F431514

General Info

Members Datasets Scaffolds Average Seq Length
389 295 314 185

Family's Representative Sequence

Representative Sequence 3300042156|Ga0439446_0082450|Ga0439446_0082450_224_775
Length 183
Sequence MAGWKAAELEWGRGPRVFEVFLEPTCPYSNKAFGKIKEVLSTVGEDKITVKVRLQSQPWHLYSGVIVRAILAASTLDNGREAAWRVMEAVAAHREEFEFDKHCTGSNRTATPNDIIARIERYSGITLAAFDIPNLDRAVKLHCRYARQNGVHVSPTFMIDGLVQSDMSSGDAVSVWAQRLADG

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
13 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
22 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
23 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
24 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
25 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
26 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
27 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
28 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
29 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
30 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
31 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
32 2791355261 Rhizobium sp. J15 Isolate Nodule
33 2791355267 Rhizobium sp. L18 Isolate Nodule
34 2802429633 Rhizobium anhuiense J3 Isolate Nodule
35 2802429634 Rhizobium anhuiense S10 Isolate Nodule
36 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
37 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
38 2802429637 Rhizobium anhuiense C15 Isolate Nodule
39 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
40 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
41 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
42 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
43 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
44 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
45 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
46 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
47 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
48 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
49 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
50 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
51 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
52 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
53 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
54 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
55 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
56 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
57 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
58 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
59 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
60 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
61 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
62 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
63 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
66 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
67 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
68 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
69 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
70 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
71 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
75 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
80 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
81 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
84 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
88 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
91 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
92 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
93 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
190 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
193 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
196 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
197 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
198 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
199 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
200 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
201 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
272 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
273 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
274 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
281 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
285 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
286 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
287 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
288 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
289 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
290 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
291 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
292 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
293 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
294 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
295 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.46
Metatranscriptomes 0.26
Isolates 19.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.08
Nodule 14.65
Rhizoplane 1.29
Rhizosphere 41.13
Stem 0
Stem Tuber 0
Unclassified 12.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000309 3300002737 Bacteria 43697
2 JGI25152J39213_1003471 3300002773 Bacteria 5365
3 JGI25150J39212_1013139 3300002774 Bacteria 1442
4 JGI25159J45721_1002575 3300002987 Bacteria 6796
5 JGI25165J46597_1000556 3300003214 Bacteria 33944
6 JGI25153J46596_10007888 3300003215 Bacteria 5167
7 JGI25153J46596_10020145 3300003215 Bacteria 2529
8 rootH2_10095716 3300003320 Bacteria 1917
9 rootL2_10071650 3300003322 Bacteria 3169
10 rootH1_10073901 3300003323 Bacteria 4315
11 JGI25160J50197_1001488 3300003354 Bacteria 11643
12 JGI25160J50197_1006235 3300003354 Bacteria 4848
13 JGI25161J50226_1002948 3300003374 Bacteria 4117
14 JGI25161J50226_1003348 3300003374 Bacteria 3702
15 Ga0055526_1003140 3300003771 Bacteria 10702
16 Ga0055526_1007570 3300003771 Bacteria 5608
17 Ga0055524_1008281 3300003775 Bacteria 4332
18 Ga0055528_1001174 3300003790 Bacteria 16948
19 Ga0055528_1008686 3300003790 Bacteria 4316
20 Ga0055528_1017188 3300003790 Bacteria 2519
21 Ga0055528_1043316 3300003790 Bacteria 981
22 Ga0055540_1000324 3300003792 Bacteria 41825
23 Ga0055540_1010450 3300003792 Bacteria 3088
24 Ga0055540_1032993 3300003792 Bacteria 1176
25 Ga0055543_1000045 3300004625 Bacteria 115098
26 Ga0065165_1021051 3300005262 Bacteria 2275
27 Ga0065165_1038655 3300005262 Bacteria 1436
28 Ga0065715_10252567 3300005293 Bacteria 1162
29 Ga0070670_100056593 3300005331 Bacteria 3365
30 Ga0070677_10209477 3300005333 Bacteria 946
31 Ga0068869_100030666 3300005334 Bacteria 3777
32 Ga0068869_100256386 3300005334 Bacteria 1399
33 Ga0070689_100162644 3300005340 Bacteria 1805
34 Ga0070675_100161614 3300005354 Bacteria 1926
35 Ga0070675_100945683 3300005354 Bacteria 790
36 Ga0070673_100233668 3300005364 Bacteria 1596
37 Ga0070688_100274588 3300005365 Bacteria 1209
38 Ga0070714_100266347 3300005435 Bacteria 1588
39 Ga0070713_100376374 3300005436 Bacteria 1322
40 Ga0070710_10006251 3300005437 Bacteria 5707
41 Ga0070711_100570257 3300005439 Unclassified 941
42 Ga0070700_100173707 3300005441 Bacteria 1494
43 Ga0070678_101386462 3300005456 Bacteria 656
44 Ga0070662_100561538 3300005457 Bacteria 957
45 Ga0070662_100787482 3300005457 Bacteria 808
46 Ga0070679_100684690 3300005530 Bacteria 968
47 Ga0068853_100499090 3300005539 Bacteria 1149
48 Ga0070665_100111652 3300005548 Bacteria 2736
49 Ga0068852_100574115 3300005616 Bacteria 1130
50 Ga0068859_100115133 3300005617 Bacteria 2753
51 Ga0068864_100212171 3300005618 Bacteria 1783
52 Ga0081455_10104978 3300005937 Bacteria 2259
53 Ga0070717_10103362 3300006028 Bacteria 2422
54 Ga0075365_10010094 3300006038 Bacteria 5477
55 Ga0075365_10146189 3300006038 Bacteria 1642
56 Ga0075365_10250775 3300006038 Bacteria 1244
57 Ga0075368_10026148 3300006042 Bacteria 2245
58 Ga0075368_10057386 3300006042 Bacteria 1554
59 Ga0075368_10313378 3300006042 Unclassified 679
60 Ga0075363_100142064 3300006048 Bacteria 1352
61 Ga0075363_100315001 3300006048 Bacteria 910
62 Ga0075364_10030173 3300006051 Bacteria 3479
63 Ga0075364_10096176 3300006051 Bacteria 1969
64 Ga0075364_10558277 3300006051 Bacteria 783
65 Ga0075364_10767460 3300006051 Bacteria 657
66 Ga0075432_10061140 3300006058 Bacteria 1341
67 Ga0070712_100785472 3300006175 Bacteria 816
68 Ga0075367_10011559 3300006178 Bacteria 4678
69 Ga0075367_10184393 3300006178 Bacteria 1301
70 Ga0075367_10223609 3300006178 Bacteria 1178
71 Ga0075367_10240166 3300006178 Bacteria 1135
72 Ga0075369_10005336 3300006186 Bacteria 4792
73 Ga0075369_10269293 3300006186 Bacteria 792
74 Ga0075366_10003172 3300006195 Bacteria 8610
75 Ga0075366_10062441 3300006195 Bacteria 2214
76 Ga0075370_10001076 3300006353 Bacteria 11358
77 Ga0075370_10137911 3300006353 Bacteria 1425
78 Ga0075370_10157088 3300006353 Bacteria 1334
79 Ga0075370_10173883 3300006353 Bacteria 1266
80 Ga0075370_10296868 3300006353 Bacteria 960
81 Ga0097620_100115133 3300006931 Bacteria 2753
82 Ga0105244_10000211 3300009036 Bacteria 60009
83 Ga0111539_10486271 3300009094 Bacteria 1438
84 Ga0111539_11302854 3300009094 Bacteria 843
85 Ga0105247_10070828 3300009101 Bacteria 2179
86 Ga0105243_10151916 3300009148 Bacteria 1987
87 Ga0105241_10114219 3300009174 Bacteria 2166
88 Ga0105248_10242999 3300009177 Bacteria 2027
89 Ga0105246_10253667 3300011119 Bacteria 1397
90 Ga0157326_1007316 3300012513 Bacteria 1191
91 Ga0157373_10538535 3300013100 Bacteria 846
92 Ga0157378_11163849 3300013297 Bacteria 810
93 Ga0163163_10024719 3300014325 Bacteria 5720
94 Ga0163163_10728256 3300014325 Bacteria 1055
95 Ga0163163_10763943 3300014325 Bacteria 1030
96 Ga0157380_10100156 3300014326 Bacteria 2411
97 Ga0157380_10339454 3300014326 Bacteria 1401
98 Ga0157380_10651587 3300014326 Bacteria 1050
99 Ga0157377_10162096 3300014745 Unclassified 1392
100 Ga0157377_10207961 3300014745 Bacteria 1246
101 Ga0213876_10001158 3300021384 Bacteria 16663
102 Ga0213875_10019015 3300021388 Bacteria 3306
103 Ga0209436_100004 3300025208 Bacteria 196698
104 Ga0209437_100104 3300025233 Bacteria 220736
105 Ga0209129_1004044 3300025258 Bacteria 5983
106 Ga0209129_1027640 3300025258 Bacteria 969
107 Ga0209233_1000279 3300025261 Bacteria 70977
108 Ga0209565_1020815 3300025263 Bacteria 1380
109 Ga0209673_1000476 3300025273 Bacteria 66898
110 Ga0209673_1022182 3300025273 Bacteria 2197
111 Ga0209673_1043303 3300025273 Bacteria 1258
112 Ga0209130_1000001 3300025284 Bacteria 831557
113 Ga0209130_1019410 3300025284 Bacteria 1576
114 Ga0209675_1037044 3300025291 Bacteria 1099
115 Ga0209025_1099883 3300025294 Bacteria 921
116 Ga0209564_1002234 3300025295 Bacteria 15958
117 Ga0209564_1003543 3300025295 Bacteria 10504
118 Ga0209564_1018782 3300025295 Bacteria 2616
119 Ga0209564_1049485 3300025295 Bacteria 1039
120 Ga0209758_1011547 3300025297 Bacteria 5094
121 Ga0209758_1059080 3300025297 Bacteria 1278
122 Ga0209050_1007946 3300025298 Bacteria 5809
123 Ga0209256_1000250 3300025299 Bacteria 95262
124 Ga0209256_1006874 3300025299 Bacteria 5839
125 Ga0209256_1017056 3300025299 Bacteria 2435
126 Ga0209256_1054760 3300025299 Bacteria 949
127 Ga0207426_1000005 3300025302 Bacteria 1037188
128 Ga0207426_1002452 3300025302 Bacteria 11819
129 Ga0209051_1000118 3300025303 Bacteria 149426
130 Ga0209051_1010630 3300025303 Bacteria 4622
131 Ga0209257_1005507 3300025304 Bacteria 8842
132 Ga0209257_1016746 3300025304 Bacteria 2942
133 Ga0207655_1001113 3300025728 Bacteria 26259
134 Ga0207642_10366858 3300025899 Bacteria 853
135 Ga0207654_10116983 3300025911 Bacteria 1668
136 Ga0207663_10234602 3300025916 Bacteria 1342
137 Ga0207663_10532504 3300025916 Unclassified 916
138 Ga0207649_10244456 3300025920 Bacteria 1290
139 Ga0207681_10446423 3300025923 Bacteria 1052
140 Ga0207694_10571314 3300025924 Bacteria 950
141 Ga0207659_10065985 3300025926 Bacteria 2625
142 Ga0207700_10309544 3300025928 Bacteria 1366
143 Ga0207664_10033691 3300025929 Bacteria 3938
144 Ga0207690_10278041 3300025932 Unclassified 1303
145 Ga0207706_10101405 3300025933 Bacteria 2532
146 Ga0207709_10105927 3300025935 Bacteria 1870
147 Ga0207669_10111800 3300025937 Bacteria 1832
148 Ga0207689_10032652 3300025942 Bacteria 4328
149 Ga0207689_10255557 3300025942 Bacteria 1449
150 Ga0207661_10225539 3300025944 Unclassified 1658
151 Ga0207679_10041715 3300025945 Bacteria 3293
152 Ga0207708_10120270 3300026075 Bacteria 2046
153 Ga0207641_11005176 3300026088 Bacteria 831
154 Ga0207648_10089253 3300026089 Bacteria 2693
155 Ga0207648_11150970 3300026089 Bacteria 728
156 Ga0207676_10027299 3300026095 Bacteria 4251
157 Ga0207675_100071393 3300026118 Bacteria 3246
158 Ga0207683_11124495 3300026121 Bacteria 728
159 Ga0207698_10095690 3300026142 Bacteria 2445
160 Ga0209813_10036343 3300027866 Bacteria 1479
161 Ga0207428_10132883 3300027907 Bacteria 1903
162 Ga0268266_10130884 3300028379 Bacteria 2244
163 Ga0268266_10667998 3300028379 Bacteria 1001
164 Ga0307408_100900764 3300031548 Bacteria 810
165 Ga0307406_10764289 3300031901 Bacteria 812
166 Ga0373954_0059360 3300035118 Bacteria 1803
167 Ga0373956_0031482 3300035119 Bacteria 2325
168 Ga0373931_0269434 3300035691 Bacteria 1042
169 Ga0373927_0294617 3300035695 Bacteria 1068
170 Ga0373933_0113631 3300035724 Bacteria 1691
171 Ga0373937_0096983 3300036401 Bacteria 2734
172 Ga0373925_1490121 3300037068 Bacteria 554
173 Ga0436364_0622046 3300037853 Bacteria 1451
174 Ga0436364_0762384 3300037853 Bacteria 14605
175 Ga0436365_0849926 3300039437 Bacteria 98452
176 Ga0436365_1351018 3300039437 Bacteria 1255
177 Ga0436365_1753486 3300039437 Bacteria 14853
178 Ga0436360_0182960 3300039438 Bacteria 3386
179 Ga0436360_0846738 3300039438 Bacteria 723
180 Ga0436361_1084730 3300039447 Bacteria 852
181 Ga0436363_0243690 3300039450 Bacteria 8672
182 Ga0436363_1507929 3300039450 Bacteria 12431
183 Ga0436362_0438574 3300039453 Bacteria 2650
184 Ga0436362_0714408 3300039453 Bacteria 9627
185 Ga0439465_0028547 3300041413 Bacteria 1770
186 Ga0451787_043015 3300041441 Bacteria 888
187 Ga0451791_0366871 3300041451 Bacteria 791
188 Ga0451793_0271382 3300041452 Bacteria 2039
189 Ga0451833_0408185 3300041491 Bacteria 3087
190 Ga0451835_0284391 3300041492 Bacteria 2921
191 Ga0451837_0908640 3300041494 Bacteria 833
192 Ga0451839_0233831 3300041496 Unclassified 737
193 Ga0451839_0353512 3300041496 Bacteria 3504
194 Ga0451841_0331881 3300041498 Bacteria 2169
195 Ga0451841_0514201 3300041498 Bacteria 2917
196 Ga0451845_0328134 3300041501 Bacteria 2785
197 Ga0451846_10625 3300041502 Bacteria 992
198 Ga0451847_0069607 3300041503 Bacteria 3078
199 Ga0451847_0566200 3300041503 Bacteria 973
200 Ga0451849_0191010 3300041505 Bacteria 880
201 Ga0451849_0497620 3300041505 Bacteria 3224
202 Ga0451851_0010599 3300041507 Bacteria 3065
203 Ga0451851_0234754 3300041507 Bacteria 1170
204 Ga0451851_0627620 3300041507 Bacteria 2926
205 Ga0451843_0384979 3300041509 Bacteria 802
206 Ga0451843_0475919 3300041509 Bacteria 3207
207 Ga0451853_0468911 3300041512 Bacteria 3792
208 Ga0451853_2893161 3300041512 Bacteria 1217
209 Ga0451853_3397347 3300041512 Bacteria 851
210 Ga0439446_0082450 3300042156 Unclassified 998
211 Ga0495592_0184664 3300046454 Bacteria 1418
212 Ga0495591_000016 3300046458 Bacteria 244927
213 Ga0495605_0117087 3300046474 Bacteria 1211
214 Ga0495664_0003721 3300046477 Bacteria 8317
215 Ga0495585_0045674 3300046492 Bacteria 2444
216 Ga0495607_0000031 3300046501 Bacteria 153964
217 Ga0495607_0143138 3300046501 Bacteria 1231
218 Ga0495610_0041561 3300046512 Bacteria 2307
219 Ga0495620_0038542 3300046515 Bacteria 2120
220 Ga0495628_0139482 3300046516 Bacteria 1851
221 Ga0495628_0802848 3300046516 Bacteria 658
222 Ga0495631_0205483 3300046518 Bacteria 842
223 Ga0495632_0028325 3300046519 Bacteria 2924
224 Ga0495632_0055976 3300046519 Bacteria 1929
225 Ga0495637_0023653 3300046520 Bacteria 2788
226 Ga0495648_0151196 3300046524 Bacteria 1211
227 Ga0495640_0187707 3300046533 Bacteria 1315
228 Ga0495587_0021887 3300046536 Bacteria 3942
229 Ga0495587_0079633 3300046536 Bacteria 1899
230 Ga0495597_0000128 3300046542 Bacteria 68991
231 Ga0495645_0084535 3300046543 Bacteria 2272
232 Ga0495633_0020681 3300046558 Bacteria 3305
233 Ga0495667_0646465 3300046559 Bacteria 657
234 Ga0495625_0008469 3300046660 Bacteria 8776
235 Ga0495625_0082157 3300046660 Bacteria 2241
236 Ga0495625_0103973 3300046660 Bacteria 1947
237 Ga0495625_0568261 3300046660 Bacteria 685
238 Ga0495635_0110438 3300046663 Bacteria 1878
239 Ga0495599_0015265 3300046678 Bacteria 4764
240 Ga0495623_0044593 3300046679 Bacteria 2817
241 Ga0495670_0023949 3300046691 Bacteria 3015
242 Ga0495671_0096113 3300046692 Bacteria 1450
243 Ga0495649_0291285 3300046694 Bacteria 833
244 Ga0495600_0259126 3300046809 Bacteria 1105
245 Ga0495660_0000566 3300046810 Bacteria 29974
246 Ga0495660_0317299 3300046810 Bacteria 701
247 Ga0495604_0096751 3300047317 Bacteria 2178
248 Ga0495674_0064322 3300047319 Bacteria 3189
249 Ga0495672_0051947 3300047320 Bacteria 2411
250 Ga0495680_0047933 3300047322 Bacteria 3358
251 Ga0495687_096605 3300047443 Bacteria 1118
252 Ga0495675_0040961 3300047444 Bacteria 2952
253 Ga0495686_0171985 3300047472 Bacteria 1259
254 Ga0495602_0000369 3300048088 Bacteria 41909
255 Ga0496101_1214331 3300048904 Bacteria 591
256 Ga0496106_0000806 3300048909 Bacteria 22724
257 Ga0496116_0198704 3300048919 Bacteria 1052
258 Ga0496117_0042265 3300048920 Bacteria 3328
259 Ga0496118_0025897 3300048921 Bacteria 5015
260 Ga0496121_0018210 3300048924 Bacteria 7099
261 Ga0496121_0040509 3300048924 Bacteria 4085
262 Ga0496122_0043740 3300048925 Bacteria 3505
263 Ga0496124_0038414 3300048927 Bacteria 4158
264 Ga0496124_0056637 3300048927 Bacteria 3305
265 Ga0496125_0156974 3300048928 Bacteria 1553
266 Ga0496126_0091436 3300048929 Bacteria 2676
267 Ga0501032_0106486 3300049569 Bacteria 1857
268 Ga0501039_0801321 3300049575 Unclassified 735
269 Ga0501043_0071661 3300049579 Bacteria 2721
270 Ga0501073_0037320 3300049589 Bacteria 3451
271 Ga0501083_0018095 3300049744 Bacteria 4912
272 nmdc:mga03683_422631_c1 3300050489 Bacteria 639
273 nmdc:mga03683_778_c1 3300050489 Bacteria 9155
274 nmdc:mga00v17_39414_c1 3300050491 Bacteria 2829
275 nmdc:mga0yw44_158859_c1 3300050492 Bacteria 1479
276 nmdc:mga0yw44_3458_c2 3300050492 Bacteria 6533
277 nmdc:mga0k408_172685_c1 3300050493 Bacteria 1289
278 nmdc:mga0k408_3187_c1 3300050493 Bacteria 8688
279 nmdc:mga06z11_40064_c1 3300050494 Bacteria 2336
280 nmdc:mga04h51_193883_c1 3300050495 Unclassified 796
281 nmdc:mga04h51_270495_c1 3300050495 Unclassified 686
282 nmdc:mga04h51_33231_c1 3300050495 Bacteria 1641
283 nmdc:mga07m45_1412_c1 3300050496 Bacteria 11005
284 nmdc:mga07m45_572303_c1 3300050496 Unclassified 653
285 nmdc:mga07m45_67289_c1 3300050496 Bacteria 2036
286 nmdc:mga08y16_480415_c1 3300050511 Bacteria 1264
287 nmdc:mga0sz30_186116_c1 3300050516 Bacteria 922
288 nmdc:mga0sz30_36304_c1 3300050516 Bacteria 2060
289 Ga0495601_0023055 3300053077 Bacteria 3824
290 Ga0495612_0058697 3300053078 Bacteria 1590
291 Ga0495595_0010853 3300053084 Bacteria 3799
292 Ga0495619_0097212 3300053085 Bacteria 2000
293 Ga0500578_0238824 3300053086 Bacteria 1098
294 Ga0500641_0050829 3300053096 Bacteria 1704
295 Ga0500654_117458 3300053099 Bacteria 1062
296 Ga0500593_204574 3300053117 Bacteria 709
297 Ga0500618_000146 3300053125 Bacteria 58637
298 Ga0500618_000460 3300053125 Bacteria 26451
299 Ga0500618_002904 3300053125 Bacteria 6140
300 Ga0500642_0256123 3300053130 Bacteria 802
301 Ga0500658_0003050 3300053134 Bacteria 6412
302 Ga0500658_0004374 3300053134 Bacteria 5292
303 Ga0500658_0043585 3300053134 Bacteria 1807
304 Ga0500658_0081122 3300053134 Bacteria 1387
305 Ga0500568_0000097 3300053139 Bacteria 82019
306 Ga0500573_0004304 3300053140 Bacteria 7472
307 Ga0500573_0120371 3300053140 Bacteria 1461
308 Ga0500616_0258496 3300053153 Bacteria 740
309 Ga0500622_0000083 3300053156 Bacteria 101289
310 Ga0500622_0027369 3300053156 Bacteria 3005
311 Ga0500627_0138990 3300053158 Bacteria 1097
312 Ga0500633_0001004 3300053160 Bacteria 5001
313 Ga0500636_0160763 3300053177 Bacteria 1224
314 Ga0501082_0016709 3300060353 Bacteria 6319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0269434 Ga0373931_0269434_125_622 165
2 3300048904 Ga0496101_1214331 Ga0496101_1214331_20_517 165
3 3300006042 Ga0075368_10057386 Ga0075368_100573862 168
4 3300006051 Ga0075364_10096176 Ga0075364_100961763 168
5 3300006195 Ga0075366_10062441 Ga0075366_100624412 168
6 3300035118 Ga0373954_0059360 Ga0373954_0059360_85_591 168
7 3300037068 Ga0373925_1490121 Ga0373925_1490121_15_521 168
8 3300046516 Ga0495628_0139482 Ga0495628_0139482_1300_1806 168
9 3300053085 Ga0495619_0097212 Ga0495619_0097212_794_1300 168
10 3300002774 JGI25150J39212_1013139 JGI25150J39212_10131392 172
11 3300009036 Ga0105244_10000211 Ga0105244_1000021113 179
12 3300009148 Ga0105243_10151916 Ga0105243_101519162 179
13 3300025728 Ga0207655_1001113 Ga0207655_100111315 179
14 3300025935 Ga0207709_10105927 Ga0207709_101059272 179
15 3300048927 Ga0496124_0038414 Ga0496124_0038414_1811_2350 179
16 iso_pu_bacteria 2582581304 2585257220 179
17 iso_pu_bacteria 2585427528 2585543067 180
18 iso_pu_bacteria 2585427593 2585839164 180
19 iso_pu_bacteria 2738541333 2739037763 180
20 iso_pu_bacteria 2802429633 2806047693 180
21 iso_pu_bacteria 2802429634 2806055269 180
22 iso_pu_bacteria 2802429635 2806062150 180
23 iso_pu_bacteria 2802429636 2806070091 180
24 iso_pu_bacteria 2802429637 2806076609 180
25 iso_pu_bacteria 8005570704 8005571959 180
26 3300039437 Ga0436365_1351018 Ga0436365_1351018_473_1087 181
27 3300047319 Ga0495674_0064322 Ga0495674_0064322_1471_2016 181
28 3300053125 Ga0500618_002904 Ga0500618_002904_4516_5064 181
29 iso_pu_bacteria 2510917030 2511199740 181
30 iso_pu_bacteria 2582581298 2585221472 181
31 iso_pu_bacteria 2585427529 2585544358 181
32 iso_pu_bacteria 2919100787 2919103632 181
33 iso_pu_bacteria 3005445848 3005451291 181
34 3300039447 Ga0436361_1084730 Ga0436361_1084730_133_681 182
35 iso_pu_bacteria 2509276033 2509446311 182
36 iso_pu_bacteria 2510065019 2510135361 182
37 iso_pu_bacteria 2510461076 2510896815 182
38 iso_pu_bacteria 2513237084 2513572943 182
39 iso_pu_bacteria 2513237085 2513580475 182
40 iso_pu_bacteria 2513237093 2513634980 182
41 iso_pu_bacteria 2513237103 2513711461 182
42 iso_pu_bacteria 2513237162 2514019526 182
43 iso_pu_bacteria 2515075009 2515114529 182
44 iso_pu_bacteria 2515154113 2515635051 182
45 iso_pu_bacteria 2515154114 2515644387 182
46 iso_pu_bacteria 2515154116 2515657534 182
47 iso_pu_bacteria 2515154134 2515741713 182
48 iso_pu_bacteria 2516653077 2517038170 182
49 iso_pu_bacteria 2516653085 2517078452 182
50 iso_pu_bacteria 2517093000 2517097190 182
51 iso_pu_bacteria 2517287029 2517408422 182
52 iso_pu_bacteria 2529292951 2530647246 182
53 iso_pu_bacteria 2585427526 2585529250 182
54 iso_pu_bacteria 2671180139 2671693437 182
55 iso_pu_bacteria 2724679232 2725945719 182
56 iso_pu_bacteria 2765235942 2766064146 182
57 iso_pu_bacteria 2791355261 2793327397 182
58 iso_pu_bacteria 2791355267 2793366010 182
59 iso_pu_bacteria 2838686498 2838693283 182
60 iso_pu_bacteria 2838729681 2838735277 182
61 iso_pu_bacteria 2838742623 2838748174 182
62 iso_pu_bacteria 2841851746 2841857349 182
63 iso_pu_bacteria 2842110456 2842116532 182
64 iso_pu_bacteria 2842156927 2842162476 182
65 iso_pu_bacteria 2842163707 2842166819 182
66 iso_pu_bacteria 2842180545 2842186116 182
67 iso_pu_bacteria 2842217011 2842221894 182
68 iso_pu_bacteria 2842229732 2842235575 182
69 iso_pu_bacteria 2842243621 2842249142 182
70 iso_pu_bacteria 2842257432 2842263097 182
71 iso_pu_bacteria 2842271015 2842277751 182
72 iso_pu_bacteria 2842304105 2842305706 182
73 iso_pu_bacteria 2842482326 2842488626 182
74 iso_pu_bacteria 2844454524 2844456868 182
75 iso_pu_bacteria 2857516855 2857519697 182
76 iso_pu_bacteria 2933570622 2933572212 182
77 iso_pu_bacteria 2933586486 2933592861 182
78 iso_pu_bacteria 2935901341 2935903509 182
79 iso_pu_bacteria 2936367885 2936370004 182
80 iso_pu_bacteria 2936375103 2936379189 182
81 iso_pu_bacteria 2939669807 2939674155 182
82 iso_pu_bacteria 639633055 639650539 182
83 iso_pu_bacteria 8005307578 8005313825 182
84 iso_pu_bacteria 8005376324 8005381455 182
85 iso_pu_bacteria 8005460587 8005465223 182
86 iso_pu_bacteria 8005556819 8005561287 182
87 iso_pu_bacteria 8005563573 8005565909 182
88 iso_pu_bacteria 8018163183 8018164976 182
89 iso_pu_bacteria 8023680758 8023686668 182
90 iso_pu_bacteria 8024479707 8024484484 182
91 iso_pu_bacteria 8056375014 8056380521 182
92 iso_pu_bacteria 8057874678 8057879403 182
93 3300042156 Ga0439446_0082450 Ga0439446_0082450_224_775 183
94 3300046519 Ga0495632_0028325 Ga0495632_0028325_826_1377 183
95 3300003354 JGI25160J50197_1001488 JGI25160J50197_100148810 184
96 3300003374 JGI25161J50226_1003348 JGI25161J50226_10033482 184
97 3300003771 Ga0055526_1003140 Ga0055526_10031409 184
98 3300003775 Ga0055524_1008281 Ga0055524_10082812 184
99 3300003790 Ga0055528_1008686 Ga0055528_10086862 184
100 3300003792 Ga0055540_1032993 Ga0055540_10329932 184
101 3300005262 Ga0065165_1038655 Ga0065165_10386551 184
102 3300005293 Ga0065715_10252567 Ga0065715_102525672 184
103 3300005331 Ga0070670_100056593 Ga0070670_1000565932 184
104 3300005333 Ga0070677_10209477 Ga0070677_102094772 184
105 3300005334 Ga0068869_100030666 Ga0068869_1000306664 184
106 3300005340 Ga0070689_100162644 Ga0070689_1001626442 184
107 3300005354 Ga0070675_100161614 Ga0070675_1001616143 184
108 3300005354 Ga0070675_100945683 Ga0070675_1009456831 184
109 3300005364 Ga0070673_100233668 Ga0070673_1002336683 184
110 3300005365 Ga0070688_100274588 Ga0070688_1002745882 184
111 3300005441 Ga0070700_100173707 Ga0070700_1001737072 184
112 3300005456 Ga0070678_101386462 Ga0070678_1013864621 184
113 3300005457 Ga0070662_100561538 Ga0070662_1005615381 184
114 3300005457 Ga0070662_100787482 Ga0070662_1007874821 184
115 3300005530 Ga0070679_100684690 Ga0070679_1006846901 184
116 3300005539 Ga0068853_100499090 Ga0068853_1004990902 184
117 3300005616 Ga0068852_100574115 Ga0068852_1005741152 184
118 3300005617 Ga0068859_100115133 Ga0068859_1001151333 184
119 3300005618 Ga0068864_100212171 Ga0068864_1002121712 184
120 3300006038 Ga0075365_10010094 Ga0075365_100100944 184
121 3300006038 Ga0075365_10146189 Ga0075365_101461891 184
122 3300006038 Ga0075365_10250775 Ga0075365_102507751 184
123 3300006042 Ga0075368_10026148 Ga0075368_100261482 184
124 3300006042 Ga0075368_10313378 Ga0075368_103133781 184
125 3300006048 Ga0075363_100142064 Ga0075363_1001420642 184
126 3300006048 Ga0075363_100315001 Ga0075363_1003150012 184
127 3300006051 Ga0075364_10030173 Ga0075364_100301732 184
128 3300006051 Ga0075364_10558277 Ga0075364_105582772 184
129 3300006051 Ga0075364_10767460 Ga0075364_107674601 184
130 3300006058 Ga0075432_10061140 Ga0075432_100611402 184
131 3300006178 Ga0075367_10011559 Ga0075367_100115593 184
132 3300006178 Ga0075367_10223609 Ga0075367_102236092 184
133 3300006178 Ga0075367_10240166 Ga0075367_102401661 184
134 3300006186 Ga0075369_10005336 Ga0075369_100053365 184
135 3300006186 Ga0075369_10269293 Ga0075369_102692931 184
136 3300006195 Ga0075366_10003172 Ga0075366_100031726 184
137 3300006353 Ga0075370_10001076 Ga0075370_100010768 184
138 3300006353 Ga0075370_10137911 Ga0075370_101379111 184
139 3300006353 Ga0075370_10173883 Ga0075370_101738833 184
140 3300006353 Ga0075370_10296868 Ga0075370_102968682 184
141 3300006931 Ga0097620_100115133 Ga0097620_1001151333 184
142 3300009094 Ga0111539_11302854 Ga0111539_113028541 184
143 3300009101 Ga0105247_10070828 Ga0105247_100708282 184
144 3300009174 Ga0105241_10114219 Ga0105241_101142193 184
145 3300009177 Ga0105248_10242999 Ga0105248_102429992 184
146 3300011119 Ga0105246_10253667 Ga0105246_102536672 184
147 3300013297 Ga0157378_11163849 Ga0157378_111638491 184
148 3300014325 Ga0163163_10728256 Ga0163163_107282562 184
149 3300014326 Ga0157380_10339454 Ga0157380_103394541 184
150 3300014745 Ga0157377_10207961 Ga0157377_102079612 184
151 3300021384 Ga0213876_10001158 Ga0213876_100011585 184
152 3300025263 Ga0209565_1020815 Ga0209565_10208152 184
153 3300025273 Ga0209673_1000476 Ga0209673_100047657 184
154 3300025284 Ga0209130_1019410 Ga0209130_10194102 184
155 3300025291 Ga0209675_1037044 Ga0209675_10370442 184
156 3300025295 Ga0209564_1003543 Ga0209564_10035438 184
157 3300025299 Ga0209256_1000250 Ga0209256_100025079 184
158 3300025302 Ga0207426_1002452 Ga0207426_10024527 184
159 3300025303 Ga0209051_1010630 Ga0209051_10106302 184
160 3300025899 Ga0207642_10366858 Ga0207642_103668582 184
161 3300025911 Ga0207654_10116983 Ga0207654_101169832 184
162 3300025920 Ga0207649_10244456 Ga0207649_102444562 184
163 3300025923 Ga0207681_10446423 Ga0207681_104464232 184
164 3300025924 Ga0207694_10571314 Ga0207694_105713141 184
165 3300025926 Ga0207659_10065985 Ga0207659_100659853 184
166 3300025932 Ga0207690_10278041 Ga0207690_102780412 184
167 3300025933 Ga0207706_10101405 Ga0207706_101014052 184
168 3300025937 Ga0207669_10111800 Ga0207669_101118003 184
169 3300025942 Ga0207689_10032652 Ga0207689_100326525 184
170 3300025944 Ga0207661_10225539 Ga0207661_102255392 184
171 3300025945 Ga0207679_10041715 Ga0207679_100417154 184
172 3300026075 Ga0207708_10120270 Ga0207708_101202702 184
173 3300026089 Ga0207648_10089253 Ga0207648_100892531 184
174 3300026089 Ga0207648_11150970 Ga0207648_111509702 184
175 3300026095 Ga0207676_10027299 Ga0207676_100272993 184
176 3300026118 Ga0207675_100071393 Ga0207675_1000713934 184
177 3300026121 Ga0207683_11124495 Ga0207683_111244952 184
178 3300026142 Ga0207698_10095690 Ga0207698_100956903 184
179 3300027866 Ga0209813_10036343 Ga0209813_100363432 184
180 3300027907 Ga0207428_10132883 Ga0207428_101328832 184
181 3300028379 Ga0268266_10667998 Ga0268266_106679982 184
182 3300031548 Ga0307408_100900764 Ga0307408_1009007641 184
183 3300039437 Ga0436365_0849926 Ga0436365_0849926_70003_70557 184
184 3300039450 Ga0436363_1507929 Ga0436363_1507929_8517_9071 184
185 3300039453 Ga0436362_0438574 Ga0436362_0438574_787_1341 184
186 3300046474 Ga0495605_0117087 Ga0495605_0117087_361_915 184
187 3300046660 Ga0495625_0568261 Ga0495625_0568261_38_670 184
188 3300049575 Ga0501039_0801321 Ga0501039_0801321_117_677 184
189 3300050489 nmdc:mga03683_422631_c1 nmdc:mga03683_422631_c1_25_585 184
190 3300050489 nmdc:mga03683_778_c1 nmdc:mga03683_778_c1_1336_1890 184
191 3300050491 nmdc:mga00v17_39414_c1 nmdc:mga00v17_39414_c1_766_1320 184
192 3300050492 nmdc:mga0yw44_158859_c1 nmdc:mga0yw44_158859_c1_313_867 184
193 3300050492 nmdc:mga0yw44_3458_c2 nmdc:mga0yw44_3458_c2_3486_4040 184
194 3300050493 nmdc:mga0k408_172685_c1 nmdc:mga0k408_172685_c1_487_1047 184
195 3300050493 nmdc:mga0k408_3187_c1 nmdc:mga0k408_3187_c1_4143_4697 184
196 3300050494 nmdc:mga06z11_40064_c1 nmdc:mga06z11_40064_c1_741_1295 184
197 3300050495 nmdc:mga04h51_193883_c1 nmdc:mga04h51_193883_c1_121_681 184
198 3300050495 nmdc:mga04h51_270495_c1 nmdc:mga04h51_270495_c1_100_660 184
199 3300050495 nmdc:mga04h51_33231_c1 nmdc:mga04h51_33231_c1_485_1039 184
200 3300050496 nmdc:mga07m45_1412_c1 nmdc:mga07m45_1412_c1_3250_3804 184
201 3300050496 nmdc:mga07m45_572303_c1 nmdc:mga07m45_572303_c1_67_627 184
202 3300050496 nmdc:mga07m45_67289_c1 nmdc:mga07m45_67289_c1_781_1341 184
203 3300050516 nmdc:mga0sz30_186116_c1 nmdc:mga0sz30_186116_c1_350_910 184
204 3300050516 nmdc:mga0sz30_36304_c1 nmdc:mga0sz30_36304_c1_324_878 184
205 3300053096 Ga0500641_0050829 Ga0500641_0050829_708_1268 184
206 3300053099 Ga0500654_117458 Ga0500654_117458_472_1026 184
207 3300053117 Ga0500593_204574 Ga0500593_204574_128_682 184
208 3300053134 Ga0500658_0043585 Ga0500658_0043585_493_1047 184
209 3300053158 Ga0500627_0138990 Ga0500627_0138990_453_1007 184
210 iso_pu_bacteria 2501025502 2501077423 184
211 iso_pu_bacteria 2510917013 2511092561 184
212 3300002773 JGI25152J39213_1003471 JGI25152J39213_10034716 185
213 3300002987 JGI25159J45721_1002575 JGI25159J45721_10025757 185
214 3300003215 JGI25153J46596_10007888 JGI25153J46596_100078886 185
215 3300003320 rootH2_10095716 rootH2_100957162 185
216 3300003322 rootL2_10071650 rootL2_100716502 185
217 3300003323 rootH1_10073901 rootH1_100739012 185
218 3300003354 JGI25160J50197_1006235 JGI25160J50197_10062352 185
219 3300003374 JGI25161J50226_1002948 JGI25161J50226_10029483 185
220 3300003771 Ga0055526_1007570 Ga0055526_10075703 185
221 3300003790 Ga0055528_1001174 Ga0055528_100117418 185
222 3300003792 Ga0055540_1010450 Ga0055540_10104503 185
223 3300004625 Ga0055543_1000045 Ga0055543_100004538 185
224 3300005262 Ga0065165_1021051 Ga0065165_10210513 185
225 3300005334 Ga0068869_100256386 Ga0068869_1002563861 185
226 3300005548 Ga0070665_100111652 Ga0070665_1001116524 185
227 3300014326 Ga0157380_10100156 Ga0157380_101001563 185
228 3300025208 Ga0209436_100004 Ga0209436_10000467 185
229 3300025258 Ga0209129_1004044 Ga0209129_10040445 185
230 3300025258 Ga0209129_1027640 Ga0209129_10276401 185
231 3300025273 Ga0209673_1022182 Ga0209673_10221822 185
232 3300025284 Ga0209130_1000001 Ga0209130_1000001357 185
233 3300025295 Ga0209564_1002234 Ga0209564_100223413 185
234 3300025295 Ga0209564_1049485 Ga0209564_10494852 185
235 3300025297 Ga0209758_1011547 Ga0209758_10115472 185
236 3300025299 Ga0209256_1006874 Ga0209256_10068742 185
237 3300025299 Ga0209256_1017056 Ga0209256_10170562 185
238 3300025302 Ga0207426_1000005 Ga0207426_1000005962 185
239 3300025304 Ga0209257_1016746 Ga0209257_10167462 185
240 3300025942 Ga0207689_10255557 Ga0207689_102555572 185
241 3300028379 Ga0268266_10130884 Ga0268266_101308842 185
242 3300039438 Ga0436360_0846738 Ga0436360_0846738_51_608 185
243 3300041413 Ga0439465_0028547 Ga0439465_0028547_138_701 185
244 3300041491 Ga0451833_0408185 Ga0451833_0408185_306_863 185
245 3300041507 Ga0451851_0010599 Ga0451851_0010599_2332_2889 185
246 3300046458 Ga0495591_000016 Ga0495591_000016_65546_66103 185
247 3300046501 Ga0495607_0000031 Ga0495607_0000031_82029_82586 185
248 3300046512 Ga0495610_0041561 Ga0495610_0041561_316_879 185
249 3300046520 Ga0495637_0023653 Ga0495637_0023653_1955_2512 185
250 3300046542 Ga0495597_0000128 Ga0495597_0000128_54165_54722 185
251 3300046694 Ga0495649_0291285 Ga0495649_0291285_35_598 185
252 3300046810 Ga0495660_0000566 Ga0495660_0000566_1004_1561 185
253 3300047320 Ga0495672_0051947 Ga0495672_0051947_704_1261 185
254 3300048909 Ga0496106_0000806 Ga0496106_0000806_16791_17438 185
255 3300048919 Ga0496116_0198704 Ga0496116_0198704_97_660 185
256 3300048920 Ga0496117_0042265 Ga0496117_0042265_227_790 185
257 3300048921 Ga0496118_0025897 Ga0496118_0025897_2738_3301 185
258 3300048924 Ga0496121_0018210 Ga0496121_0018210_2741_3298 185
259 3300048924 Ga0496121_0040509 Ga0496121_0040509_925_1488 185
260 3300048925 Ga0496122_0043740 Ga0496122_0043740_314_877 185
261 3300048927 Ga0496124_0056637 Ga0496124_0056637_616_1179 185
262 3300048929 Ga0496126_0091436 Ga0496126_0091436_1078_1659 185
263 3300049569 Ga0501032_0106486 Ga0501032_0106486_1275_1832 185
264 3300049579 Ga0501043_0071661 Ga0501043_0071661_1225_1782 185
265 3300049589 Ga0501073_0037320 Ga0501073_0037320_931_1488 185
266 3300049744 Ga0501083_0018095 Ga0501083_0018095_3387_3944 185
267 3300053130 Ga0500642_0256123 Ga0500642_0256123_15_572 185
268 3300053134 Ga0500658_0004374 Ga0500658_0004374_302_865 185
269 3300053139 Ga0500568_0000097 Ga0500568_0000097_70085_70648 185
270 3300053156 Ga0500622_0000083 Ga0500622_0000083_11284_11841 185
271 3300053160 Ga0500633_0001004 Ga0500633_0001004_1385_2032 185
272 3300060353 Ga0501082_0016709 Ga0501082_0016709_2985_3542 185
273 3300002737 JGI25162J39368_1000309 JGI25162J39368_10003092 186
274 3300003214 JGI25165J46597_1000556 JGI25165J46597_100055610 186
275 3300003215 JGI25153J46596_10020145 JGI25153J46596_100201451 186
276 3300003790 Ga0055528_1017188 Ga0055528_10171882 186
277 3300003790 Ga0055528_1043316 Ga0055528_10433161 186
278 3300003792 Ga0055540_1000324 Ga0055540_100032415 186
279 3300005435 Ga0070714_100266347 Ga0070714_1002663472 186
280 3300005436 Ga0070713_100376374 Ga0070713_1003763742 186
281 3300005437 Ga0070710_10006251 Ga0070710_100062512 186
282 3300005439 Ga0070711_100570257 Ga0070711_1005702571 186
283 3300005937 Ga0081455_10104978 Ga0081455_101049782 186
284 3300006028 Ga0070717_10103362 Ga0070717_101033622 186
285 3300006175 Ga0070712_100785472 Ga0070712_1007854721 186
286 3300006178 Ga0075367_10184393 Ga0075367_101843932 186
287 3300006353 Ga0075370_10157088 Ga0075370_101570881 186
288 3300009094 Ga0111539_10486271 Ga0111539_104862712 186
289 3300012513 Ga0157326_1007316 Ga0157326_10073162 186
290 3300013100 Ga0157373_10538535 Ga0157373_105385351 186
291 3300014325 Ga0163163_10024719 Ga0163163_100247194 186
292 3300014325 Ga0163163_10763943 Ga0163163_107639431 186
293 3300014326 Ga0157380_10651587 Ga0157380_106515872 186
294 3300014745 Ga0157377_10162096 Ga0157377_101620961 186
295 3300021388 Ga0213875_10019015 Ga0213875_100190153 186
296 3300025233 Ga0209437_100104 Ga0209437_100104162 186
297 3300025261 Ga0209233_1000279 Ga0209233_100027935 186
298 3300025273 Ga0209673_1043303 Ga0209673_10433032 186
299 3300025294 Ga0209025_1099883 Ga0209025_10998831 186
300 3300025295 Ga0209564_1018782 Ga0209564_10187822 186
301 3300025297 Ga0209758_1059080 Ga0209758_10590802 186
302 3300025298 Ga0209050_1007946 Ga0209050_10079462 186
303 3300025299 Ga0209256_1054760 Ga0209256_10547601 186
304 3300025303 Ga0209051_1000118 Ga0209051_100011892 186
305 3300025304 Ga0209257_1005507 Ga0209257_10055075 186
306 3300025916 Ga0207663_10234602 Ga0207663_102346021 186
307 3300025916 Ga0207663_10532504 Ga0207663_105325041 186
308 3300025928 Ga0207700_10309544 Ga0207700_103095442 186
309 3300025929 Ga0207664_10033691 Ga0207664_100336912 186
310 3300026088 Ga0207641_11005176 Ga0207641_110051762 186
311 3300031901 Ga0307406_10764289 Ga0307406_107642891 186
312 3300035119 Ga0373956_0031482 Ga0373956_0031482_1339_1899 186
313 3300035695 Ga0373927_0294617 Ga0373927_0294617_29_589 186
314 3300035724 Ga0373933_0113631 Ga0373933_0113631_196_756 186
315 3300036401 Ga0373937_0096983 Ga0373937_0096983_1474_2034 186
316 3300037853 Ga0436364_0622046 Ga0436364_0622046_355_915 186
317 3300037853 Ga0436364_0762384 Ga0436364_0762384_9388_9948 186
318 3300039437 Ga0436365_1753486 Ga0436365_1753486_2453_3013 186
319 3300039438 Ga0436360_0182960 Ga0436360_0182960_318_884 186
320 3300039450 Ga0436363_0243690 Ga0436363_0243690_6653_7213 186
321 3300039453 Ga0436362_0714408 Ga0436362_0714408_3680_4240 186
322 3300041441 Ga0451787_043015 Ga0451787_043015_137_697 186
323 3300041451 Ga0451791_0366871 Ga0451791_0366871_109_759 186
324 3300041452 Ga0451793_0271382 Ga0451793_0271382_63_623 186
325 3300041492 Ga0451835_0284391 Ga0451835_0284391_2151_2711 186
326 3300041494 Ga0451837_0908640 Ga0451837_0908640_225_785 186
327 3300041496 Ga0451839_0233831 Ga0451839_0233831_14_610 186
328 3300041496 Ga0451839_0353512 Ga0451839_0353512_2151_2711 186
329 3300041498 Ga0451841_0331881 Ga0451841_0331881_271_831 186
330 3300041498 Ga0451841_0514201 Ga0451841_0514201_2080_2640 186
331 3300041501 Ga0451845_0328134 Ga0451845_0328134_2156_2716 186
332 3300041502 Ga0451846_10625 Ga0451846_10625_315_875 186
333 3300041503 Ga0451847_0069607 Ga0451847_0069607_368_928 186
334 3300041503 Ga0451847_0566200 Ga0451847_0566200_342_902 186
335 3300041505 Ga0451849_0191010 Ga0451849_0191010_20_580 186
336 3300041505 Ga0451849_0497620 Ga0451849_0497620_2151_2711 186
337 3300041507 Ga0451851_0234754 Ga0451851_0234754_301_861 186
338 3300041507 Ga0451851_0627620 Ga0451851_0627620_2156_2716 186
339 3300041509 Ga0451843_0384979 Ga0451843_0384979_133_693 186
340 3300041509 Ga0451843_0475919 Ga0451843_0475919_2151_2711 186
341 3300041512 Ga0451853_0468911 Ga0451853_0468911_2997_3557 186
342 3300041512 Ga0451853_2893161 Ga0451853_2893161_412_972 186
343 3300041512 Ga0451853_3397347 Ga0451853_3397347_216_776 186
344 3300046454 Ga0495592_0184664 Ga0495592_0184664_385_945 186
345 3300046477 Ga0495664_0003721 Ga0495664_0003721_2757_3317 186
346 3300046492 Ga0495585_0045674 Ga0495585_0045674_517_1077 186
347 3300046501 Ga0495607_0143138 Ga0495607_0143138_657_1217 186
348 3300046515 Ga0495620_0038542 Ga0495620_0038542_1062_1622 186
349 3300046516 Ga0495628_0802848 Ga0495628_0802848_36_599 186
350 3300046518 Ga0495631_0205483 Ga0495631_0205483_21_581 186
351 3300046519 Ga0495632_0055976 Ga0495632_0055976_1043_1603 186
352 3300046524 Ga0495648_0151196 Ga0495648_0151196_330_890 186
353 3300046533 Ga0495640_0187707 Ga0495640_0187707_589_1149 186
354 3300046536 Ga0495587_0021887 Ga0495587_0021887_3148_3708 186
355 3300046536 Ga0495587_0079633 Ga0495587_0079633_561_1121 186
356 3300046543 Ga0495645_0084535 Ga0495645_0084535_844_1404 186
357 3300046558 Ga0495633_0020681 Ga0495633_0020681_1060_1620 186
358 3300046559 Ga0495667_0646465 Ga0495667_0646465_83_646 186
359 3300046660 Ga0495625_0008469 Ga0495625_0008469_6090_6650 186
360 3300046660 Ga0495625_0082157 Ga0495625_0082157_634_1194 186
361 3300046660 Ga0495625_0103973 Ga0495625_0103973_553_1113 186
362 3300046663 Ga0495635_0110438 Ga0495635_0110438_202_762 186
363 3300046678 Ga0495599_0015265 Ga0495599_0015265_1606_2166 186
364 3300046679 Ga0495623_0044593 Ga0495623_0044593_1447_2007 186
365 3300046691 Ga0495670_0023949 Ga0495670_0023949_1612_2172 186
366 3300046692 Ga0495671_0096113 Ga0495671_0096113_114_674 186
367 3300046809 Ga0495600_0259126 Ga0495600_0259126_133_693 186
368 3300046810 Ga0495660_0317299 Ga0495660_0317299_23_583 186
369 3300047317 Ga0495604_0096751 Ga0495604_0096751_347_907 186
370 3300047322 Ga0495680_0047933 Ga0495680_0047933_440_1000 186
371 3300047443 Ga0495687_096605 Ga0495687_096605_207_767 186
372 3300047444 Ga0495675_0040961 Ga0495675_0040961_1994_2554 186
373 3300047472 Ga0495686_0171985 Ga0495686_0171985_28_588 186
374 3300048088 Ga0495602_0000369 Ga0495602_0000369_23748_24308 186
375 3300048928 Ga0496125_0156974 Ga0496125_0156974_112_672 186
376 3300050511 nmdc:mga08y16_480415_c1 nmdc:mga08y16_480415_c1_480_1046 186
377 3300053077 Ga0495601_0023055 Ga0495601_0023055_1920_2480 186
378 3300053078 Ga0495612_0058697 Ga0495612_0058697_38_598 186
379 3300053084 Ga0495595_0010853 Ga0495595_0010853_779_1339 186
380 3300053086 Ga0500578_0238824 Ga0500578_0238824_101_661 186
381 3300053125 Ga0500618_000146 Ga0500618_000146_46143_46718 186
382 3300053125 Ga0500618_000460 Ga0500618_000460_24779_25339 186
383 3300053134 Ga0500658_0003050 Ga0500658_0003050_3307_3867 186
384 3300053134 Ga0500658_0081122 Ga0500658_0081122_497_1057 186
385 3300053140 Ga0500573_0004304 Ga0500573_0004304_3278_3847 186
386 3300053140 Ga0500573_0120371 Ga0500573_0120371_639_1199 186
387 3300053153 Ga0500616_0258496 Ga0500616_0258496_80_640 186
388 3300053156 Ga0500622_0027369 Ga0500622_0027369_1605_2204 186
389 3300053177 Ga0500636_0160763 Ga0500636_0160763_242_802 186

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gn3-assembly1.cif.gz_A crystal structure of a putative protein-disulfide isomerase from pseudomonas syringae to 2.5a resolution. 0.9888 9 183
3gn3-assembly1.cif.gz_A crystal structure of a putative protein-disulfide isomerase from pseudomonas syringae to 2.5a resolution. 0.9615 9 183
2av4-assembly1.cif.gz_A crystal structure of plasmodium yoelii thioredoxin-like protein 4a (dim1) 0.8383 16 56
2he3-assembly1.cif.gz_A crystal structure of the selenocysteine to cysteine mutant of human glutathionine peroxidase 2 (gpx2) 0.8177 15 56
2h71-assembly2.cif.gz_B crystal structure of thioredoxin mutant d47e in hexagonal (p61) space group 0.8058 15 56
ID Description Score Start End Superfamily
3gn3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9882 8 183 3.40.30.10
3gn3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9663 8 183 3.40.30.10
af_C6T172_46_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8533 18 183 3.40.30.10
af_C6T172_46_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.83 18 183 3.40.30.10
af_A0A1D8PLE6_13_218_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8215 15 180 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7I6Z9P4-F1-model_v4 deleted 0.9918 5 183
AF-A0A089QZC2-F1-model_v4 Thioredoxin 0.9911 7 184
AF-A0A3M5KGX9-F1-model_v4 Thioredoxon-like super protein 0.9904 9 183
AF-A0A0P9K8L0-F1-model_v4 Thioredoxin-like fold domain-containing protein 0.99 9 183
AF-A0A3M2VXY7-F1-model_v4 Thioredoxon-like super protein 0.9899 76 183

Feature Viewer

pLDDT pTM Quality
93.43 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map