F431325

General Info

Members Datasets Scaffolds Average Seq Length
389 148 778 154

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_101155706|Ga0070661_1011557061
Length 180
Sequence MANRIMGGGPIHAFAYLCKCVHNHAMADLKERRQRAIADLIRKRALASQEELAERLTRQGFAVTQATISRDLEQIGAVKVRRDGQLSYSLPDQVRDAPAPRLAAVFRDWVQSVDTAGNLVVIKTPPGSAHLVGVALDGSDFENIVGTICGDDTIFIACRTEKGGKRLARILSDQSGAGLQ

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 6.17
Rhizosphere 92.8
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_101155706 3300005344 Unclassified 646
2 JGI24741J21665_1015860 3300001915 Bacteria 1238
3 JGI24739J22299_10025417 3300001989 Bacteria 2082
4 JGI24737J22298_10000516 3300001990 Bacteria 13557
5 JGI24737J22298_10003950 3300001990 Bacteria 5192
6 JGI24743J22301_10012711 3300001991 Bacteria 1536
7 JGI24735J21928_10049349 3300002067 Bacteria 1216
8 JGI24735J21928_10069293 3300002067 Bacteria 1011
9 JGI24738J21930_10068199 3300002075 Bacteria 735
10 Ga0070658_10283911 3300005327 Bacteria 1409
11 Ga0070658_10472625 3300005327 Bacteria 1081
12 Ga0070658_10610119 3300005327 Bacteria 946
13 Ga0070658_11495770 3300005327 Bacteria 585
14 Ga0070683_100002165 3300005329 Bacteria 15542
15 Ga0070683_100098027 3300005329 Bacteria 2758
16 Ga0070683_101104717 3300005329 Bacteria 762
17 Ga0070670_100315717 3300005331 Bacteria 1368
18 Ga0070670_100782785 3300005331 Bacteria 861
19 Ga0068869_100660989 3300005334 Bacteria 888
20 Ga0068869_100697226 3300005334 Unclassified 866
21 Ga0070666_10021810 3300005335 Bacteria 4152
22 Ga0070680_100003672 3300005336 Bacteria 11461
23 Ga0070680_100010477 3300005336 Bacteria 7148
24 Ga0070680_101059906 3300005336 Bacteria 700
25 Ga0068868_100453578 3300005338 Bacteria 1116
26 Ga0070660_100075698 3300005339 Bacteria 2635
27 Ga0070660_100146194 3300005339 Bacteria 1899
28 Ga0070660_100230407 3300005339 Bacteria 1507
29 Ga0070660_100676192 3300005339 Unclassified 865
30 Ga0070661_100036538 3300005344 Bacteria 3571
31 Ga0070661_100127413 3300005344 Bacteria 1910
32 Ga0070692_10043649 3300005345 Bacteria 2307
33 Ga0070668_101571889 3300005347 Bacteria 602
34 Ga0070669_100883922 3300005353 Bacteria 763
35 Ga0070671_100004740 3300005355 Bacteria 10804
36 Ga0070671_100008369 3300005355 Bacteria 8287
37 Ga0070671_100017298 3300005355 Bacteria 5838
38 Ga0070671_100717755 3300005355 Bacteria 868
39 Ga0070673_100435727 3300005364 Unclassified 1177
40 Ga0070659_100003560 3300005366 Bacteria 11090
41 Ga0070659_100052490 3300005366 Bacteria 3207
42 Ga0070659_100099043 3300005366 Bacteria 2344
43 Ga0070659_100132460 3300005366 Unclassified 2025
44 Ga0070667_100026825 3300005367 Bacteria 4794
45 Ga0070709_10098453 3300005434 Bacteria 1943
46 Ga0070714_100128257 3300005435 Bacteria 2264
47 Ga0070714_100288852 3300005435 Bacteria 1526
48 Ga0070714_101067879 3300005435 Bacteria 786
49 Ga0070663_100130861 3300005455 Bacteria 1905
50 Ga0070663_100437477 3300005455 Bacteria 1076
51 Ga0070662_100019462 3300005457 Bacteria 4608
52 Ga0070662_100181917 3300005457 Bacteria 1657
53 Ga0070662_100861087 3300005457 Bacteria 772
54 Ga0070681_10104384 3300005458 Bacteria 2777
55 Ga0070681_10161777 3300005458 Bacteria 2162
56 Ga0070681_10207380 3300005458 Bacteria 1876
57 Ga0070681_10318222 3300005458 Bacteria 1465
58 Ga0070681_11102912 3300005458 Bacteria 714
59 Ga0070707_101459153 3300005468 Unclassified 651
60 Ga0070679_100017863 3300005530 Bacteria 6870
61 Ga0070679_100151057 3300005530 Bacteria 2299
62 Ga0070679_100512500 3300005530 Bacteria 1143
63 Ga0070684_100006623 3300005535 Bacteria 8973
64 Ga0070684_100038517 3300005535 Bacteria 4107
65 Ga0070684_100339664 3300005535 Bacteria 1381
66 Ga0068853_100074002 3300005539 Bacteria 2971
67 Ga0068853_100242470 3300005539 Bacteria 1652
68 Ga0068853_100251607 3300005539 Bacteria 1621
69 Ga0068853_100771303 3300005539 Bacteria 920
70 Ga0068855_100038668 3300005563 Bacteria 5669
71 Ga0068855_100044650 3300005563 Bacteria 5244
72 Ga0068855_100055407 3300005563 Bacteria 4657
73 Ga0068855_100512857 3300005563 Bacteria 1302
74 Ga0070664_100008560 3300005564 Bacteria 8276
75 Ga0070664_100058598 3300005564 Bacteria 3275
76 Ga0070664_100477177 3300005564 Bacteria 1147
77 Ga0068857_100003128 3300005577 Bacteria 13693
78 Ga0068857_100115118 3300005577 Unclassified 2419
79 Ga0068857_100835982 3300005577 Bacteria 880
80 Ga0068854_100025437 3300005578 Bacteria 4062
81 Ga0068854_100558896 3300005578 Bacteria 972
82 Ga0068854_100902241 3300005578 Bacteria 777
83 Ga0068854_101110984 3300005578 Bacteria 705
84 Ga0068856_100051277 3300005614 Bacteria 4068
85 Ga0068856_100179749 3300005614 Bacteria 2128
86 Ga0068856_100212110 3300005614 Bacteria 1952
87 Ga0068856_100246342 3300005614 Bacteria 1802
88 Ga0068856_100612821 3300005614 Bacteria 1109
89 Ga0068852_100010004 3300005616 Bacteria 7058
90 Ga0068852_100356262 3300005616 Unclassified 1430
91 Ga0068852_100504400 3300005616 Unclassified 1205
92 Ga0068852_101311621 3300005616 Bacteria 746
93 Ga0068859_100018821 3300005617 Bacteria 6938
94 Ga0068864_100013836 3300005618 Bacteria 6686
95 Ga0068864_100101802 3300005618 Bacteria 2548
96 Ga0068864_100336678 3300005618 Bacteria 1421
97 Ga0068861_100469105 3300005719 Bacteria 1132
98 Ga0068851_10009550 3300005834 Bacteria 4515
99 Ga0068851_10251688 3300005834 Unclassified 1002
100 Ga0068863_100017895 3300005841 Bacteria 6781
101 Ga0068863_100018870 3300005841 Bacteria 6600
102 Ga0068858_100405033 3300005842 Unclassified 1311
103 Ga0068860_100092874 3300005843 Bacteria 2876
104 Ga0075366_10297676 3300006195 Unclassified 987
105 Ga0097621_100449293 3300006237 Bacteria 1161
106 Ga0097620_100018821 3300006931 Bacteria 6938
107 Ga0105240_10097931 3300009093 Bacteria 3573
108 Ga0105247_10055680 3300009101 Bacteria 2440
109 Ga0105248_10028459 3300009177 Bacteria 6225
110 Ga0105248_10226935 3300009177 Unclassified 2102
111 Ga0105238_10288470 3300009551 Bacteria 1623
112 Ga0105246_10799902 3300011119 Unclassified 836
113 Ga0157373_10030859 3300013100 Bacteria 3856
114 Ga0157373_10902063 3300013100 Bacteria 656
115 Ga0157371_10007858 3300013102 Bacteria 8562
116 Ga0157371_10081229 3300013102 Bacteria 2295
117 Ga0157371_10104387 3300013102 Bacteria 2011
118 Ga0157371_10283388 3300013102 Bacteria 1197
119 Ga0157371_10383887 3300013102 Bacteria 1026
120 Ga0157371_10708080 3300013102 Bacteria 754
121 Ga0157370_10015186 3300013104 Bacteria 7842
122 Ga0157370_10088918 3300013104 Bacteria 2901
123 Ga0157370_10100465 3300013104 Bacteria 2710
124 Ga0157370_10154282 3300013104 Bacteria 2137
125 Ga0157369_10005054 3300013105 Bacteria 15446
126 Ga0157369_10048390 3300013105 Bacteria 4614
127 Ga0157369_10646396 3300013105 Bacteria 1091
128 Ga0157374_10312589 3300013296 Bacteria 1556
129 Ga0157374_10860049 3300013296 Bacteria 924
130 Ga0157372_10019700 3300013307 Bacteria 7272
131 Ga0157372_10159021 3300013307 Bacteria 2610
132 Ga0157372_10337075 3300013307 Bacteria 1757
133 Ga0157372_11370818 3300013307 Bacteria 815
134 Ga0157372_11502881 3300013307 Bacteria 776
135 Ga0163163_10046317 3300014325 Bacteria 4272
136 Ga0163163_10390854 3300014325 Unclassified 1449
137 Ga0157380_10845592 3300014326 Unclassified 936
138 Ga0157379_10008994 3300014968 Bacteria 8706
139 Ga0197907_11179033 3300020069 Bacteria 851
140 Ga0206353_10423651 3300020082 Bacteria 790
141 Ga0206353_10715458 3300020082 Bacteria 3679
142 Ga0213875_10007315 3300021388 Bacteria 5711
143 Ga0207656_10026166 3300025321 Bacteria 2376
144 Ga0207680_10342398 3300025903 Bacteria 1049
145 Ga0207647_10039686 3300025904 Bacteria 2969
146 Ga0207647_10057683 3300025904 Bacteria 2380
147 Ga0207647_10061207 3300025904 Bacteria 2298
148 Ga0207647_10257825 3300025904 Bacteria 999
149 Ga0207647_10433050 3300025904 Bacteria 738
150 Ga0207705_10004509 3300025909 Bacteria 10525
151 Ga0207705_10008140 3300025909 Bacteria 7677
152 Ga0207705_10008269 3300025909 Bacteria 7601
153 Ga0207705_10020148 3300025909 Bacteria 4771
154 Ga0207705_10118013 3300025909 Bacteria 1966
155 Ga0207705_10225550 3300025909 Bacteria 1424
156 Ga0207705_10226726 3300025909 Bacteria 1420
157 Ga0207705_10622735 3300025909 Bacteria 839
158 Ga0207707_10004841 3300025912 Bacteria 11810
159 Ga0207707_10103516 3300025912 Bacteria 2488
160 Ga0207707_10138997 3300025912 Bacteria 2124
161 Ga0207707_10917676 3300025912 Bacteria 723
162 Ga0207695_10282680 3300025913 Bacteria 1553
163 Ga0207693_10008871 3300025915 Bacteria 8213
164 Ga0207660_10003728 3300025917 Bacteria 9931
165 Ga0207660_10004828 3300025917 Bacteria 8774
166 Ga0207660_10159072 3300025917 Bacteria 1741
167 Ga0207657_10004234 3300025919 Bacteria 15204
168 Ga0207657_10006559 3300025919 Bacteria 12050
169 Ga0207657_10008545 3300025919 Bacteria 10381
170 Ga0207657_10230786 3300025919 Bacteria 1480
171 Ga0207649_10062587 3300025920 Bacteria 2346
172 Ga0207649_10449833 3300025920 Unclassified 972
173 Ga0207652_10010799 3300025921 Bacteria 7355
174 Ga0207652_10273040 3300025921 Unclassified 1525
175 Ga0207652_10446106 3300025921 Bacteria 1166
176 Ga0207652_10450550 3300025921 Bacteria 1160
177 Ga0207652_10615289 3300025921 Bacteria 973
178 Ga0207694_10760931 3300025924 Bacteria 818
179 Ga0207650_10395177 3300025925 Bacteria 1144
180 Ga0207700_10075882 3300025928 Bacteria 2606
181 Ga0207664_10827876 3300025929 Bacteria 832
182 Ga0207664_10873555 3300025929 Unclassified 808
183 Ga0207644_10028693 3300025931 Bacteria 3855
184 Ga0207644_10197119 3300025931 Unclassified 1586
185 Ga0207644_10233521 3300025931 Bacteria 1462
186 Ga0207644_10677408 3300025931 Bacteria 859
187 Ga0207690_10002872 3300025932 Bacteria 10374
188 Ga0207690_10005672 3300025932 Bacteria 7379
189 Ga0207690_10074561 3300025932 Bacteria 2350
190 Ga0207690_10292354 3300025932 Bacteria 1272
191 Ga0207706_10029723 3300025933 Bacteria 4877
192 Ga0207706_10283791 3300025933 Bacteria 1444
193 Ga0207706_10723063 3300025933 Bacteria 849
194 Ga0207711_10077051 3300025941 Bacteria 2905
195 Ga0207661_10013450 3300025944 Bacteria 5977
196 Ga0207661_10175284 3300025944 Bacteria 1869
197 Ga0207661_10822527 3300025944 Bacteria 855
198 Ga0207661_11304268 3300025944 Bacteria 667
199 Ga0207679_10145362 3300025945 Bacteria 1922
200 Ga0207679_10231913 3300025945 Bacteria 1559
201 Ga0207667_10043094 3300025949 Bacteria 4790
202 Ga0207667_11206326 3300025949 Bacteria 736
203 Ga0207651_10119596 3300025960 Bacteria 1995
204 Ga0207668_11365569 3300025972 Bacteria 638
205 Ga0207640_10003570 3300025981 Bacteria 8387
206 Ga0207640_10102521 3300025981 Bacteria 2010
207 Ga0207640_10143077 3300025981 Bacteria 1746
208 Ga0207658_10456140 3300025986 Unclassified 1132
209 Ga0207658_11158128 3300025986 Bacteria 707
210 Ga0207639_10078074 3300026041 Bacteria 2612
211 Ga0207639_11153917 3300026041 Bacteria 727
212 Ga0207639_11168153 3300026041 Bacteria 722
213 Ga0207678_10020047 3300026067 Bacteria 5874
214 Ga0207678_10062229 3300026067 Bacteria 3209
215 Ga0207702_10020619 3300026078 Bacteria 5455
216 Ga0207702_10037234 3300026078 Bacteria 4071
217 Ga0207702_10128579 3300026078 Bacteria 2277
218 Ga0207702_10387723 3300026078 Bacteria 1345
219 Ga0207641_10043648 3300026088 Bacteria 3766
220 Ga0207641_10778562 3300026088 Unclassified 945
221 Ga0207676_10038306 3300026095 Bacteria 3658
222 Ga0207676_10440530 3300026095 Bacteria 1226
223 Ga0207674_10000308 3300026116 Bacteria 62120
224 Ga0207674_10000780 3300026116 Bacteria 41514
225 Ga0207674_10010013 3300026116 Bacteria 10788
226 Ga0207675_100410291 3300026118 Bacteria 1336
227 Ga0207698_10020613 3300026142 Bacteria 4541
228 Ga0207698_11497793 3300026142 Bacteria 690
229 Ga0307405_10276406 3300031731 Archaea 1262
230 Ga0373923_0054367 3300035111 Bacteria 1685
231 Ga0373954_0055949 3300035118 Bacteria 1856
232 Ga0373956_0386769 3300035119 Bacteria 667
233 Ga0373943_0918271 3300035170 Unclassified 523
234 Ga0373946_0429628 3300035171 Bacteria 670
235 Ga0373955_0002447 3300035172 Bacteria 8107
236 Ga0373931_0265946 3300035691 Bacteria 1048
237 Ga0373935_0150008 3300035692 Bacteria 1581
238 Ga0373927_0536048 3300035695 Bacteria 774
239 Ga0373933_0062123 3300035724 Bacteria 2255
240 Ga0373937_0165693 3300036401 Bacteria 2072
241 Ga0395899_0000112 3300037312 Bacteria 138389
242 Ga0395899_0001656 3300037312 Bacteria 18573
243 Ga0395899_0016211 3300037312 Bacteria 5678
244 Ga0395899_0041416 3300037312 Bacteria 3441
245 Ga0395899_0079079 3300037312 Bacteria 2395
246 Ga0395899_0084617 3300037312 Bacteria 2305
247 Ga0395899_0150873 3300037312 Bacteria 1647
248 Ga0395899_0271560 3300037312 Bacteria 1156
249 Ga0395899_0314255 3300037312 Bacteria 1057
250 Ga0395899_0338985 3300037312 Bacteria 1008
251 Ga0395899_0506411 3300037312 Unclassified 782
252 Ga0395899_0574014 3300037312 Bacteria 722
253 Ga0395899_0805895 3300037312 Bacteria 580
254 Ga0395899_0942860 3300037312 Bacteria 524
255 Ga0395900_0000336 3300037418 Bacteria 69212
256 Ga0395900_0002089 3300037418 Bacteria 22389
257 Ga0395900_0018731 3300037418 Bacteria 7060
258 Ga0395900_0025245 3300037418 Bacteria 6083
259 Ga0395900_0030911 3300037418 Bacteria 5499
260 Ga0395900_0041598 3300037418 Bacteria 4737
261 Ga0395900_0058225 3300037418 Bacteria 3978
262 Ga0395900_0068802 3300037418 Bacteria 3638
263 Ga0395900_0074568 3300037418 Bacteria 3488
264 Ga0395900_0076414 3300037418 Bacteria 3442
265 Ga0395900_0156967 3300037418 Bacteria 2323
266 Ga0395900_0169582 3300037418 Bacteria 2223
267 Ga0395900_0193479 3300037418 Bacteria 2062
268 Ga0395900_0224326 3300037418 Bacteria 1892
269 Ga0395900_0261679 3300037418 Bacteria 1727
270 Ga0395900_0324655 3300037418 Bacteria 1518
271 Ga0395900_0436808 3300037418 Bacteria 1267
272 Ga0395900_0466158 3300037418 Bacteria 1217
273 Ga0395900_0574685 3300037418 Bacteria 1069
274 Ga0395900_0879017 3300037418 Bacteria 820
275 Ga0395900_1188086 3300037418 Bacteria 678
276 Ga0395900_1261869 3300037418 Unclassified 653
277 Ga0395898_0002211 3300037466 Bacteria 23748
278 Ga0395898_0013704 3300037466 Bacteria 8339
279 Ga0395898_0018403 3300037466 Bacteria 7122
280 Ga0395898_0038107 3300037466 Bacteria 4766
281 Ga0395898_0076644 3300037466 Bacteria 3228
282 Ga0395898_0080283 3300037466 Bacteria 3146
283 Ga0395898_0116763 3300037466 Bacteria 2557
284 Ga0395898_0119955 3300037466 Bacteria 2519
285 Ga0395898_0490899 3300037466 Bacteria 1168
286 Ga0395898_0571770 3300037466 Bacteria 1073
287 Ga0395898_0580869 3300037466 Bacteria 1063
288 Ga0395898_0584201 3300037466 Bacteria 1059
289 Ga0395898_0921297 3300037466 Bacteria 812
290 Ga0395905_0001353 3300037471 Bacteria 29855
291 Ga0395905_0005930 3300037471 Bacteria 12382
292 Ga0395905_0006356 3300037471 Bacteria 11909
293 Ga0395905_0011208 3300037471 Bacteria 8668
294 Ga0395905_0015993 3300037471 Bacteria 7131
295 Ga0395905_0017849 3300037471 Bacteria 6741
296 Ga0395905_0023103 3300037471 Bacteria 5878
297 Ga0395905_0026056 3300037471 Bacteria 5514
298 Ga0395905_0026138 3300037471 Bacteria 5506
299 Ga0395905_0035085 3300037471 Bacteria 4709
300 Ga0395905_0042827 3300037471 Bacteria 4247
301 Ga0395905_0045018 3300037471 Bacteria 4139
302 Ga0395905_0045019 3300037471 Bacteria 4139
303 Ga0395905_0053598 3300037471 Bacteria 3774
304 Ga0395905_0113485 3300037471 Bacteria 2546
305 Ga0395905_0124406 3300037471 Bacteria 2425
306 Ga0395905_0131641 3300037471 Bacteria 2352
307 Ga0395905_0173147 3300037471 Bacteria 2027
308 Ga0395905_0203550 3300037471 Bacteria 1855
309 Ga0395905_0207725 3300037471 Bacteria 1835
310 Ga0395905_0220386 3300037471 Bacteria 1775
311 Ga0395905_0221085 3300037471 Bacteria 1772
312 Ga0395905_0414775 3300037471 Bacteria 1242
313 Ga0395905_0489656 3300037471 Unclassified 1129
314 Ga0395905_0867753 3300037471 Unclassified 805
315 Ga0395905_1221803 3300037471 Unclassified 655
316 Ga0395905_1576678 3300037471 Unclassified 561
317 Ga0436364_1277856 3300037853 Bacteria 6630
318 Ga0395901_0000047 3300038443 Bacteria 175221
319 Ga0395901_0000770 3300038443 Bacteria 35923
320 Ga0395901_0011751 3300038443 Bacteria 8875
321 Ga0395901_0044332 3300038443 Bacteria 4613
322 Ga0395901_0054203 3300038443 Bacteria 4167
323 Ga0395901_0073354 3300038443 Bacteria 3569
324 Ga0395901_0100034 3300038443 Bacteria 3041
325 Ga0395901_0104438 3300038443 Bacteria 2973
326 Ga0395901_0170087 3300038443 Bacteria 2286
327 Ga0395901_0209980 3300038443 Bacteria 2038
328 Ga0395901_0281058 3300038443 Bacteria 1729
329 Ga0395901_0430229 3300038443 Unclassified 1352
330 Ga0395901_0435146 3300038443 Bacteria 1343
331 Ga0395901_1047517 3300038443 Bacteria 789
332 Ga0395901_1051510 3300038443 Bacteria 787
333 Ga0395901_1119281 3300038443 Bacteria 757
334 Ga0395901_1286865 3300038443 Bacteria 693
335 Ga0436365_1830787 3300039437 Bacteria 1232
336 Ga0439448_0001036 3300042005 Bacteria 6948
337 Ga0439458_0002203 3300042157 Bacteria 4813
338 Ga0466963_0033329 3300044694 Bacteria 3343
339 Ga0466963_0037609 3300044694 Bacteria 3161
340 Ga0466963_0077972 3300044694 Bacteria 2239
341 Ga0466963_0143673 3300044694 Bacteria 1654
342 Ga0466963_0209207 3300044694 Bacteria 1365
343 Ga0466964_0006111 3300044706 Bacteria 4489
344 Ga0466971_0301847 3300044719 Bacteria 769
345 Ga0466957_0004220 3300044842 Bacteria 7970
346 Ga0466957_0031713 3300044842 Bacteria 3159
347 Ga0466960_0221821 3300044901 Bacteria 1041
348 Ga0466960_0368905 3300044901 Bacteria 822
349 Ga0466959_0387654 3300045049 Bacteria 950
350 Ga0466958_0033341 3300045836 Bacteria 3068
351 Ga0466958_0200267 3300045836 Bacteria 1271
352 Ga0466958_0643190 3300045836 Unclassified 690
353 Ga0466958_0906049 3300045836 Bacteria 575
354 Ga0466967_0000409 3300045976 Bacteria 20274
355 Ga0466967_0006519 3300045976 Bacteria 8274
356 Ga0466967_0031758 3300045976 Bacteria 4451
357 Ga0466967_0076156 3300045976 Bacteria 3017
358 Ga0466967_0109393 3300045976 Unclassified 2537
359 Ga0495582_0224978 3300046473 Bacteria 1074
360 Ga0495623_0290403 3300046679 Bacteria 907
361 Ga0495669_0079895 3300046684 Bacteria 1500
362 Ga0496100_0251596 3300048903 Bacteria 1307
363 Ga0496101_0051680 3300048904 Bacteria 2962
364 Ga0496101_0421654 3300048904 Unclassified 1052
365 Ga0496103_0003471 3300048906 Bacteria 9633
366 Ga0496104_0082494 3300048907 Bacteria 3066
367 Ga0496105_0058381 3300048908 Bacteria 3185
368 Ga0496106_0246924 3300048909 Unclassified 1426
369 Ga0496107_0051009 3300048910 Bacteria 2983
370 Ga0496107_0605866 3300048910 Bacteria 809
371 Ga0496108_0005548 3300048911 Bacteria 10211
372 Ga0496108_0019144 3300048911 Bacteria 5618
373 Ga0496109_0008214 3300048912 Bacteria 8857
374 Ga0496109_1204038 3300048912 Bacteria 694
375 Ga0496110_0085482 3300048913 Bacteria 2815
376 Ga0496110_0086141 3300048913 Bacteria 2804
377 Ga0496111_0008161 3300048914 Bacteria 6920
378 Ga0496111_0028689 3300048914 Bacteria 3944
379 Ga0496112_0034465 3300048915 Bacteria 4926
380 Ga0496112_0047265 3300048915 Bacteria 4221
381 Ga0496112_0558486 3300048915 Unclassified 1078
382 Ga0496112_0579622 3300048915 Bacteria 1054
383 Ga0496113_0008017 3300048916 Bacteria 6849
384 Ga0496113_0074131 3300048916 Bacteria 2594
385 Ga0496114_0411735 3300048917 Unclassified 1197
386 Ga0501067_0096536 3300049583 Bacteria 1641
387 Ga0501068_0012439 3300049584 Bacteria 4827
388 Ga0501073_0363792 3300049589 Bacteria 999
389 Ga0501074_0265047 3300049590 Bacteria 1221
390 Ga0070661_101155706
391 JGI24741J21665_1015860
392 JGI24739J22299_10025417
393 JGI24737J22298_10000516
394 JGI24737J22298_10003950
395 JGI24743J22301_10012711
396 JGI24735J21928_10049349
397 JGI24735J21928_10069293
398 JGI24738J21930_10068199
399 Ga0070658_10283911
400 Ga0070658_10472625
401 Ga0070658_10610119
402 Ga0070658_11495770
403 Ga0070683_100002165
404 Ga0070683_100098027
405 Ga0070683_101104717
406 Ga0070670_100315717
407 Ga0070670_100782785
408 Ga0068869_100660989
409 Ga0068869_100697226
410 Ga0070666_10021810
411 Ga0070680_100003672
412 Ga0070680_100010477
413 Ga0070680_101059906
414 Ga0068868_100453578
415 Ga0070660_100075698
416 Ga0070660_100146194
417 Ga0070660_100230407
418 Ga0070660_100676192
419 Ga0070661_100036538
420 Ga0070661_100127413
421 Ga0070692_10043649
422 Ga0070668_101571889
423 Ga0070669_100883922
424 Ga0070671_100004740
425 Ga0070671_100008369
426 Ga0070671_100017298
427 Ga0070671_100717755
428 Ga0070673_100435727
429 Ga0070659_100003560
430 Ga0070659_100052490
431 Ga0070659_100099043
432 Ga0070659_100132460
433 Ga0070667_100026825
434 Ga0070709_10098453
435 Ga0070714_100128257
436 Ga0070714_100288852
437 Ga0070714_101067879
438 Ga0070663_100130861
439 Ga0070663_100437477
440 Ga0070662_100019462
441 Ga0070662_100181917
442 Ga0070662_100861087
443 Ga0070681_10104384
444 Ga0070681_10161777
445 Ga0070681_10207380
446 Ga0070681_10318222
447 Ga0070681_11102912
448 Ga0070707_101459153
449 Ga0070679_100017863
450 Ga0070679_100151057
451 Ga0070679_100512500
452 Ga0070684_100006623
453 Ga0070684_100038517
454 Ga0070684_100339664
455 Ga0068853_100074002
456 Ga0068853_100242470
457 Ga0068853_100251607
458 Ga0068853_100771303
459 Ga0068855_100038668
460 Ga0068855_100044650
461 Ga0068855_100055407
462 Ga0068855_100512857
463 Ga0070664_100008560
464 Ga0070664_100058598
465 Ga0070664_100477177
466 Ga0068857_100003128
467 Ga0068857_100115118
468 Ga0068857_100835982
469 Ga0068854_100025437
470 Ga0068854_100558896
471 Ga0068854_100902241
472 Ga0068854_101110984
473 Ga0068856_100051277
474 Ga0068856_100179749
475 Ga0068856_100212110
476 Ga0068856_100246342
477 Ga0068856_100612821
478 Ga0068852_100010004
479 Ga0068852_100356262
480 Ga0068852_100504400
481 Ga0068852_101311621
482 Ga0068859_100018821
483 Ga0068864_100013836
484 Ga0068864_100101802
485 Ga0068864_100336678
486 Ga0068861_100469105
487 Ga0068851_10009550
488 Ga0068851_10251688
489 Ga0068863_100017895
490 Ga0068863_100018870
491 Ga0068858_100405033
492 Ga0068860_100092874
493 Ga0075366_10297676
494 Ga0097621_100449293
495 Ga0097620_100018821
496 Ga0105240_10097931
497 Ga0105247_10055680
498 Ga0105248_10028459
499 Ga0105248_10226935
500 Ga0105238_10288470
501 Ga0105246_10799902
502 Ga0157373_10030859
503 Ga0157373_10902063
504 Ga0157371_10007858
505 Ga0157371_10081229
506 Ga0157371_10104387
507 Ga0157371_10283388
508 Ga0157371_10383887
509 Ga0157371_10708080
510 Ga0157370_10015186
511 Ga0157370_10088918
512 Ga0157370_10100465
513 Ga0157370_10154282
514 Ga0157369_10005054
515 Ga0157369_10048390
516 Ga0157369_10646396
517 Ga0157374_10312589
518 Ga0157374_10860049
519 Ga0157372_10019700
520 Ga0157372_10159021
521 Ga0157372_10337075
522 Ga0157372_11370818
523 Ga0157372_11502881
524 Ga0163163_10046317
525 Ga0163163_10390854
526 Ga0157380_10845592
527 Ga0157379_10008994
528 Ga0197907_11179033
529 Ga0206353_10423651
530 Ga0206353_10715458
531 Ga0213875_10007315
532 Ga0207656_10026166
533 Ga0207680_10342398
534 Ga0207647_10039686
535 Ga0207647_10057683
536 Ga0207647_10061207
537 Ga0207647_10257825
538 Ga0207647_10433050
539 Ga0207705_10004509
540 Ga0207705_10008140
541 Ga0207705_10008269
542 Ga0207705_10020148
543 Ga0207705_10118013
544 Ga0207705_10225550
545 Ga0207705_10226726
546 Ga0207705_10622735
547 Ga0207707_10004841
548 Ga0207707_10103516
549 Ga0207707_10138997
550 Ga0207707_10917676
551 Ga0207695_10282680
552 Ga0207693_10008871
553 Ga0207660_10003728
554 Ga0207660_10004828
555 Ga0207660_10159072
556 Ga0207657_10004234
557 Ga0207657_10006559
558 Ga0207657_10008545
559 Ga0207657_10230786
560 Ga0207649_10062587
561 Ga0207649_10449833
562 Ga0207652_10010799
563 Ga0207652_10273040
564 Ga0207652_10446106
565 Ga0207652_10450550
566 Ga0207652_10615289
567 Ga0207694_10760931
568 Ga0207650_10395177
569 Ga0207700_10075882
570 Ga0207664_10827876
571 Ga0207664_10873555
572 Ga0207644_10028693
573 Ga0207644_10197119
574 Ga0207644_10233521
575 Ga0207644_10677408
576 Ga0207690_10002872
577 Ga0207690_10005672
578 Ga0207690_10074561
579 Ga0207690_10292354
580 Ga0207706_10029723
581 Ga0207706_10283791
582 Ga0207706_10723063
583 Ga0207711_10077051
584 Ga0207661_10013450
585 Ga0207661_10175284
586 Ga0207661_10822527
587 Ga0207661_11304268
588 Ga0207679_10145362
589 Ga0207679_10231913
590 Ga0207667_10043094
591 Ga0207667_11206326
592 Ga0207651_10119596
593 Ga0207668_11365569
594 Ga0207640_10003570
595 Ga0207640_10102521
596 Ga0207640_10143077
597 Ga0207658_10456140
598 Ga0207658_11158128
599 Ga0207639_10078074
600 Ga0207639_11153917
601 Ga0207639_11168153
602 Ga0207678_10020047
603 Ga0207678_10062229
604 Ga0207702_10020619
605 Ga0207702_10037234
606 Ga0207702_10128579
607 Ga0207702_10387723
608 Ga0207641_10043648
609 Ga0207641_10778562
610 Ga0207676_10038306
611 Ga0207676_10440530
612 Ga0207674_10000308
613 Ga0207674_10000780
614 Ga0207674_10010013
615 Ga0207675_100410291
616 Ga0207698_10020613
617 Ga0207698_11497793
618 Ga0307405_10276406
619 Ga0373923_0054367
620 Ga0373954_0055949
621 Ga0373956_0386769
622 Ga0373943_0918271
623 Ga0373946_0429628
624 Ga0373955_0002447
625 Ga0373931_0265946
626 Ga0373935_0150008
627 Ga0373927_0536048
628 Ga0373933_0062123
629 Ga0373937_0165693
630 Ga0395899_0000112
631 Ga0395899_0001656
632 Ga0395899_0016211
633 Ga0395899_0041416
634 Ga0395899_0079079
635 Ga0395899_0084617
636 Ga0395899_0150873
637 Ga0395899_0271560
638 Ga0395899_0314255
639 Ga0395899_0338985
640 Ga0395899_0506411
641 Ga0395899_0574014
642 Ga0395899_0805895
643 Ga0395899_0942860
644 Ga0395900_0000336
645 Ga0395900_0002089
646 Ga0395900_0018731
647 Ga0395900_0025245
648 Ga0395900_0030911
649 Ga0395900_0041598
650 Ga0395900_0058225
651 Ga0395900_0068802
652 Ga0395900_0074568
653 Ga0395900_0076414
654 Ga0395900_0156967
655 Ga0395900_0169582
656 Ga0395900_0193479
657 Ga0395900_0224326
658 Ga0395900_0261679
659 Ga0395900_0324655
660 Ga0395900_0436808
661 Ga0395900_0466158
662 Ga0395900_0574685
663 Ga0395900_0879017
664 Ga0395900_1188086
665 Ga0395900_1261869
666 Ga0395898_0002211
667 Ga0395898_0013704
668 Ga0395898_0018403
669 Ga0395898_0038107
670 Ga0395898_0076644
671 Ga0395898_0080283
672 Ga0395898_0116763
673 Ga0395898_0119955
674 Ga0395898_0490899
675 Ga0395898_0571770
676 Ga0395898_0580869
677 Ga0395898_0584201
678 Ga0395898_0921297
679 Ga0395905_0001353
680 Ga0395905_0005930
681 Ga0395905_0006356
682 Ga0395905_0011208
683 Ga0395905_0015993
684 Ga0395905_0017849
685 Ga0395905_0023103
686 Ga0395905_0026056
687 Ga0395905_0026138
688 Ga0395905_0035085
689 Ga0395905_0042827
690 Ga0395905_0045018
691 Ga0395905_0045019
692 Ga0395905_0053598
693 Ga0395905_0113485
694 Ga0395905_0124406
695 Ga0395905_0131641
696 Ga0395905_0173147
697 Ga0395905_0203550
698 Ga0395905_0207725
699 Ga0395905_0220386
700 Ga0395905_0221085
701 Ga0395905_0414775
702 Ga0395905_0489656
703 Ga0395905_0867753
704 Ga0395905_1221803
705 Ga0395905_1576678
706 Ga0436364_1277856
707 Ga0395901_0000047
708 Ga0395901_0000770
709 Ga0395901_0011751
710 Ga0395901_0044332
711 Ga0395901_0054203
712 Ga0395901_0073354
713 Ga0395901_0100034
714 Ga0395901_0104438
715 Ga0395901_0170087
716 Ga0395901_0209980
717 Ga0395901_0281058
718 Ga0395901_0430229
719 Ga0395901_0435146
720 Ga0395901_1047517
721 Ga0395901_1051510
722 Ga0395901_1119281
723 Ga0395901_1286865
724 Ga0436365_1830787
725 Ga0439448_0001036
726 Ga0439458_0002203
727 Ga0466963_0033329
728 Ga0466963_0037609
729 Ga0466963_0077972
730 Ga0466963_0143673
731 Ga0466963_0209207
732 Ga0466964_0006111
733 Ga0466971_0301847
734 Ga0466957_0004220
735 Ga0466957_0031713
736 Ga0466960_0221821
737 Ga0466960_0368905
738 Ga0466959_0387654
739 Ga0466958_0033341
740 Ga0466958_0200267
741 Ga0466958_0643190
742 Ga0466958_0906049
743 Ga0466967_0000409
744 Ga0466967_0006519
745 Ga0466967_0031758
746 Ga0466967_0076156
747 Ga0466967_0109393
748 Ga0495582_0224978
749 Ga0495623_0290403
750 Ga0495669_0079895
751 Ga0496100_0251596
752 Ga0496101_0051680
753 Ga0496101_0421654
754 Ga0496103_0003471
755 Ga0496104_0082494
756 Ga0496105_0058381
757 Ga0496106_0246924
758 Ga0496107_0051009
759 Ga0496107_0605866
760 Ga0496108_0005548
761 Ga0496108_0019144
762 Ga0496109_0008214
763 Ga0496109_1204038
764 Ga0496110_0085482
765 Ga0496110_0086141
766 Ga0496111_0008161
767 Ga0496111_0028689
768 Ga0496112_0034465
769 Ga0496112_0047265
770 Ga0496112_0558486
771 Ga0496112_0579622
772 Ga0496113_0008017
773 Ga0496113_0074131
774 Ga0496114_0411735
775 Ga0501067_0096536
776 Ga0501068_0012439
777 Ga0501073_0363792
778 Ga0501074_0265047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01316

Arg_repressor

Arginine repressor, DNA binding domain

29

96

0.96

PF02863

Arg_repressor_C

Arginine repressor, C-terminal domain

106

173

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b4b-assembly1.cif.gz_A structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus 0.9652 81 148
2p5l-assembly2.cif.gz_H crystal structure of a dimer of n-terminal domains of ahrc in complex with an 18bp dna operator site 0.9403 5 65
6wjo-assembly1.cif.gz_B crystal structure of wild-type arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis bound to tyrosine 0.9276 77 146
1b4b-assembly1.cif.gz_A structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus 0.9133 81 148
2p5m-assembly1.cif.gz_A c-terminal domain hexamer of ahrc bound with l-arginine 0.9116 72 149
ID Description Score Start End Superfamily
1f9nF02 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9522 81 146 3.30.1360.40
2p5lC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9436 5 65 1.10.10.10
2p5lH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 5 65 1.10.10.10
af_Q2FUX5_70_149_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9152 74 146 3.30.1360.40
2p5mA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9116 72 149 3.30.1360.40
ID Description Score Start End GO Terms
AF-A0A523V7A1-F1-model_v4 Arginine repressor 0.9765 77 146 GO:0003700
GO:0034618
GO:0051259
AF-A0A1F2WWN3-F1-model_v4 Arginine repressor 0.9744 81 151 GO:0003677
GO:0003700
GO:0005737
GO:0006526
GO:0034618
GO:0051259
GO:1900079
AF-A0A4Y8XTA5-F1-model_v4 deleted 0.9696 76 151
AF-A0A380P2R8-F1-model_v4 Arginine repressor 0.969 84 148 GO:0003677
GO:0003700
GO:0005737
GO:0006526
GO:0034618
GO:0051259
GO:1900079
AF-A0A5A5U3F8-F1-model_v4 Arginine repressor C-terminal domain-containing protein 0.964 77 150 GO:0003700
GO:0034618
GO:0051259

Map