F431276

General Info

Members Datasets Scaffolds Average Seq Length
388 212 266 600

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2602042109|2603868047
Length 651
Sequence KPERDANRRGSRVFLFLILSRRLSVGSGSKEKSMEYKALAQDILHRVGGKENIVSLVHCATRLRFKLKDNAKADAEGLKANPGVIMVVESGGQFQVVIGNHVHDVWLAVRQQAGLSDDSEPVPQEKAAKSSVLSQLIDIISGIFTPFIGVMAATGLLKGLLALALTCGWLTPQQGTYKIWFAASDALFFFFPLFLGYTAGKKFGGNPFISMVIGGALTHPLMIQAFEASQTGAPVEHFLGIPVTYINYSSSVIPIILASWVCCWLERKSNAVLPSAMKNFFTPAICLAVVVPLTFLVIGPLATWLSHMIANGYQVIYVFAPWLAGAVLGALWQVCVIFGLHWGLIPLMINNMTVLGHDSMLPIILPAVIAQVGAVLGILLATRDSRQRMLAGSAFSAGLFGITEPAIYGLTLPLRRPFIFGCIAGAIGGAITAFSNSYAYSFGVPNIFFPAQMIPPGGIDFSVWGGLIGTGVAFILACVLTFFAGMPRSQAEQTVVIASAAENDILAPMSGSVLALDQVPDSTFASGLLGKGVAIIPAVGKVIAPFSGEVASLFQTKHAIGLLSDSGIELLIHVGIDTVKLDGVPFTAHVKEGDKVQAGDLLLEFDRQAILDAGYDLATPIIISNSDDYRSVEIVSASVVDAGQPLLSVSH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
7 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
8 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
9 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
10 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
11 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
12 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
13 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
14 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
15 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
16 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
17 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
18 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
19 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
20 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
21 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
22 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
23 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
24 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
25 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
26 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
27 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
28 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
29 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
30 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
31 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
32 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
33 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
34 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
35 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
36 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
37 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
38 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
39 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
40 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
41 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
42 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
43 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
44 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
45 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
46 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
47 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
48 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
49 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
50 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
51 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
52 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
53 2636415599 Klebsiella variicola DX120E Isolate Unclassified
54 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
55 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
56 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
57 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
58 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
59 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
60 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
61 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
62 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
63 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
64 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
65 2751185917 Enterobacter sp. HK169 Isolate Unclassified
66 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
67 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
68 2775507074 Klebsiella sp. D5A Isolate Unclassified
69 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
70 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
71 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
72 2821118458 Enterobacter asburiae 609 Isolate Unclassified
73 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
74 2847085930 Erwinia persicina B64 Isolate Bulb
75 2849139964 Bacillus sp. R-71875 Isolate Unclassified
76 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
77 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
78 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
79 2865014394 Pantoea sp. R-71966 Isolate Unclassified
80 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
81 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
82 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
83 2876601092 Pantoea endophytica 596 Isolate Unclassified
84 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
85 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
86 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
87 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
88 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
89 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
90 2904504865 Serratia marcescens 1822 Isolate Unclassified
91 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
92 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
93 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
94 2919150387 Rahnella aceris 1817 Isolate Unclassified
95 2927143783 Rahnella sp. 2050 Isolate Unclassified
96 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
97 2932406140 Serratia sp. 2723 Isolate Rhizosphere
98 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
99 2937967321 Serratia sp. YC16 Isolate Unclassified
100 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
101 2939577877 Serratia sp. 509 Isolate Rhizosphere
102 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
103 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
104 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
105 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
106 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
107 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
108 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
109 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
110 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
111 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
112 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
113 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
114 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
115 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
116 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
117 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
118 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
119 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
120 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
121 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
122 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
123 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
124 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
125 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
128 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
129 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
130 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
163 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
203 8004592986 Serratia sp. S119 Isolate Unclassified
204 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
205 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
206 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
207 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
208 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
209 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
210 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
211 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
212 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.56
Metatranscriptomes 0
Isolates 31.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0.26
Endosphere 5.41
Nodule 2.84
Rhizoplane 14.18
Rhizosphere 40.98
Stem 0
Stem Tuber 1.55
Unclassified 34.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1282399 2162886007 Bacteria 3772
2 JGI25162J39368_1000019 3300002737 Bacteria 262053
3 JGI25163J39215_1000079 3300002771 Bacteria 42883
4 JGI25164J39214_1000011 3300002772 Bacteria 262057
5 rootH2_10008161 3300003320 Bacteria 23559
6 Ga0055538_1000021 3300003751 Bacteria 262057
7 Ga0055539_1000026 3300003752 Bacteria 262057
8 Ga0055533_1000035 3300003756 Bacteria 262057
9 Ga0055525_1000045 3300003759 Bacteria 262057
10 Ga0055541_1000020 3300003841 Bacteria 262057
11 Ga0058692_1000332 3300003856 Bacteria 23453
12 Ga0058692_1000728 3300003856 Bacteria 13378
13 Ga0058692_1001941 3300003856 Bacteria 7209
14 Ga0065704_10001487 3300005289 Bacteria 15750
15 Ga0065704_10078395 3300005289 Bacteria 4442
16 Ga0065704_10091397 3300005289 Bacteria 2720
17 Ga0068857_100000333 3300005577 Bacteria 32544
18 Ga0075364_10024899 3300006051 Bacteria 3805
19 Ga0079104_1000250 3300006946 Bacteria 72013
20 Ga0079104_1001116 3300006946 Bacteria 19706
21 Ga0079104_1001814 3300006946 Bacteria 13178
22 Ga0079104_1002813 3300006946 Bacteria 8758
23 Ga0105251_10000045 3300009011 Bacteria 113579
24 Ga0105251_10000223 3300009011 Bacteria 57260
25 Ga0105251_10000377 3300009011 Bacteria 43767
26 Ga0105251_10001108 3300009011 Bacteria 23414
27 Ga0105251_10001228 3300009011 Bacteria 22219
28 Ga0105251_10002752 3300009011 Bacteria 13431
29 Ga0105251_10007029 3300009011 Bacteria 7021
30 Ga0105251_10011570 3300009011 Bacteria 5035
31 Ga0105244_10000009 3300009036 Bacteria 286143
32 Ga0105244_10000056 3300009036 Bacteria 130022
33 Ga0105244_10001873 3300009036 Bacteria 16352
34 Ga0105244_10002429 3300009036 Bacteria 14053
35 Ga0105244_10008750 3300009036 Bacteria 6295
36 Ga0105244_10009001 3300009036 Bacteria 6179
37 Ga0105244_10010880 3300009036 Bacteria 5489
38 Ga0105244_10012490 3300009036 Bacteria 5014
39 Ga0105244_10018699 3300009036 Bacteria 3881
40 Ga0105250_10000011 3300009092 Bacteria 276144
41 Ga0105250_10000018 3300009092 Bacteria 246692
42 Ga0105250_10005316 3300009092 Bacteria 5779
43 Ga0105247_10000610 3300009101 Bacteria 28776
44 Ga0105241_10000010 3300009174 Bacteria 253836
45 Ga0105246_10019002 3300011119 Bacteria 4384
46 Ga0157373_10000911 3300013100 Bacteria 22918
47 Ga0157373_10029339 3300013100 Bacteria 3962
48 Ga0157371_10000098 3300013102 Bacteria 134017
49 Ga0157371_10000491 3300013102 Bacteria 47942
50 Ga0157371_10040537 3300013102 Bacteria 3325
51 Ga0157370_10001743 3300013104 Bacteria 26769
52 Ga0163162_10013391 3300013306 Bacteria 8009
53 Ga0157372_10001823 3300013307 Bacteria 23107
54 Ga0182008_10008703 3300014497 Bacteria 5520
55 Ga0182008_10022641 3300014497 Bacteria 3217
56 Ga0163161_10000006 3300017792 Bacteria 302708
57 Ga0213876_10000023 3300021384 Bacteria 255370
58 Ga0209760_100004 3300025207 Bacteria 254650
59 Ga0209784_100001 3300025224 Bacteria 3600592
60 Ga0209566_100001 3300025225 Bacteria 3600765
61 Ga0209674_100002 3300025226 Bacteria 3600592
62 Ga0209563_100002 3300025230 Bacteria 2045675
63 Ga0207427_100012 3300025231 Bacteria 585657
64 Ga0209437_100001 3300025233 Bacteria 2045675
65 Ga0209677_100002 3300025253 Bacteria 2045675
66 Ga0209129_1000037 3300025258 Bacteria 326534
67 Ga0209233_1003483 3300025261 Bacteria 5533
68 Ga0207696_1000013 3300025711 Bacteria 524881
69 Ga0207696_1000026 3300025711 Bacteria 418166
70 Ga0207696_1000046 3300025711 Bacteria 291327
71 Ga0207696_1000113 3300025711 Bacteria 151878
72 Ga0207696_1000298 3300025711 Bacteria 57382
73 Ga0207696_1002830 3300025711 Bacteria 8212
74 Ga0207696_1003136 3300025711 Bacteria 7708
75 Ga0207696_1011744 3300025711 Bacteria 3136
76 Ga0207655_1000002 3300025728 Bacteria 1148694
77 Ga0207655_1000004 3300025728 Bacteria 1021221
78 Ga0207655_1000036 3300025728 Bacteria 356747
79 Ga0207655_1000229 3300025728 Bacteria 93185
80 Ga0207655_1000288 3300025728 Bacteria 76899
81 Ga0207655_1000468 3300025728 Bacteria 52445
82 Ga0207655_1031489 3300025728 Bacteria 2443
83 Ga0207713_1000004 3300025735 Bacteria 702781
84 Ga0207713_1000023 3300025735 Bacteria 346097
85 Ga0207713_1000047 3300025735 Bacteria 229463
86 Ga0207713_1000056 3300025735 Bacteria 217615
87 Ga0207713_1000075 3300025735 Bacteria 179242
88 Ga0207713_1000911 3300025735 Bacteria 26641
89 Ga0207713_1001772 3300025735 Bacteria 16539
90 Ga0207713_1002867 3300025735 Bacteria 12110
91 Ga0207713_1008268 3300025735 Bacteria 6014
92 Ga0207710_10000024 3300025900 Bacteria 319633
93 Ga0207654_10000010 3300025911 Bacteria 304367
94 Ga0207674_10000573 3300026116 Bacteria 48332
95 Ga0209281_1000004 3300027111 Bacteria 1253949
96 Ga0209281_1000139 3300027111 Bacteria 179588
97 Ga0209281_1000291 3300027111 Bacteria 91918
98 Ga0209281_1000379 3300027111 Bacteria 70495
99 Ga0209281_1000694 3300027111 Bacteria 34337
100 Ga0209281_1000749 3300027111 Bacteria 31356
101 Ga0209281_1002098 3300027111 Bacteria 8897
102 Ga0209371_1000001 3300027312 Bacteria 2771503
103 Ga0209371_1000002 3300027312 Bacteria 1551985
104 Ga0209371_1000015 3300027312 Bacteria 659640
105 Ga0209371_1001282 3300027312 Bacteria 17695
106 Ga0209371_1001428 3300027312 Bacteria 16273
107 Ga0209371_1005463 3300027312 Bacteria 5040
108 Ga0209371_1006165 3300027312 Bacteria 4526
109 Ga0209371_1011621 3300027312 Bacteria 2602
110 Ga0268256_1000001 3300030500 Bacteria 2771065
111 Ga0268256_1000002 3300030500 Bacteria 1535763
112 Ga0268256_1000018 3300030500 Bacteria 594572
113 Ga0268256_1000572 3300030500 Bacteria 29655
114 Ga0268256_1001071 3300030500 Bacteria 18111
115 Ga0268256_1001790 3300030500 Bacteria 12093
116 Ga0268256_1003684 3300030500 Bacteria 6757
117 Ga0268256_1005621 3300030500 Bacteria 4872
118 Ga0436365_0965775 3300039437 Bacteria 470291
119 Ga0439438_000503 3300041405 Bacteria 17737
120 Ga0439466_0000503 3300041411 Bacteria 14797
121 Ga0439432_000104 3300042006 Bacteria 26816
122 Ga0439432_005099 3300042006 Bacteria 4750
123 Ga0439452_000020 3300042010 Bacteria 309345
124 Ga0439452_000032 3300042010 Bacteria 184797
125 Ga0439452_000090 3300042010 Bacteria 78724
126 Ga0495627_000096 3300046453 Bacteria 107809
127 Ga0495591_000006 3300046458 Bacteria 390570
128 Ga0495591_000050 3300046458 Bacteria 137772
129 Ga0495591_000921 3300046458 Bacteria 20296
130 Ga0495650_0000113 3300046471 Bacteria 196536
131 Ga0495650_0000182 3300046471 Bacteria 137031
132 Ga0495585_0010496 3300046492 Bacteria 5510
133 Ga0495596_0003874 3300046500 Bacteria 7427
134 Ga0495606_0001088 3300046507 Bacteria 38905
135 Ga0495643_0030543 3300046522 Bacteria 3008
136 Ga0495648_0024356 3300046524 Bacteria 4124
137 Ga0495654_0000013 3300046530 Bacteria 327576
138 Ga0495654_0002845 3300046530 Bacteria 10867
139 Ga0495654_0010389 3300046530 Bacteria 5066
140 Ga0495597_0000293 3300046542 Bacteria 44977
141 Ga0495625_0005781 3300046660 Bacteria 11178
142 Ga0495671_0012738 3300046692 Bacteria 4582
143 Ga0495649_0012559 3300046694 Bacteria 4920
144 Ga0495660_0000004 3300046810 Bacteria 1003183
145 Ga0495660_0000034 3300046810 Bacteria 201261
146 Ga0495672_0000029 3300047320 Bacteria 305231
147 Ga0495672_0000070 3300047320 Bacteria 184471
148 Ga0495672_0000096 3300047320 Bacteria 143686
149 Ga0495679_000021 3300047446 Bacteria 226183
150 Ga0495679_003207 3300047446 Bacteria 7946
151 Ga0495673_0000820 3300047469 Bacteria 29164
152 Ga0496100_0045268 3300048903 Bacteria 2823
153 Ga0496101_0000006 3300048904 Bacteria 329135
154 Ga0496103_0061575 3300048906 Bacteria 2334
155 Ga0496104_0000385 3300048907 Bacteria 38635
156 Ga0496104_0011571 3300048907 Bacteria 7905
157 Ga0496104_0169116 3300048907 Bacteria 2096
158 Ga0496105_0058149 3300048908 Bacteria 3191
159 Ga0496116_0000058 3300048919 Bacteria 279767
160 Ga0496116_0000094 3300048919 Bacteria 205588
161 Ga0496116_0000576 3300048919 Bacteria 49121
162 Ga0496116_0002263 3300048919 Bacteria 20411
163 Ga0496116_0041582 3300048919 Bacteria 3152
164 Ga0496117_0000639 3300048920 Bacteria 56383
165 Ga0496117_0000973 3300048920 Bacteria 43846
166 Ga0496117_0001432 3300048920 Bacteria 34429
167 Ga0496117_0001969 3300048920 Bacteria 27292
168 Ga0496117_0003385 3300048920 Bacteria 18575
169 Ga0496117_0003512 3300048920 Bacteria 18161
170 Ga0496117_0003655 3300048920 Bacteria 17691
171 Ga0496117_0010181 3300048920 Bacteria 8624
172 Ga0496117_0014636 3300048920 Bacteria 6746
173 Ga0496117_0023257 3300048920 Bacteria 4945
174 Ga0496118_0000157 3300048921 Bacteria 121411
175 Ga0496118_0000915 3300048921 Bacteria 46107
176 Ga0496118_0001909 3300048921 Bacteria 29643
177 Ga0496118_0002414 3300048921 Bacteria 25207
178 Ga0496118_0003326 3300048921 Bacteria 20347
179 Ga0496118_0010246 3300048921 Bacteria 9304
180 Ga0496118_0010422 3300048921 Bacteria 9208
181 Ga0496118_0012766 3300048921 Bacteria 8022
182 Ga0496118_0016114 3300048921 Bacteria 6874
183 Ga0496118_0024595 3300048921 Bacteria 5193
184 Ga0496118_0027829 3300048921 Bacteria 4774
185 Ga0496118_0033641 3300048921 Bacteria 4201
186 Ga0496119_0000005 3300048922 Bacteria 529799
187 Ga0496119_0000039 3300048922 Bacteria 208631
188 Ga0496119_0000049 3300048922 Bacteria 185482
189 Ga0496119_0000697 3300048922 Bacteria 45018
190 Ga0496119_0001036 3300048922 Bacteria 35548
191 Ga0496119_0001206 3300048922 Bacteria 32260
192 Ga0496119_0003423 3300048922 Bacteria 16479
193 Ga0496119_0003875 3300048922 Bacteria 15249
194 Ga0496119_0004075 3300048922 Bacteria 14734
195 Ga0496119_0004545 3300048922 Bacteria 13747
196 Ga0496119_0011714 3300048922 Bacteria 7217
197 Ga0496119_0013273 3300048922 Bacteria 6583
198 Ga0496119_0031572 3300048922 Bacteria 3549
199 Ga0496120_0000002 3300048923 Bacteria 547999
200 Ga0496120_0000005 3300048923 Bacteria 529797
201 Ga0496120_0000010 3300048923 Bacteria 385791
202 Ga0496120_0000016 3300048923 Bacteria 307608
203 Ga0496120_0000069 3300048923 Bacteria 165694
204 Ga0496120_0001249 3300048923 Bacteria 32021
205 Ga0496120_0001277 3300048923 Bacteria 31458
206 Ga0496120_0001499 3300048923 Bacteria 27638
207 Ga0496120_0001616 3300048923 Bacteria 26133
208 Ga0496120_0002829 3300048923 Bacteria 16737
209 Ga0496120_0005227 3300048923 Bacteria 10438
210 Ga0496120_0005390 3300048923 Bacteria 10224
211 Ga0496120_0006875 3300048923 Bacteria 8593
212 Ga0496120_0008335 3300048923 Bacteria 7545
213 Ga0496121_0003267 3300048924 Bacteria 23305
214 Ga0496121_0003538 3300048924 Bacteria 22138
215 Ga0496121_0004231 3300048924 Bacteria 19535
216 Ga0496121_0005244 3300048924 Bacteria 16761
217 Ga0496121_0010025 3300048924 Bacteria 10762
218 Ga0496121_0078083 3300048924 Bacteria 2633
219 Ga0496122_0000003 3300048925 Bacteria 645810
220 Ga0496122_0000007 3300048925 Bacteria 606493
221 Ga0496122_0000088 3300048925 Bacteria 207600
222 Ga0496122_0007744 3300048925 Bacteria 11817
223 Ga0496122_0008487 3300048925 Bacteria 11064
224 Ga0496122_0013917 3300048925 Bacteria 7825
225 Ga0496122_0014520 3300048925 Bacteria 7603
226 Ga0496122_0019396 3300048925 Bacteria 6214
227 Ga0496122_0032888 3300048925 Bacteria 4276
228 Ga0496123_0000004 3300048926 Bacteria 777230
229 Ga0496123_0000012 3300048926 Bacteria 458760
230 Ga0496123_0000139 3300048926 Bacteria 151469
231 Ga0496123_0001291 3300048926 Bacteria 35699
232 Ga0496123_0004052 3300048926 Bacteria 15790
233 Ga0496123_0004895 3300048926 Bacteria 13759
234 Ga0496123_0008206 3300048926 Bacteria 9630
235 Ga0496123_0018262 3300048926 Bacteria 5585
236 Ga0496123_0043949 3300048926 Bacteria 3060
237 Ga0496123_0046990 3300048926 Bacteria 2921
238 Ga0496123_0055846 3300048926 Bacteria 2586
239 Ga0496124_0000025 3300048927 Bacteria 405471
240 Ga0496124_0000045 3300048927 Bacteria 287396
241 Ga0496124_0000136 3300048927 Bacteria 151846
242 Ga0496124_0000611 3300048927 Bacteria 60081
243 Ga0496124_0000627 3300048927 Bacteria 58705
244 Ga0496124_0008815 3300048927 Bacteria 10477
245 Ga0496124_0017388 3300048927 Bacteria 6777
246 Ga0496124_0018869 3300048927 Bacteria 6440
247 Ga0496124_0036590 3300048927 Bacteria 4280
248 Ga0496124_0061784 3300048927 Bacteria 3138
249 Ga0496125_0000013 3300048928 Bacteria 628761
250 Ga0496125_0000260 3300048928 Bacteria 108939
251 Ga0496125_0002592 3300048928 Bacteria 23222
252 Ga0496125_0004810 3300048928 Bacteria 15352
253 Ga0496125_0009538 3300048928 Bacteria 9956
254 Ga0496125_0020247 3300048928 Bacteria 6248
255 Ga0496125_0033805 3300048928 Bacteria 4517
256 Ga0496126_0000276 3300048929 Bacteria 108459
257 Ga0496126_0000701 3300048929 Bacteria 61198
258 Ga0496126_0002346 3300048929 Bacteria 25880
259 Ga0496126_0006509 3300048929 Bacteria 12999
260 Ga0496126_0015049 3300048929 Bacteria 7796
261 Ga0496126_0018107 3300048929 Bacteria 6994
262 Ga0496126_0050274 3300048929 Bacteria 3800
263 Ga0495678_000607 3300049459 Bacteria 33697
264 Ga0495682_0000003 3300049460 Bacteria 515787
265 nmdc:mga00v17_635_c1 3300050491 Bacteria 19430
266 Ga0500621_000006 3300053126 Bacteria 245480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046458 Ga0495591_000006 Ga0495591_000006_149951_151825 502
2 3300046530 Ga0495654_0000013 Ga0495654_0000013_196584_198458 502
3 3300048924 Ga0496121_0078083 Ga0496121_0078083_1015_2604 507
4 3300048904 Ga0496101_0000006 Ga0496101_0000006_201593_203512 511
5 3300013102 Ga0157371_10000491 Ga0157371_1000049117 512
6 3300048925 Ga0496122_0032888 Ga0496122_0032888_2202_4121 512
7 3300048927 Ga0496124_0008815 Ga0496124_0008815_4526_6394 512
8 3300048927 Ga0496124_0036590 Ga0496124_0036590_1924_3903 512
9 3300013100 Ga0157373_10000911 Ga0157373_1000091115 513
10 3300025711 Ga0207696_1000113 Ga0207696_1000113106 513
11 3300009036 Ga0105244_10008750 Ga0105244_100087505 516
12 3300011119 Ga0105246_10019002 Ga0105246_100190021 516
13 3300048923 Ga0496120_0000069 Ga0496120_0000069_52827_54695 517
14 3300048922 Ga0496119_0001206 Ga0496119_0001206_12833_14698 537
15 3300048922 Ga0496119_0003875 Ga0496119_0003875_13338_15203 537
16 3300048923 Ga0496120_0001249 Ga0496120_0001249_14789_16654 537
17 3300048923 Ga0496120_0001277 Ga0496120_0001277_16901_18766 537
18 3300048927 Ga0496124_0000136 Ga0496124_0000136_62403_64268 537
19 3300048923 Ga0496120_0005390 Ga0496120_0005390_1226_3106 544
20 3300048920 Ga0496117_0003655 Ga0496117_0003655_5897_7786 545
21 3300048921 Ga0496118_0033641 Ga0496118_0033641_123_2012 545
22 3300048922 Ga0496119_0011714 Ga0496119_0011714_5269_7158 545
23 3300048923 Ga0496120_0006875 Ga0496120_0006875_5555_7444 545
24 3300048925 Ga0496122_0014520 Ga0496122_0014520_4199_6157 545
25 3300048928 Ga0496125_0000260 Ga0496125_0000260_89884_91842 545
26 3300048929 Ga0496126_0018107 Ga0496126_0018107_3882_5771 545
27 3300048922 Ga0496119_0000039 Ga0496119_0000039_161465_163345 546
28 3300048923 Ga0496120_0000002 Ga0496120_0000002_500833_502713 546
29 3300009036 Ga0105244_10000056 Ga0105244_10000056127 548
30 3300025728 Ga0207655_1000288 Ga0207655_100028877 548
31 3300048919 Ga0496116_0002263 Ga0496116_0002263_15847_17712 548
32 3300006946 Ga0079104_1001116 Ga0079104_10011169 551
33 3300009011 Ga0105251_10000223 Ga0105251_1000022316 551
34 3300009174 Ga0105241_10000010 Ga0105241_10000010126 551
35 3300013100 Ga0157373_10029339 Ga0157373_100293392 551
36 3300014497 Ga0182008_10008703 Ga0182008_100087033 551
37 3300025735 Ga0207713_1000075 Ga0207713_100007543 551
38 3300025911 Ga0207654_10000010 Ga0207654_10000010127 551
39 3300027111 Ga0209281_1000139 Ga0209281_100013913 551
40 3300042006 Ga0439432_000104 Ga0439432_000104_10583_12460 551
41 3300009011 Ga0105251_10001228 Ga0105251_1000122811 553
42 3300025728 Ga0207655_1000468 Ga0207655_100046820 553
43 3300025735 Ga0207713_1002867 Ga0207713_10028672 553
44 3300048920 Ga0496117_0003512 Ga0496117_0003512_10192_12051 553
45 3300041411 Ga0439466_0000503 Ga0439466_0000503_6081_7976 557
46 3300013102 Ga0157371_10000098 Ga0157371_1000009873 558
47 3300048921 Ga0496118_0003326 Ga0496118_0003326_7648_9519 559
48 3300009092 Ga0105250_10000011 Ga0105250_10000011125 560
49 3300025711 Ga0207696_1000026 Ga0207696_1000026135 560
50 3300009011 Ga0105251_10000377 Ga0105251_1000037715 561
51 3300009101 Ga0105247_10000610 Ga0105247_100006109 561
52 3300017792 Ga0163161_10000006 Ga0163161_10000006139 561
53 3300025711 Ga0207696_1000046 Ga0207696_1000046144 561
54 3300025735 Ga0207713_1000056 Ga0207713_1000056143 561
55 3300025900 Ga0207710_10000024 Ga0207710_10000024150 561
56 3300046453 Ga0495627_000096 Ga0495627_000096_60054_61976 561
57 3300048906 Ga0496103_0061575 Ga0496103_0061575_350_2272 561
58 3300048919 Ga0496116_0000058 Ga0496116_0000058_122398_124320 561
59 3300048920 Ga0496117_0001969 Ga0496117_0001969_24706_26628 561
60 3300048921 Ga0496118_0002414 Ga0496118_0002414_1705_3627 561
61 3300048922 Ga0496119_0031572 Ga0496119_0031572_1283_3205 561
62 3300046458 Ga0495591_000921 Ga0495591_000921_3288_5135 563
63 3300046507 Ga0495606_0001088 Ga0495606_0001088_20764_22611 563
64 3300046692 Ga0495671_0012738 Ga0495671_0012738_1206_3053 563
65 3300046694 Ga0495649_0012559 Ga0495649_0012559_304_2151 563
66 3300047320 Ga0495672_0000029 Ga0495672_0000029_79743_81590 563
67 3300047469 Ga0495673_0000820 Ga0495673_0000820_659_2506 563
68 3300049459 Ga0495678_000607 Ga0495678_000607_10942_12789 563
69 3300053126 Ga0500621_000006 Ga0500621_000006_204153_206000 563
70 3300009036 Ga0105244_10000009 Ga0105244_10000009140 565
71 3300025728 Ga0207655_1000004 Ga0207655_1000004359 565
72 3300014497 Ga0182008_10022641 Ga0182008_100226411 566
73 3300046810 Ga0495660_0000034 Ga0495660_0000034_97224_99071 566
74 3300048924 Ga0496121_0003538 Ga0496121_0003538_15322_17217 566
75 3300046492 Ga0495585_0010496 Ga0495585_0010496_727_2622 568
76 3300046524 Ga0495648_0024356 Ga0495648_0024356_1234_3129 568
77 3300047320 Ga0495672_0000096 Ga0495672_0000096_136256_138151 568
78 3300047446 Ga0495679_003207 Ga0495679_003207_1204_3099 568
79 3300048920 Ga0496117_0003385 Ga0496117_0003385_11711_13606 568
80 3300048921 Ga0496118_0001909 Ga0496118_0001909_27046_28941 568
81 3300048922 Ga0496119_0004075 Ga0496119_0004075_7755_9650 568
82 3300048923 Ga0496120_0000010 Ga0496120_0000010_73285_75180 568
83 3300048928 Ga0496125_0020247 Ga0496125_0020247_3115_5010 568
84 3300046530 Ga0495654_0002845 Ga0495654_0002845_8679_10538 569
85 3300046660 Ga0495625_0005781 Ga0495625_0005781_8918_10777 569
86 3300047446 Ga0495679_000021 Ga0495679_000021_182500_184359 569
87 3300009036 Ga0105244_10009001 Ga0105244_100090013 570
88 3300013104 Ga0157370_10001743 Ga0157370_1000174328 570
89 3300002737 JGI25162J39368_1000019 JGI25162J39368_1000019208 571
90 3300002771 JGI25163J39215_1000079 JGI25163J39215_100007935 571
91 3300002772 JGI25164J39214_1000011 JGI25164J39214_100001166 571
92 3300003751 Ga0055538_1000021 Ga0055538_100002166 571
93 3300003752 Ga0055539_1000026 Ga0055539_1000026208 571
94 3300003756 Ga0055533_1000035 Ga0055533_100003566 571
95 3300003759 Ga0055525_1000045 Ga0055525_100004566 571
96 3300003841 Ga0055541_1000020 Ga0055541_100002066 571
97 3300005289 Ga0065704_10001487 Ga0065704_100014872 571
98 3300009036 Ga0105244_10001873 Ga0105244_100018734 571
99 3300009092 Ga0105250_10005316 Ga0105250_100053163 571
100 3300013306 Ga0163162_10013391 Ga0163162_100133912 571
101 3300025207 Ga0209760_100004 Ga0209760_10000466 571
102 3300025224 Ga0209784_100001 Ga0209784_1000012523 571
103 3300025225 Ga0209566_100001 Ga0209566_1000012523 571
104 3300025226 Ga0209674_100002 Ga0209674_1000022523 571
105 3300025230 Ga0209563_100002 Ga0209563_1000021058 571
106 3300025231 Ga0207427_100012 Ga0207427_100012293 571
107 3300025233 Ga0209437_100001 Ga0209437_1000011058 571
108 3300025253 Ga0209677_100002 Ga0209677_1000021058 571
109 3300025261 Ga0209233_1003483 Ga0209233_10034832 571
110 3300025711 Ga0207696_1000298 Ga0207696_100029813 571
111 3300025728 Ga0207655_1000229 Ga0207655_100022916 571
112 3300046471 Ga0495650_0000182 Ga0495650_0000182_84851_86725 571
113 3300046810 Ga0495660_0000004 Ga0495660_0000004_840842_842716 571
114 3300048907 Ga0496104_0011571 Ga0496104_0011571_5136_7010 571
115 3300048919 Ga0496116_0000094 Ga0496116_0000094_66253_68127 571
116 3300048920 Ga0496117_0010181 Ga0496117_0010181_607_2481 571
117 3300048921 Ga0496118_0010422 Ga0496118_0010422_5700_7574 571
118 3300048925 Ga0496122_0000007 Ga0496122_0000007_316942_318816 571
119 3300048926 Ga0496123_0000004 Ga0496123_0000004_458414_460288 571
120 3300048927 Ga0496124_0000025 Ga0496124_0000025_165373_167247 571
121 3300048928 Ga0496125_0000013 Ga0496125_0000013_262631_264505 571
122 3300048929 Ga0496126_0000276 Ga0496126_0000276_66495_68369 571
123 3300006946 Ga0079104_1000250 Ga0079104_100025050 572
124 3300027111 Ga0209281_1000291 Ga0209281_100029171 572
125 3300048920 Ga0496117_0014636 Ga0496117_0014636_1845_3704 573
126 3300048921 Ga0496118_0012766 Ga0496118_0012766_23_1882 573
127 3300048922 Ga0496119_0003423 Ga0496119_0003423_6474_8333 573
128 3300048923 Ga0496120_0001616 Ga0496120_0001616_21554_23413 573
129 3300048925 Ga0496122_0013917 Ga0496122_0013917_23_1882 573
130 3300048926 Ga0496123_0018262 Ga0496123_0018262_2356_4215 573
131 3300048928 Ga0496125_0002592 Ga0496125_0002592_16338_18197 573
132 3300048929 Ga0496126_0002346 Ga0496126_0002346_10581_12440 573
133 3300009011 Ga0105251_10001108 Ga0105251_1000110812 574
134 3300046530 Ga0495654_0010389 Ga0495654_0010389_1164_3011 574
135 3300009036 Ga0105244_10018699 Ga0105244_100186992 578
136 3300046471 Ga0495650_0000113 Ga0495650_0000113_69362_71209 578
137 3300048926 Ga0496123_0001291 Ga0496123_0001291_17538_19397 578
138 3300049460 Ga0495682_0000003 Ga0495682_0000003_214381_216228 578
139 3300006946 Ga0079104_1001814 Ga0079104_10018143 580
140 3300013102 Ga0157371_10040537 Ga0157371_100405373 580
141 3300027111 Ga0209281_1000749 Ga0209281_100074921 580
142 3300042006 Ga0439432_005099 Ga0439432_005099_1044_2897 580
143 3300048920 Ga0496117_0000639 Ga0496117_0000639_6698_8557 580
144 3300048924 Ga0496121_0003267 Ga0496121_0003267_19_1872 580
145 3300048924 Ga0496121_0004231 Ga0496121_0004231_10955_12814 580
146 3300048925 Ga0496122_0008487 Ga0496122_0008487_1361_3214 580
147 3300048926 Ga0496123_0008206 Ga0496123_0008206_6689_8542 580
148 3300048927 Ga0496124_0000611 Ga0496124_0000611_41928_43781 580
149 iso_pu_bacteria 2849139964 2849144458 580
150 3300027312 Ga0209371_1001428 Ga0209371_100142812 581
151 3300030500 Ga0268256_1001071 Ga0268256_100107114 581
152 iso_pu_bacteria 2721755693 2723602022 582
153 iso_pu_bacteria 2728369359 2730138094 582
154 iso_pu_bacteria 2751185905 2753812428 582
155 iso_pu_bacteria 2889276214 2889278096 582
156 3300048919 Ga0496116_0000576 Ga0496116_0000576_44510_46393 584
157 3300048922 Ga0496119_0001036 Ga0496119_0001036_16955_18838 584
158 3300048923 Ga0496120_0000016 Ga0496120_0000016_36833_38716 584
159 3300009036 Ga0105244_10002429 Ga0105244_100024293 586
160 3300021384 Ga0213876_10000023 Ga0213876_10000023187 586
161 3300039437 Ga0436365_0965775 Ga0436365_0965775_214440_216299 586
162 3300005577 Ga0068857_100000333 Ga0068857_1000003339 587
163 3300026116 Ga0207674_10000573 Ga0207674_1000057320 587
164 3300027312 Ga0209371_1006165 Ga0209371_10061653 587
165 3300030500 Ga0268256_1003684 Ga0268256_10036846 587
166 3300048926 Ga0496123_0043949 Ga0496123_0043949_704_2557 587
167 3300042010 Ga0439452_000090 Ga0439452_000090_59111_60970 588
168 3300048922 Ga0496119_0000005 Ga0496119_0000005_106229_108088 588
169 3300048923 Ga0496120_0000005 Ga0496120_0000005_105536_107395 588
170 3300048925 Ga0496122_0000088 Ga0496122_0000088_126404_128263 588
171 3300048926 Ga0496123_0000139 Ga0496123_0000139_23208_25067 588
172 3300048927 Ga0496124_0018869 Ga0496124_0018869_2488_4347 588
173 3300009011 Ga0105251_10000045 Ga0105251_1000004540 589
174 3300009036 Ga0105244_10010880 Ga0105244_100108802 589
175 3300009092 Ga0105250_10000018 Ga0105250_10000018183 589
176 3300025711 Ga0207696_1000013 Ga0207696_1000013226 589
177 3300025711 Ga0207696_1002830 Ga0207696_10028302 589
178 3300025728 Ga0207655_1031489 Ga0207655_10314892 589
179 3300025735 Ga0207713_1000047 Ga0207713_100004799 589
180 3300046522 Ga0495643_0030543 Ga0495643_0030543_1082_2977 589
181 3300048919 Ga0496116_0041582 Ga0496116_0041582_107_1960 589
182 3300048921 Ga0496118_0024595 Ga0496118_0024595_1403_3256 589
183 3300048927 Ga0496124_0000627 Ga0496124_0000627_9391_11286 589
184 iso_pu_bacteria 2511231025 2511380683 589
185 iso_pu_bacteria 2876601092 2876604765 589
186 iso_pu_bacteria 8016733728 8016738794 589
187 iso_pu_bacteria 8019499862 8019500440 589
188 3300003856 Ga0058692_1001941 Ga0058692_10019412 590
189 3300025735 Ga0207713_1001772 Ga0207713_10017725 590
190 3300027111 Ga0209281_1000694 Ga0209281_100069413 590
191 3300027312 Ga0209371_1001282 Ga0209371_10012828 590
192 3300030500 Ga0268256_1000572 Ga0268256_100057220 590
193 3300048907 Ga0496104_0169116 Ga0496104_0169116_103_1956 590
194 3300048922 Ga0496119_0013273 Ga0496119_0013273_3528_5381 590
195 3300048923 Ga0496120_0005227 Ga0496120_0005227_6637_8490 590
196 3300048925 Ga0496122_0019396 Ga0496122_0019396_21_1874 590
197 3300048926 Ga0496123_0004895 Ga0496123_0004895_5120_6973 590
198 3300048926 Ga0496123_0055846 Ga0496123_0055846_21_1874 590
199 3300048929 Ga0496126_0015049 Ga0496126_0015049_683_2536 590
200 iso_pu_bacteria 2511231035 2511433349 590
201 iso_pu_bacteria 2585427591 2585827621 590
202 iso_pu_bacteria 2585427592 2585832311 590
203 iso_pu_bacteria 2667528173 2671108705 590
204 iso_pu_bacteria 2884086401 2884088044 590
205 iso_pu_bacteria 2904474040 2904475600 590
206 iso_pu_bacteria 2919150387 2919151769 590
207 iso_pu_bacteria 2927143783 2927144438 590
208 3300048921 Ga0496118_0010246 Ga0496118_0010246_5570_7429 591
209 3300048922 Ga0496119_0000697 Ga0496119_0000697_24776_26635 591
210 3300048923 Ga0496120_0002829 Ga0496120_0002829_10150_12009 591
211 3300048927 Ga0496124_0061784 Ga0496124_0061784_211_2070 591
212 iso_pu_bacteria 2547132416 2548649461 591
213 iso_pu_bacteria 2602042067 2603705270 591
214 iso_pu_bacteria 2667528172 2671101225 591
215 iso_pu_bacteria 2681812866 2681996320 591
216 iso_pu_bacteria 2751185917 2753856818 591
217 iso_pu_bacteria 2775506706 2775541405 591
218 iso_pu_bacteria 2821118458 2821120942 591
219 iso_pu_bacteria 2888366609 2888366715 591
220 iso_pu_bacteria 2908669403 2908669605 591
221 iso_pu_bacteria 2927833300 2927837771 591
222 iso_pu_bacteria 8004592986 8004593452 591
223 iso_pu_bacteria 8015394850 8015399752 591
224 3300025711 Ga0207696_1003136 Ga0207696_10031368 592
225 3300048929 Ga0496126_0000701 Ga0496126_0000701_7867_9720 592
226 iso_pu_bacteria 2554235234 2555259730 592
227 iso_pu_bacteria 2599185169 2599411366 592
228 iso_pu_bacteria 2600255254 2601524361 592
229 iso_pu_bacteria 2600255255 2601529515 592
230 iso_pu_bacteria 2600255256 2601534914 592
231 iso_pu_bacteria 2600255257 2601539457 592
232 iso_pu_bacteria 2600255280 2601616349 592
233 iso_pu_bacteria 2600255281 2601621071 592
234 iso_pu_bacteria 2600255287 2601644415 592
235 iso_pu_bacteria 2600255288 2601649468 592
236 iso_pu_bacteria 2600255289 2601654395 592
237 iso_pu_bacteria 2600255290 2601659817 592
238 iso_pu_bacteria 2600255291 2601664237 592
239 iso_pu_bacteria 2600255298 2601697197 592
240 iso_pu_bacteria 2600255299 2601702243 592
241 iso_pu_bacteria 2600255300 2601707139 592
242 iso_pu_bacteria 2600255301 2601711909 592
243 iso_pu_bacteria 2600255302 2601717656 592
244 iso_pu_bacteria 2600255303 2601722077 592
245 iso_pu_bacteria 2600255304 2601727584 592
246 iso_pu_bacteria 2600255305 2601732351 592
247 iso_pu_bacteria 2600255306 2601737134 592
248 iso_pu_bacteria 2600255307 2601741416 592
249 iso_pu_bacteria 2600255309 2601752330 592
250 iso_pu_bacteria 2600255310 2601757807 592
251 iso_pu_bacteria 2600255311 2601764165 592
252 iso_pu_bacteria 2600255392 2602019171 592
253 iso_pu_bacteria 2602042046 2603636976 592
254 iso_pu_bacteria 2602042052 2603662401 592
255 iso_pu_bacteria 2602042053 2603667297 592
256 iso_pu_bacteria 2602042103 2603840008 592
257 iso_pu_bacteria 2602042104 2603845085 592
258 iso_pu_bacteria 2602042105 2603849911 592
259 iso_pu_bacteria 2602042106 2603855226 592
260 iso_pu_bacteria 2602042110 2603872806 592
261 iso_pu_bacteria 2602042111 2603878108 592
262 iso_pu_bacteria 2603880178 2606049737 592
263 iso_pu_bacteria 2603880184 2606071399 592
264 iso_pu_bacteria 2603880202 2606147670 592
265 iso_pu_bacteria 2603880211 2606177626 592
266 iso_pu_bacteria 2636415599 2637224188 592
267 iso_pu_bacteria 2675903046 2676405591 592
268 iso_pu_bacteria 2775507074 2777020839 592
269 iso_pu_bacteria 2811995292 2813727985 592
270 iso_pu_bacteria 2814123068 2814695528 592
271 iso_pu_bacteria 2847085930 2847087724 592
272 iso_pu_bacteria 2904513164 2904515503 592
273 iso_pu_bacteria 2919108558 2919110831 592
274 iso_pu_bacteria 2935625433 2935625866 592
275 iso_pu_bacteria 2939617950 2939618385 592
276 iso_pu_bacteria 2969079654 2969081225 592
277 iso_pu_bacteria 2971820967 2971822615 592
278 iso_pu_bacteria 2974435778 2974439178 592
279 iso_pu_bacteria 2984559226 2984563683 592
280 iso_pu_bacteria 2984595703 2984596417 592
281 iso_pu_bacteria 8019504834 8019505277 592
282 iso_pu_bacteria 8055693939 8055696831 592
283 iso_pu_bacteria 2537561728 2538425765 593
284 iso_pu_bacteria 2609459761 2609909773 593
285 iso_pu_bacteria 2711768156 2712470673 593
286 iso_pu_bacteria 2772190666 2772436669 593
287 iso_pu_bacteria 2871282230 2871286318 593
288 iso_pu_bacteria 2888373701 2888375214 593
289 iso_pu_bacteria 2904504865 2904506733 593
290 iso_pu_bacteria 2932406140 2932408966 593
291 iso_pu_bacteria 2937967321 2937971543 593
292 iso_pu_bacteria 2939577877 2939581730 593
293 iso_pu_bacteria 2945874760 2945876960 593
294 iso_pu_bacteria 8054844752 8054847011 593
295 3300025728 Ga0207655_1000002 Ga0207655_1000002376 594
296 3300027111 Ga0209281_1000379 Ga0209281_100037921 594
297 3300027312 Ga0209371_1005463 Ga0209371_10054633 594
298 3300030500 Ga0268256_1001790 Ga0268256_100179012 594
299 iso_pu_bacteria 2506520007 2506576094 594
300 iso_pu_bacteria 2506520008 2506581232 594
301 iso_pu_bacteria 2654587920 2656277499 594
302 iso_pu_bacteria 2687453601 2689442524 594
303 iso_pu_bacteria 2706794495 2707100473 594
304 iso_pu_bacteria 2808606414 2809127264 594
305 iso_pu_bacteria 2844528606 2844529965 594
306 iso_pu_bacteria 2854601825 2854604476 594
307 iso_pu_bacteria 2855195626 2855195978 594
308 iso_pu_bacteria 2858466076 2858468936 594
309 iso_pu_bacteria 2865014394 2865018806 594
310 iso_pu_bacteria 2869551831 2869551936 594
311 iso_pu_bacteria 2871272651 2871272748 594
312 iso_pu_bacteria 2900051742 2900052688 594
313 iso_pu_bacteria 2939607340 2939608777 594
314 iso_pu_bacteria 2945951305 2945956133 594
315 iso_pu_bacteria 3000376612 3000378492 594
316 iso_pu_bacteria 8055087960 8055092062 594
317 iso_pu_bacteria 8055092621 8055095399 594
318 iso_pu_bacteria 8055097453 8055100096 594
319 3300003320 rootH2_10008161 rootH2_1000816113 595
320 3300003856 Ga0058692_1000728 Ga0058692_10007287 595
321 3300009011 Ga0105251_10007029 Ga0105251_100070294 595
322 3300009011 Ga0105251_10011570 Ga0105251_100115701 595
323 3300025735 Ga0207713_1000023 Ga0207713_1000023218 595
324 3300025735 Ga0207713_1000911 Ga0207713_10009119 595
325 3300025735 Ga0207713_1008268 Ga0207713_10082682 595
326 3300027312 Ga0209371_1000001 Ga0209371_10000012242 595
327 3300030500 Ga0268256_1000001 Ga0268256_1000001398 595
328 3300042010 Ga0439452_000032 Ga0439452_000032_52143_53996 595
329 3300048907 Ga0496104_0000385 Ga0496104_0000385_11144_12997 595
330 3300048908 Ga0496105_0058149 Ga0496105_0058149_638_2491 595
331 3300048920 Ga0496117_0001432 Ga0496117_0001432_4674_6527 595
332 3300048920 Ga0496117_0023257 Ga0496117_0023257_2470_4323 595
333 3300048921 Ga0496118_0000157 Ga0496118_0000157_8662_10515 595
334 3300048922 Ga0496119_0004545 Ga0496119_0004545_4190_6043 595
335 3300048923 Ga0496120_0001499 Ga0496120_0001499_12316_14169 595
336 3300048924 Ga0496121_0005244 Ga0496121_0005244_6731_8584 595
337 3300048925 Ga0496122_0007744 Ga0496122_0007744_4398_6251 595
338 3300048926 Ga0496123_0004052 Ga0496123_0004052_10213_12066 595
339 3300048927 Ga0496124_0017388 Ga0496124_0017388_3164_5017 595
340 3300048928 Ga0496125_0009538 Ga0496125_0009538_3279_5132 595
341 3300048929 Ga0496126_0006509 Ga0496126_0006509_5860_7713 595
342 iso_pu_bacteria 2602042109 2603868047 595
343 iso_pu_bacteria 2939568625 2939569940 595
344 iso_pu_bacteria 2939642701 2939643041 595
345 iso_pu_bacteria 2978975091 2978975160 595
346 3300003856 Ga0058692_1000332 Ga0058692_10003327 596
347 3300013307 Ga0157372_10001823 Ga0157372_1000182312 596
348 3300025258 Ga0209129_1000037 Ga0209129_1000037289 596
349 3300027111 Ga0209281_1002098 Ga0209281_10020988 596
350 3300027312 Ga0209371_1000002 Ga0209371_10000021411 596
351 3300027312 Ga0209371_1000015 Ga0209371_1000015195 596
352 3300027312 Ga0209371_1011621 Ga0209371_10116212 596
353 3300030500 Ga0268256_1000002 Ga0268256_100000251 596
354 3300030500 Ga0268256_1000018 Ga0268256_1000018429 596
355 3300042010 Ga0439452_000020 Ga0439452_000020_139370_141229 596
356 3300048920 Ga0496117_0000973 Ga0496117_0000973_12741_14600 596
357 3300048921 Ga0496118_0000915 Ga0496118_0000915_13447_15306 596
358 3300048921 Ga0496118_0027829 Ga0496118_0027829_1501_3363 596
359 3300048922 Ga0496119_0000049 Ga0496119_0000049_128641_130500 596
360 3300048925 Ga0496122_0000003 Ga0496122_0000003_378587_380449 596
361 3300048926 Ga0496123_0000012 Ga0496123_0000012_133770_135632 596
362 3300048926 Ga0496123_0046990 Ga0496123_0046990_1024_2883 596
363 3300048927 Ga0496124_0000045 Ga0496124_0000045_73014_74873 596
364 3300048928 Ga0496125_0033805 Ga0496125_0033805_1130_2989 596
365 3300009011 Ga0105251_10002752 Ga0105251_100027522 597
366 3300009036 Ga0105244_10012490 Ga0105244_100124902 597
367 3300025735 Ga0207713_1000004 Ga0207713_100000450 597
368 3300046542 Ga0495597_0000293 Ga0495597_0000293_36938_38800 597
369 3300005289 Ga0065704_10078395 Ga0065704_100783952 598
370 3300041405 Ga0439438_000503 Ga0439438_000503_7321_9204 598
371 3300047320 Ga0495672_0000070 Ga0495672_0000070_17287_19176 598
372 3300048903 Ga0496100_0045268 Ga0496100_0045268_376_2238 598
373 2162886007 SwRhRL2b_contig_1282399 SwRhRL2b_0469.00002160 599
374 3300005289 Ga0065704_10091397 Ga0065704_100913972 599
375 3300006051 Ga0075364_10024899 Ga0075364_100248992 599
376 3300006946 Ga0079104_1002813 Ga0079104_10028134 599
377 3300025711 Ga0207696_1011744 Ga0207696_10117442 599
378 3300025728 Ga0207655_1000036 Ga0207655_1000036249 599
379 3300027111 Ga0209281_1000004 Ga0209281_1000004313 599
380 3300030500 Ga0268256_1005621 Ga0268256_10056212 599
381 3300046458 Ga0495591_000050 Ga0495591_000050_8760_10622 599
382 3300046500 Ga0495596_0003874 Ga0495596_0003874_1652_3517 599
383 3300048921 Ga0496118_0016114 Ga0496118_0016114_2866_4728 599
384 3300048923 Ga0496120_0008335 Ga0496120_0008335_282_2144 599
385 3300048924 Ga0496121_0010025 Ga0496121_0010025_5009_6871 599
386 3300048928 Ga0496125_0004810 Ga0496125_0004810_6134_7996 599
387 3300048929 Ga0496126_0050274 Ga0496126_0050274_962_2824 599
388 3300050491 nmdc:mga00v17_635_c1 nmdc:mga00v17_635_c1_10338_12200 599

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00358

PTS_EIIA_1

phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1

503

629

0.99

PF00367

PTS_EIIB

phosphotransferase system, EIIB

41

74

0.97

PF02378

PTS_EIIC

Phosphotransferase system, EIIC

141

426

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o2f-assembly1.cif.gz_B complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure 0.9149 6 81
3bp8-assembly1.cif.gz_C crystal structure of mlc/eiib complex 0.9135 7 80
4jbw-assembly1.cif.gz_M crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9101 472 597
3bp3-assembly2.cif.gz_B crystal structure of eiib 0.9084 6 81
3our-assembly3.cif.gz_F crystal structure of complex between eiia and a novel pyruvate decarboxylase 0.9032 472 597
ID Description Score Start End Superfamily
af_P08722_1_78_3.30.1360.60 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Glucose permease domain IIB 0.9943 4 79 3.30.1360.60
af_P24241_1_79_3.30.1360.60 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Glucose permease domain IIB 0.9728 2 76 3.30.1360.60
af_P08722_474_624_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9617 468 596 2.70.70.10
af_P36672_6_82_3.30.1360.60 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Glucose permease domain IIB 0.9613 4 78 3.30.1360.60
af_P08722_1_78_3.30.1360.60 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Glucose permease domain IIB 0.9568 4 79 3.30.1360.60
ID Description Score Start End GO Terms
AF-A0A6D0EMW2-F1-model_v4 deleted 0.992 338 451
AF-A0A3B8S0Y8-F1-model_v4 deleted 0.9801 507 597
AF-A0A7X7H2Y9-F1-model_v4 PTS transporter subunit EIIB 0.9743 2 76 GO:0005886
GO:0008982
GO:0009401
GO:0015771
GO:0016301
GO:0090589
AF-A0A0V8DM29-F1-model_v4 PTS system sucrose-specific IIB component / PTS system sucrose-specific IIC component 0.9743 509 597 GO:0005737
GO:0009401
GO:0016301
AF-A0A6A8LQJ6-F1-model_v4 Phosphotransferase system, EIIB 0.9709 2 81 GO:0005886
GO:0008982
GO:0009401
GO:0015771
GO:0016301
GO:0090589

Feature Viewer

pLDDT pTM Quality
78.59 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map