassified 1346
237 Ga0207690_10147829 3300025932 Bacteria 1739
238 Ga0207690_10513879 3300025932 Unclassified 970
239 Ga0207706_10001407 3300025933 Bacteria 24074
240 Ga0207706_10051262 3300025933 Unclassified 3644
241 Ga0207686_10235771 3300025934 Unclassified 1329
242 Ga0207670_10100219 3300025936 Bacteria 2068
243 Ga0207669_10134238 3300025937 Bacteria 1706
244 Ga0207704_10126879 3300025938 Unclassified 1758
245 Ga0207704_10436987 3300025938 Unclassified 1041
246 Ga0207691_10036605 3300025940 Bacteria 4547
247 Ga0207691_10036849 3300025940 Unclassified 4530
248 Ga0207689_10010217 3300025942 Bacteria 8086
249 Ga0207689_10030025 3300025942 Unclassified 4532
250 Ga0207689_10100995 3300025942 Bacteria 2369
251 Ga0207661_10009057 3300025944 Bacteria 7134
252 Ga0207661_10359552 3300025944 Bacteria 1315
253 Ga0207661_10382476 3300025944 Unclassified 1274
254 Ga0207661_10432381 3300025944 Bacteria 1197
255 Ga0207661_10640781 3300025944 Bacteria 976
256 Ga0207679_10001076 3300025945 Bacteria 17378
257 Ga0207679_10199490 3300025945 Unclassified 1670
258 Ga0207679_10217418 3300025945 Unclassified 1606
259 Ga0207667_10598304 3300025949 Unclassified 1112
260 Ga0207651_10013089 3300025960 Bacteria 4731
261 Ga0207651_10374060 3300025960 Unclassified 1206
262 Ga0207651_10639059 3300025960 Bacteria 933
263 Ga0207651_10727861 3300025960 Bacteria 876
264 Ga0207712_10002828 3300025961 Bacteria 11120
265 Ga0207712_10275287 3300025961 Bacteria 1371
266 Ga0207712_11073450 3300025961 Bacteria 716
267 Ga0207668_11317394 3300025972 Unclassified 650
268 Ga0207640_10104919 3300025981 Unclassified 1990
269 Ga0207640_10618432 3300025981 Archaea 919
270 Ga0207658_10107583 3300025986 Unclassified 2198
271 Ga0207658_10385663 3300025986 Bacteria 1228
272 Ga0207658_10846089 3300025986 Unclassified 832
273 Ga0207677_10036861 3300026023 Bacteria 3191
274 Ga0207677_10120776 3300026023 Bacteria 1971
275 Ga0207677_10233149 3300026023 Unclassified 1484
276 Ga0207703_10278802 3300026035 Archaea 1517
277 Ga0207703_10487026 3300026035 Unclassified 1156
278 Ga0207703_10920241 3300026035 Bacteria 837
279 Ga0207703_11168989 3300026035 Unclassified 739
280 Ga0207639_10407851 3300026041 Unclassified 1226
281 Ga0207639_10663637 3300026041 Archaea 965
282 Ga0207639_10867984 3300026041 Bacteria 843
283 Ga0207639_10977267 3300026041 Bacteria 793
284 Ga0207639_11203134 3300026041 Unclassified 711
285 Ga0207678_10992416 3300026067 Bacteria 743
286 Ga0207702_10744088 3300026078 Bacteria 968
287 Ga0207641_10090272 3300026088 Bacteria 2679
288 Ga0207641_10587840 3300026088 Unclassified 1089
289 Ga0207648_10004603 3300026089 Bacteria 14142
290 Ga0207648_10055240 3300026089 Unclassified 3467
291 Ga0207648_10055325 3300026089 Bacteria 3464
292 Ga0207648_10236549 3300026089 Bacteria 1626
293 Ga0207676_10001515 3300026095 Bacteria 17151
294 Ga0207676_10041422 3300026095 Bacteria 3535
295 Ga0207674_10074051 3300026116 Bacteria 3418
296 Ga0207674_10424043 3300026116 Bacteria 1285
297 Ga0207674_10424386 3300026116 Unclassified 1285
298 Ga0207674_10546934 3300026116 Archaea 1118
299 Ga0207675_100346505 3300026118 Bacteria 1455
300 Ga0207675_100664098 3300026118 Unclassified 1049
301 Ga0207683_10006065 3300026121 Bacteria 10348
302 Ga0207683_10017857 3300026121 Bacteria 6050
303 Ga0207698_10023574 3300026142 Unclassified 4302
304 Ga0268265_10128977 3300028380 Unclassified 2098
305 Ga0268265_10433737 3300028380 Unclassified 1223
306 Ga0268264_10225228 3300028381 Bacteria 1728
307 Ga0268264_10496967 3300028381 Archaea 1189
308 Ga0307515_10065908 3300028794 Bacteria 5028
309 Ga0265327_10023820 3300031251 Bacteria 3613
310 Ga0265327_10490234 3300031251 Unclassified 530
311 Ga0307509_10494227 3300031507 Bacteria 909
312 Ga0316576_10089777 3300031727 Bacteria 2289
313 Ga0307416_102493960 3300032002 Bacteria 616
314 Ga0307414_10044310 3300032004 Bacteria 3037
315 Ga0307414_10149929 3300032004 Bacteria 1838
316 Ga0307414_10252133 3300032004 Bacteria 1468
317 Ga0307414_10268637 3300032004 Bacteria 1427
318 Ga0307414_10487263 3300032004 Bacteria 1088
319 Ga0307414_10759505 3300032004 Bacteria 882
320 Ga0307414_12052555 3300032004 Bacteria 534
321 Ga0307414_12132670 3300032004 Bacteria 523
322 Ga0307411_10061135 3300032005 Bacteria 2506
323 Ga0307411_10429731 3300032005 Bacteria 1099
324 Ga0373944_0179166 3300035089 Bacteria 759
325 Ga0373943_0139293 3300035170 Bacteria 1306
326 Ga0373924_0016317 3300035410 Bacteria 2834
327 Ga0373933_0485307 3300035724 Bacteria 809
328 Ga0373937_0013175 3300036401 Bacteria 7281
329 Ga0436365_1251897 3300039437 Bacteria 24739
330 Ga0451807_1263247 3300041486 Unclassified 540
331 Ga0466959_0101348 3300045049 Bacteria 2061
332 Ga0451576_0000003 3300045051 Bacteria 1550573
333 Ga0495627_027473 3300046453 Bacteria 1825
334 Ga0495592_0021970 3300046454 Bacteria 4856
335 Ga0495590_0268399 3300046457 Bacteria 637
336 Ga0495650_0009451 3300046471 Bacteria 5540
337 Ga0495580_0790264 3300046472 Bacteria 616
338 Ga0495639_0545933 3300046475 Unclassified 594
339 Ga0495664_0220655 3300046477 Bacteria 1148
340 Ga0495608_0034250 3300046511 Bacteria 3429
341 Ga0495618_0056205 3300046514 Bacteria 2492
342 Ga0495628_0027525 3300046516 Bacteria 4625
343 Ga0495630_0007976 3300046517 Bacteria 7601
344 Ga0495630_0937682 3300046517 Unclassified 659
345 Ga0495652_0489840 3300046529 Bacteria 854
346 Ga0495586_0314416 3300046535 Bacteria 898
347 Ga0495598_0199636 3300046537 Bacteria 722
348 Ga0495621_0219763 3300046539 Unclassified 769
349 Ga0495645_0720990 3300046543 Bacteria 604
350 Ga0495667_0115916 3300046559 Bacteria 1731
351 Ga0495669_0213503 3300046684 Unclassified 924
352 Ga0495613_0072913 3300046689 Bacteria 2503
353 Ga0495624_0407735 3300046690 Bacteria 816
354 Ga0495670_0430206 3300046691 Unclassified 714
355 Ga0495604_0371884 3300047317 Unclassified 946
356 Ga0495674_0108767 3300047319 Bacteria 2352
357 Ga0495680_0484937 3300047322 Unclassified 841
358 Ga0495675_0839047 3300047444 Bacteria 506
359 Ga0495684_0326785 3300047471 Bacteria 1095
360 Ga0496100_0476166 3300048903 Bacteria 960
361 Ga0496100_1502203 3300048903 Bacteria 532
362 Ga0496106_1115593 3300048909 Unclassified 618
363 Ga0496114_0044387 3300048917 Unclassified 3688
364 Ga0496126_0015308 3300048929 Bacteria 7719
365 Ga0501032_0062321 3300049569 Bacteria 2499
366 Ga0501034_0025155 3300049571 Bacteria 6059
367 Ga0501036_0038784 3300049572 Bacteria 4033
368 Ga0501037_0034451 3300049573 Bacteria 3736
369 Ga0501043_0469357 3300049579 Bacteria 943
370 Ga0501235_152568 3300049669 Bacteria 599
371 Ga0501249_110912 3300049679 Bacteria 663
372 Ga0501253_073053 3300049683 Bacteria 761
373 Ga0501221_215358 3300049704 Bacteria 539
374 Ga0501080_0513561 3300049742 Bacteria 1070
375 Ga0501035_0002418 3300049822 Bacteria 18265
376 Ga0501044_0032748 3300049823 Bacteria 5463
377 nmdc:mga0rr50_756436_c1 3300050513 Bacteria 829
378 Ga0495619_0112154 3300053085 Bacteria 1864
379 Ga0500622_0000151 3300053156 Bacteria 73392
380 2522547716 2522125168 Bacteria 7376607
381 2739644737 2739367663 Bacteria 5040914
382 2819677379 2818991460 Bacteria 7595395
383 2839992368 2839989709 Bacteria 3773432
384 2852627577 2852627209 Bacteria 5896285
385 2857628736 2857627736 Bacteria 5625397
386 2881956203 2881955468 Bacteria 3545609
387 2884797305 2884791551 Bacteria 8511252
388 2902051262 2902048731 Bacteria 4976191
389 8036738872 8036736890 Bacteria 2944828
390 nmdc:mga08y16_967847_c1
391 rootH1_10089393
392 rootL2_10181371
393 rootL2_10214863
394 Ga0055536_1013441
395 Ga0065165_1000226
396 Ga0065704_10273653
397 Ga0070658_10857005
398 Ga0070676_10039223
399 Ga0070676_10052427
400 Ga0070683_100644541
401 Ga0070683_100780535
402 Ga0070683_100955880
403 Ga0070683_101037108
404 Ga0070690_100012114
405 Ga0070670_100023205
406 Ga0070670_100087914
407 Ga0070670_100710524
408 Ga0070677_10222177
409 Ga0070677_10441070
410 Ga0068869_100003022
411 Ga0068869_100013383
412 Ga0068869_100087332
413 Ga0070666_10111304
414 Ga0070682_100376591
415 Ga0068868_100044266
416 Ga0068868_100093666
417 Ga0068868_100101174
418 Ga0068868_100200747
419 Ga0070689_100031358
420 Ga0070691_10206990
421 Ga0070691_10477062
422 Ga0070661_100739841
423 Ga0070668_100181093
424 Ga0070668_100455037
425 Ga0070675_100202741
426 Ga0070675_100284432
427 Ga0070671_100028674
428 Ga0070671_100304921
429 Ga0070671_101313965
430 Ga0070674_100016004
431 Ga0070673_100008486
432 Ga0070673_100555009
433 Ga0070688_100023626
434 Ga0070688_100092541
435 Ga0070688_100752707
436 Ga0070659_100008369
437 Ga0070659_100832866
438 Ga0070667_100424708
439 Ga0070667_100490662
440 Ga0070700_100974775
441 Ga0070700_101494783
442 Ga0070678_100004456
443 Ga0070678_100009387
444 Ga0070678_101062106
445 Ga0070662_100029753
446 Ga0070662_100102265
447 Ga0070662_100110031
448 Ga0070662_100213462
449 Ga0068867_100060305
450 Ga0068867_100160277
451 Ga0068867_100191598
452 Ga0068867_100583370
453 Ga0070685_10098356
454 Ga0070684_100290240
455 Ga0070684_100366411
456 Ga0070684_100419647
457 Ga0068853_100287263
458 Ga0068853_100482874
459 Ga0068853_101120137
460 Ga0068853_101476797
461 Ga0070672_100036847
462 Ga0070672_100178508
463 Ga0070672_100912313
464 Ga0070686_100053728
465 Ga0070686_100085604
466 Ga0070693_100349847
467 Ga0070665_100026863
468 Ga0070665_100158174
469 Ga0068855_101395681
470 Ga0070664_100072791
471 Ga0070664_100119348
472 Ga0070664_100672675
473 Ga0068857_100048266
474 Ga0068857_100057192
475 Ga0068854_100236351
476 Ga0068854_100492648
477 Ga0068854_101694996
478 Ga0068856_100302116
479 Ga0068856_100822665
480 Ga0070702_100275197
481 Ga0068852_100133938
482 Ga0068852_100411083
483 Ga0068852_100998230
484 Ga0068859_100035079
485 Ga0068859_100253456
486 Ga0068859_100628328
487 Ga0068859_101149745
488 Ga0068864_100066651
489 Ga0068864_100143665
490 Ga0068866_10024145
491 Ga0068866_10218569
492 Ga0068866_10742269
493 Ga0068861_100210661
494 Ga0068851_10419243
495 Ga0068870_10045623
496 Ga0068870_10134417
497 Ga0068870_10765192
498 Ga0068863_100129098
499 Ga0068863_100155119
500 Ga0068858_100394891
501 Ga0068858_101747055
502 Ga0068858_101940387
503 Ga0068860_100443069
504 Ga0068860_100472590
505 Ga0068862_100278093
506 Ga0097621_100183907
507 Ga0097621_100550107
508 Ga0068871_100317234
509 Ga0068871_100326908
510 Ga0068865_100067473
511 Ga0068865_100166361
512 Ga0068865_100322817
513 Ga0068865_100581626
514 Ga0097620_100035080
515 Ga0097620_100253463
516 Ga0097620_100628282
517 Ga0097620_101149975
518 Ga0105240_10179786
519 Ga0105240_10463930
520 Ga0111539_11333247
521 Ga0105247_10305030
522 Ga0105241_10104565
523 Ga0105241_10539771
524 Ga0105242_10079974
525 Ga0105242_10105250
526 Ga0105242_10109086
527 Ga0105242_10353957
528 Ga0105242_11074326
529 Ga0105248_10354849
530 Ga0105248_10601455
531 Ga0105248_10776157
532 Ga0105248_10800682
533 Ga0105249_10001887
534 Ga0105249_10234517
535 Ga0105239_10028027
536 Ga0105239_10825533
537 Ga0105246_10074145
538 Ga0105246_10912980
539 Ga0157373_10877660
540 Ga0157371_10001213
541 Ga0157371_10115562
542 Ga0157371_10151585
543 Ga0157370_10043964
544 Ga0157370_10155240
545 Ga0157370_10351484
546 Ga0157369_10124437
547 Ga0157369_10152586
548 Ga0157369_10388677
549 Ga0157369_11519571
550 Ga0157369_11884231
551 Ga0157374_10001762
552 Ga0157374_10018577
553 Ga0157374_10067378
554 Ga0157374_10140158
555 Ga0157374_10465342
556 Ga0157378_10071803
557 Ga0157378_10292561
558 Ga0163162_10001667
559 Ga0163162_10162157
560 Ga0163162_10331696
561 Ga0163162_11048520
562 Ga0157372_10005711
563 Ga0157372_10045873
564 Ga0157372_10048744
565 Ga0157372_10273706
566 Ga0157375_10007784
567 Ga0157375_10159706
568 Ga0157375_10224555
569 Ga0157375_10612172
570 Ga0163163_10000469
571 Ga0163163_10076447
572 Ga0163163_11237660
573 Ga0157380_10879007
574 Ga0157380_10925283
575 Ga0157380_12832142
576 Ga0157377_10053114
577 Ga0157377_10104283
578 Ga0157377_10386766
579 Ga0157377_11482544
580 Ga0157379_10037332
581 Ga0157379_10258255
582 Ga0157379_10627692
583 Ga0157379_11701822
584 Ga0157376_10046187
585 Ga0157376_10467087
586 Ga0157376_11807919
587 Ga0163161_10012604
588 Ga0163161_10015717
589 Ga0163161_10058469
590 Ga0163161_10192491
591 Ga0163161_10309307
592 Ga0163161_10403675
593 Ga0163161_10472782
594 Ga0163161_11032322
595 Ga0213876_10004339
596 Ga0209676_1001032
597 Ga0207426_1136854
598 Ga0207697_10022545
599 Ga0207682_10558315
600 Ga0207642_10006766
601 Ga0207642_10352561
602 Ga0207710_10396216
603 Ga0207680_10201950
604 Ga0207647_10041865
605 Ga0207647_10058300
606 Ga0207685_10722075
607 Ga0207645_10016913
608 Ga0207645_10035131
609 Ga0207645_10297173
610 Ga0207643_10061736
611 Ga0207643_10144214
612 Ga0207643_10306916
613 Ga0207654_10150519
614 Ga0207695_10398457
615 Ga0207649_10224567
616 Ga0207649_10303858
617 Ga0207649_11325171
618 Ga0207681_10180094
619 Ga0207681_10458650
620 Ga0207650_10067204
621 Ga0207650_10214195
622 Ga0207650_11278592
623 Ga0207659_10158159
624 Ga0207644_10207586
625 Ga0207644_10276998
626 Ga0207690_10147829
627 Ga0207690_10513879
628 Ga0207706_10001407
629 Ga0207706_10051262
630 Ga0207686_10235771
631 Ga0207670_10100219
632 Ga0207669_10134238
633 Ga0207704_10126879
634 Ga0207704_10436987
635 Ga0207691_10036605
636 Ga0207691_10036849
637 Ga0207689_10010217
638 Ga0207689_10030025
639 Ga0207689_10100995
640 Ga0207661_10009057
641 Ga0207661_10359552
642 Ga0207661_10382476
643 Ga0207661_10432381
644 Ga0207661_10640781
645 Ga0207679_10001076
646 Ga0207679_10199490
647 Ga0207679_10217418
648 Ga0207667_10598304
649 Ga0207651_10013089
650 Ga0207651_10374060
651 Ga0207651_10639059
652 Ga0207651_10727861
653 Ga0207712_10002828
654 Ga0207712_10275287
655 Ga0207712_11073450
656 Ga0207668_11317394
657 Ga0207640_10104919
658 Ga0207640_10618432
659 Ga0207658_10107583
660 Ga0207658_10385663
661 Ga0207658_10846089
662 Ga0207677_10036861
663 Ga0207677_10120776
664 Ga0207677_10233149
665 Ga0207703_10278802
666 Ga0207703_10487026
667 Ga0207703_10920241
668 Ga0207703_11168989
669 Ga0207639_10407851
670 Ga0207639_10663637
671 Ga0207639_10867984
672 Ga0207639_10977267
673 Ga0207639_11203134
674 Ga0207678_10992416
675 Ga0207702_10744088
676 Ga0207641_10090272
677 Ga0207641_10587840
678 Ga0207648_10004603
679 Ga0207648_10055240
680 Ga0207648_10055325
681 Ga0207648_10236549
682 Ga0207676_10001515
683 Ga0207676_10041422
684 Ga0207674_10074051
685 Ga0207674_10424043
686 Ga0207674_10424386
687 Ga0207674_10546934
688 Ga0207675_100346505
689 Ga0207675_100664098
690 Ga0207683_10006065
691 Ga0207683_10017857
692 Ga0207698_10023574
693 Ga0268265_10128977
694 Ga0268265_10433737
695 Ga0268264_10225228
696 Ga0268264_10496967
697 Ga0307515_10065908
698 Ga0265327_10023820
699 Ga0265327_10490234
700 Ga0307509_10494227
701 Ga0316576_10089777
702 Ga0307416_102493960
703 Ga0307414_10044310
704 Ga0307414_10149929
705 Ga0307414_10252133
706 Ga0307414_10268637
707 Ga0307414_10487263
708 Ga0307414_10759505
709 Ga0307414_12052555
710 Ga0307414_12132670
711 Ga0307411_10061135
712 Ga0307411_10429731
713 Ga0373944_0179166
714 Ga0373943_0139293
715 Ga0373924_0016317
716 Ga0373933_0485307
717 Ga0373937_0013175
718 Ga0436365_1251897
719 Ga0451807_1263247
720 Ga0466959_0101348
721 Ga0451576_0000003
722 Ga0495627_027473
723 Ga0495592_0021970
724 Ga0495590_0268399
725 Ga0495650_0009451
726 Ga0495580_0790264
727 Ga0495639_0545933
728 Ga0495664_0220655
729 Ga0495608_0034250
730 Ga0495618_0056205
731 Ga0495628_0027525
732 Ga0495630_0007976
733 Ga0495630_0937682
734 Ga0495652_0489840
735 Ga0495586_0314416
736 Ga0495598_0199636
737 Ga0495621_0219763
738 Ga0495645_0720990
739 Ga0495667_0115916
740 Ga0495669_0213503
741 Ga0495613_0072913
742 Ga0495624_0407735
743 Ga0495670_0430206
744 Ga0495604_0371884
745 Ga0495674_0108767
746 Ga0495680_0484937
747 Ga0495675_0839047
748 Ga0495684_0326785
749 Ga0496100_0476166
750 Ga0496100_1502203
751 Ga0496106_1115593
752 Ga0496114_0044387
753 Ga0496126_0015308
754 Ga0501032_0062321
755 Ga0501034_0025155
756 Ga0501036_0038784
757 Ga0501037_0034451
758 Ga0501043_0469357
759 Ga0501235_152568
760 Ga0501249_110912
761 Ga0501253_073053
762 Ga0501221_215358
763 Ga0501080_0513561
764 Ga0501035_0002418
765 Ga0501044_0032748
766 nmdc:mga0rr50_756436_c1
767 Ga0495619_0112154
768 Ga0500622_0000151
769 2522547716
770 2739644737
771 2819677379
772 2839992368
773 2852627577
774 2857628736
775 2881956203
776 2884797305
777 2902051262
778 8036738872

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

104

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

117

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vu9-assembly2.cif.gz_D pholiota squarrosa lectin (phosl) in complex with fucose(alpha1-6)[glcnac(beta1-4)]glcnac 0.7856 27 59
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.7756 1 131
6fx2-assembly2.cif.gz_B crystal structure of pholiota squarrosa lectin in complex with a decasaccharide 0.7682 27 59
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.7596 1 131
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.7398 1 128
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8364 75 132 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7731 1 56 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.766 1 131 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7555 1 131 3.10.180.10
af_I1JQG5_3_382_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7409 27 56 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3D2S5Y6-F1-model_v4 Methylmalonyl-CoA epimerase 0.9569 1 73 GO:0004493
GO:0046491
AF-A0A3D2S5Y6-F1-model_v4 Methylmalonyl-CoA epimerase 0.9442 1 73 GO:0004493
GO:0046491
AF-A0A519XW06-F1-model_v4 Methylmalonyl-CoA epimerase 0.9376 1 77 GO:0004493
GO:0046491
GO:0046872
AF-A0A7W0SDR7-F1-model_v4 Methylmalonyl Co-A mutase-associated GTPase MeaB 0.9331 2 65 GO:0003924
GO:0005525
AF-A0A7Y1XJW9-F1-model_v4 Lactoylglutathione lyase 0.923 2 74 GO:0016829

Map