F431212

General Info

Members Datasets Scaffolds Average Seq Length
388 143 381 176

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0102754|Ga0495584_0102754_418_1017
Length 199
Sequence MTQAAVPEAAPASATNALPAPDPAMRLPTHLETPSVRRRLMVMVYETFLLLAVEMLAVLVYMLVTGNRQEPIYQHGRTLFLFLVAGAYFVRCWTDSGHTLAMKTWRVRLSSSDVSQARVPLRTAMLRYLLAWGWFAPALIVRAAFGLHGKGQTAAVIAAGIAAWAMTAFLDKDRQFLHDRLARTRLVQMPKKLTAPAAS

Samples

Sample ID Description Type Environment
1 2643221638 Duganella sp. Root336D2 Isolate Unclassified
2 2738541297 Duganella sp. GV083 Isolate Unclassified
3 2738541357 Duganella sp. GV053 Isolate Unclassified
4 2738543003 Duganella sp. GV066 Isolate Unclassified
5 2738543026 Duganella sp. GV089 Isolate Unclassified
6 2738543029 Duganella sp. GV039 Isolate Unclassified
7 2821131069 Duganella sp. 1224 Isolate Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
30 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
31 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
32 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
54 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
68 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
69 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
70 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
71 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
72 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
73 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
143 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.26
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.11
Nodule 0
Rhizoplane 2.84
Rhizosphere 80.41
Stem 0
Stem Tuber 0
Unclassified 4.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001380 3300002773 Bacteria 10561
2 JGI25152J39213_1023757 3300002773 Bacteria 1039
3 JGI25150J39212_1000821 3300002774 Bacteria 10461
4 JGI25153J46596_10040255 3300003215 Bacteria 1451
5 Ga0055526_1000198 3300003771 Bacteria 51889
6 Ga0055526_1003501 3300003771 Bacteria 9933
7 Ga0055526_1022754 3300003771 Bacteria 2119
8 Ga0055537_1005707 3300003773 Bacteria 3286
9 Ga0055537_1006223 3300003773 Bacteria 3064
10 Ga0055524_1002255 3300003775 Bacteria 10087
11 Ga0055524_1002308 3300003775 Bacteria 9933
12 Ga0055524_1014445 3300003775 Bacteria 2925
13 Ga0055534_1003727 3300003784 Bacteria 4701
14 Ga0055530_10002937 3300003791 Bacteria 10317
15 Ga0055530_10003286 3300003791 Bacteria 9383
16 Ga0055530_10020935 3300003791 Bacteria 1939
17 Ga0055531_10001502 3300003794 Bacteria 17132
18 Ga0065715_10556045 3300005293 Bacteria 737
19 Ga0070661_101132113 3300005344 Bacteria 653
20 Ga0070659_100185266 3300005366 Bacteria 1709
21 Ga0070663_100647934 3300005455 Bacteria 893
22 Ga0070717_10033076 3300006028 Bacteria 4170
23 Ga0105244_10008385 3300009036 Bacteria 6458
24 Ga0105242_10132564 3300009176 Bacteria 2153
25 Ga0105242_10451254 3300009176 Bacteria 1212
26 Ga0157371_10000001 3300013102 Bacteria 1162285
27 Ga0157372_10421486 3300013307 Bacteria 1555
28 Ga0182008_10020158 3300014497 Bacteria 3436
29 Ga0182007_10061015 3300015262 Bacteria 1236
30 Ga0163161_10454364 3300017792 Bacteria 1036
31 Ga0209436_101950 3300025208 Bacteria 6632
32 Ga0207425_1000001 3300025245 Bacteria 2525432
33 Ga0207425_1000249 3300025245 Bacteria 41006
34 Ga0207425_1000264 3300025245 Bacteria 38905
35 Ga0209129_1000001 3300025258 Bacteria 1452436
36 Ga0209129_1003100 3300025258 Bacteria 7481
37 Ga0209565_1002036 3300025263 Bacteria 7785
38 Ga0209565_1002276 3300025263 Bacteria 7088
39 Ga0209565_1005339 3300025263 Bacteria 3747
40 Ga0209565_1026908 3300025263 Bacteria 1149
41 Ga0209673_1062343 3300025273 Bacteria 924
42 Ga0209673_1083202 3300025273 Bacteria 728
43 Ga0209675_1006077 3300025291 Bacteria 4924
44 Ga0209025_1002375 3300025294 Bacteria 20145
45 Ga0209564_1000009 3300025295 Bacteria 950196
46 Ga0209564_1000178 3300025295 Bacteria 151982
47 Ga0209758_1000116 3300025297 Bacteria 198356
48 Ga0209758_1000751 3300025297 Bacteria 47038
49 Ga0209050_1001038 3300025298 Bacteria 34415
50 Ga0209050_1003669 3300025298 Bacteria 11081
51 Ga0209050_1004481 3300025298 Bacteria 9406
52 Ga0209256_1002696 3300025299 Bacteria 13872
53 Ga0209256_1009229 3300025299 Bacteria 4366
54 Ga0209257_1000293 3300025304 Bacteria 110422
55 Ga0209257_1006683 3300025304 Bacteria 7304
56 Ga0207655_1026827 3300025728 Bacteria 2757
57 Ga0207657_10011869 3300025919 Bacteria 8623
58 Ga0207690_10045145 3300025932 Bacteria 2909
59 Ga0207667_10707620 3300025949 Bacteria 1009
60 Ga0207678_10674899 3300026067 Bacteria 908
61 Ga0316177_1200651 3300030731 Bacteria 2805
62 Ga0307408_100000576 3300031548 Bacteria 31629
63 Ga0307408_100003945 3300031548 Bacteria 10101
64 Ga0307416_100002060 3300032002 Bacteria 11327
65 Ga0373939_0059176 3300035114 Bacteria 1214
66 Ga0395899_0000028 3300037312 Bacteria 334378
67 Ga0395899_0004930 3300037312 Bacteria 10382
68 Ga0395900_0133363 3300037418 Bacteria 2544
69 Ga0395900_0351022 3300037418 Bacteria 1448
70 Ga0395901_0563458 3300038443 Bacteria 1153
71 Ga0439448_0002726 3300042005 Bacteria 4830
72 Ga0439450_015719 3300042008 Bacteria 1555
73 Ga0466961_0046245 3300044693 Bacteria 2784
74 Ga0466964_0008159 3300044706 Bacteria 3930
75 Ga0466968_0030791 3300044735 Bacteria 2224
76 Ga0466970_0323097 3300044765 Bacteria 873
77 Ga0466967_0036871 3300045976 Bacteria 4178
78 Ga0495617_000898 3300046452 Bacteria 13942
79 Ga0495617_002816 3300046452 Bacteria 6700
80 Ga0495617_139869 3300046452 Bacteria 773
81 Ga0495603_0151387 3300046455 Bacteria 1347
82 Ga0495590_0000238 3300046457 Bacteria 30191
83 Ga0495638_0018726 3300046460 Bacteria 4593
84 Ga0495638_0019679 3300046460 Bacteria 4464
85 Ga0495638_0062952 3300046460 Bacteria 2288
86 Ga0495638_0353298 3300046460 Bacteria 776
87 Ga0495653_0000038 3300046463 Bacteria 120385
88 Ga0495653_0018441 3300046463 Bacteria 5665
89 Ga0495653_0086453 3300046463 Bacteria 2304
90 Ga0495653_0792161 3300046463 Bacteria 570
91 Ga0495650_0000048 3300046471 Bacteria 334427
92 Ga0495650_0002609 3300046471 Bacteria 14132
93 Ga0495650_0003542 3300046471 Bacteria 11304
94 Ga0495650_0011183 3300046471 Bacteria 4940
95 Ga0495650_0011483 3300046471 Bacteria 4847
96 Ga0495650_0047430 3300046471 Bacteria 1797
97 Ga0495582_0007638 3300046473 Bacteria 5978
98 Ga0495605_0000044 3300046474 Bacteria 182513
99 Ga0495605_0041811 3300046474 Bacteria 2281
100 Ga0495605_0062165 3300046474 Bacteria 1784
101 Ga0495605_0080757 3300046474 Bacteria 1521
102 Ga0495605_0146786 3300046474 Bacteria 1054
103 Ga0495605_0269320 3300046474 Bacteria 725
104 Ga0495584_0000806 3300046491 Bacteria 20619
105 Ga0495584_0001696 3300046491 Bacteria 12908
106 Ga0495584_0009015 3300046491 Bacteria 5153
107 Ga0495584_0023559 3300046491 Bacteria 3121
108 Ga0495584_0038384 3300046491 Bacteria 2420
109 Ga0495584_0047194 3300046491 Bacteria 2171
110 Ga0495584_0052317 3300046491 Bacteria 2055
111 Ga0495584_0094818 3300046491 Bacteria 1506
112 Ga0495584_0102754 3300046491 Bacteria 1445
113 Ga0495584_0113542 3300046491 Bacteria 1371
114 Ga0495584_0194326 3300046491 Bacteria 1031
115 Ga0495585_0000122 3300046492 Bacteria 84570
116 Ga0495585_0001385 3300046492 Bacteria 19167
117 Ga0495585_0002644 3300046492 Bacteria 12603
118 Ga0495585_0003422 3300046492 Bacteria 10730
119 Ga0495585_0008853 3300046492 Bacteria 6074
120 Ga0495585_0009968 3300046492 Bacteria 5678
121 Ga0495585_0015785 3300046492 Bacteria 4385
122 Ga0495585_0054539 3300046492 Bacteria 2209
123 Ga0495585_0150210 3300046492 Bacteria 1215
124 Ga0495585_0184642 3300046492 Bacteria 1070
125 Ga0495594_0030390 3300046499 Bacteria 2922
126 Ga0495594_0031120 3300046499 Bacteria 2891
127 Ga0495594_0033862 3300046499 Bacteria 2778
128 Ga0495596_0001540 3300046500 Bacteria 13166
129 Ga0495596_0009563 3300046500 Bacteria 4261
130 Ga0495596_0009649 3300046500 Bacteria 4241
131 Ga0495596_0013257 3300046500 Bacteria 3503
132 Ga0495596_0017054 3300046500 Bacteria 3012
133 Ga0495596_0032284 3300046500 Bacteria 2088
134 Ga0495596_0046945 3300046500 Bacteria 1695
135 Ga0495596_0112689 3300046500 Bacteria 1056
136 Ga0495607_0039153 3300046501 Bacteria 2833
137 Ga0495607_0080920 3300046501 Bacteria 1784
138 Ga0495607_0090040 3300046501 Bacteria 1664
139 Ga0495583_0000230 3300046506 Bacteria 93092
140 Ga0495583_0000295 3300046506 Bacteria 79005
141 Ga0495583_0010195 3300046506 Bacteria 5512
142 Ga0495583_0013804 3300046506 Bacteria 4482
143 Ga0495583_0028995 3300046506 Bacteria 2713
144 Ga0495583_0029583 3300046506 Bacteria 2678
145 Ga0495583_0063089 3300046506 Bacteria 1648
146 Ga0495606_0000232 3300046507 Bacteria 98402
147 Ga0495606_0000537 3300046507 Bacteria 61013
148 Ga0495606_0007462 3300046507 Bacteria 9776
149 Ga0495606_0085826 3300046507 Bacteria 1946
150 Ga0495606_0129062 3300046507 Bacteria 1505
151 Ga0495606_0239216 3300046507 Bacteria 1013
152 Ga0495606_0239351 3300046507 Bacteria 1013
153 Ga0495606_0300279 3300046507 Bacteria 870
154 Ga0495606_0437859 3300046507 Bacteria 672
155 Ga0495610_0000003 3300046512 Bacteria 1203910
156 Ga0495610_0013231 3300046512 Bacteria 4912
157 Ga0495616_0002071 3300046513 Bacteria 13482
158 Ga0495616_0002381 3300046513 Bacteria 12521
159 Ga0495616_0004476 3300046513 Bacteria 8801
160 Ga0495616_0007352 3300046513 Bacteria 6590
161 Ga0495616_0033841 3300046513 Bacteria 2658
162 Ga0495616_0132954 3300046513 Bacteria 1138
163 Ga0495631_0002122 3300046518 Bacteria 11483
164 Ga0495631_0004758 3300046518 Bacteria 7168
165 Ga0495631_0005156 3300046518 Bacteria 6885
166 Ga0495631_0026920 3300046518 Bacteria 2635
167 Ga0495631_0051892 3300046518 Bacteria 1791
168 Ga0495631_0066109 3300046518 Bacteria 1564
169 Ga0495631_0074488 3300046518 Bacteria 1465
170 Ga0495632_0004948 3300046519 Bacteria 8930
171 Ga0495632_0009864 3300046519 Bacteria 5710
172 Ga0495637_0000318 3300046520 Bacteria 37411
173 Ga0495643_0001229 3300046522 Bacteria 24725
174 Ga0495643_0002336 3300046522 Bacteria 15238
175 Ga0495643_0005470 3300046522 Bacteria 8589
176 Ga0495643_0036406 3300046522 Bacteria 2703
177 Ga0495643_0037163 3300046522 Bacteria 2673
178 Ga0495643_0059460 3300046522 Bacteria 2031
179 Ga0495644_0016046 3300046523 Bacteria 2869
180 Ga0495644_0087375 3300046523 Bacteria 1175
181 Ga0495648_0000118 3300046524 Bacteria 95878
182 Ga0495648_0005843 3300046524 Bacteria 10133
183 Ga0495648_0007327 3300046524 Bacteria 8842
184 Ga0495648_0059115 3300046524 Bacteria 2288
185 Ga0495648_0070386 3300046524 Bacteria 2033
186 Ga0495663_0000893 3300046525 Bacteria 10052
187 Ga0495666_0001858 3300046526 Bacteria 10423
188 Ga0495666_0025915 3300046526 Bacteria 2894
189 Ga0495666_0125366 3300046526 Bacteria 1201
190 Ga0495642_0009170 3300046528 Bacteria 3787
191 Ga0495642_0015178 3300046528 Bacteria 2989
192 Ga0495642_0038144 3300046528 Bacteria 1946
193 Ga0495642_0056940 3300046528 Bacteria 1615
194 Ga0495642_0287867 3300046528 Bacteria 719
195 Ga0495642_0356551 3300046528 Bacteria 643
196 Ga0495654_0000028 3300046530 Bacteria 223384
197 Ga0495654_0002137 3300046530 Bacteria 12898
198 Ga0495654_0004934 3300046530 Bacteria 7847
199 Ga0495654_0031832 3300046530 Bacteria 2676
200 Ga0495654_0037332 3300046530 Bacteria 2437
201 Ga0495654_0052811 3300046530 Bacteria 1977
202 Ga0495665_0006409 3300046531 Bacteria 6353
203 Ga0495586_0011489 3300046535 Bacteria 4709
204 Ga0495586_0028710 3300046535 Bacteria 2977
205 Ga0495587_0072411 3300046536 Bacteria 2003
206 Ga0495609_0005357 3300046538 Bacteria 6768
207 Ga0495609_0012980 3300046538 Bacteria 3941
208 Ga0495609_0025334 3300046538 Bacteria 2720
209 Ga0495609_0025927 3300046538 Bacteria 2686
210 Ga0495609_0026488 3300046538 Bacteria 2655
211 Ga0495609_0034575 3300046538 Bacteria 2291
212 Ga0495609_0043230 3300046538 Bacteria 2023
213 Ga0495609_0061184 3300046538 Bacteria 1663
214 Ga0495609_0076003 3300046538 Bacteria 1472
215 Ga0495609_0096249 3300046538 Bacteria 1284
216 Ga0495597_0005218 3300046542 Bacteria 6911
217 Ga0495597_0015311 3300046542 Bacteria 3632
218 Ga0495597_0019775 3300046542 Bacteria 3145
219 Ga0495597_0042379 3300046542 Bacteria 2030
220 Ga0495597_0115477 3300046542 Bacteria 1122
221 Ga0495597_0157285 3300046542 Bacteria 929
222 Ga0495597_0181213 3300046542 Bacteria 851
223 Ga0495597_0238577 3300046542 Bacteria 717
224 Ga0495622_0027697 3300046557 Bacteria 2644
225 Ga0495622_0059824 3300046557 Bacteria 1763
226 Ga0495622_0153048 3300046557 Bacteria 1043
227 Ga0495633_0003752 3300046558 Bacteria 9987
228 Ga0495633_0003964 3300046558 Bacteria 9619
229 Ga0495633_0012700 3300046558 Bacteria 4468
230 Ga0495633_0014830 3300046558 Bacteria 4058
231 Ga0495633_0067390 3300046558 Bacteria 1671
232 Ga0495633_0068817 3300046558 Bacteria 1652
233 Ga0495656_0005234 3300046615 Bacteria 4470
234 Ga0495668_0000155 3300046616 Bacteria 103810
235 Ga0495668_0001678 3300046616 Bacteria 20526
236 Ga0495668_0006214 3300046616 Bacteria 7890
237 Ga0495668_0012216 3300046616 Bacteria 5102
238 Ga0495668_0013860 3300046616 Bacteria 4741
239 Ga0495668_0030423 3300046616 Bacteria 3048
240 Ga0495668_0030758 3300046616 Bacteria 3028
241 Ga0495668_0174807 3300046616 Bacteria 1176
242 Ga0495611_0007413 3300046648 Bacteria 4658
243 Ga0495611_0025754 3300046648 Bacteria 2565
244 Ga0495611_0029412 3300046648 Bacteria 2409
245 Ga0495611_0066195 3300046648 Bacteria 1647
246 Ga0495625_0044130 3300046660 Bacteria 3229
247 Ga0495625_0590858 3300046660 Bacteria 668
248 Ga0495661_0006572 3300046665 Bacteria 8166
249 Ga0495661_0017333 3300046665 Bacteria 4758
250 Ga0495661_0046983 3300046665 Bacteria 2631
251 Ga0495661_0092913 3300046665 Bacteria 1713
252 Ga0495661_0196351 3300046665 Bacteria 1059
253 Ga0495661_0258552 3300046665 Bacteria 885
254 Ga0495588_0000137 3300046674 Bacteria 114279
255 Ga0495588_0010637 3300046674 Bacteria 4287
256 Ga0495588_0015616 3300046674 Bacteria 3659
257 Ga0495588_0022360 3300046674 Bacteria 3124
258 Ga0495588_0037417 3300046674 Bacteria 2465
259 Ga0495588_0060302 3300046674 Bacteria 1963
260 Ga0495588_0080867 3300046674 Bacteria 1696
261 Ga0495588_0130866 3300046674 Bacteria 1324
262 Ga0495623_0031521 3300046679 Bacteria 3408
263 Ga0495623_0137079 3300046679 Bacteria 1459
264 Ga0495669_0000424 3300046684 Bacteria 20190
265 Ga0495613_0021557 3300046689 Bacteria 4800
266 Ga0495670_0005740 3300046691 Bacteria 6085
267 Ga0495670_0006664 3300046691 Bacteria 5680
268 Ga0495670_0013631 3300046691 Bacteria 3996
269 Ga0495670_0033792 3300046691 Bacteria 2545
270 Ga0495670_0355225 3300046691 Bacteria 789
271 Ga0495670_0618009 3300046691 Bacteria 590
272 Ga0495671_0000001 3300046692 Bacteria 1169494
273 Ga0495671_0011145 3300046692 Bacteria 4962
274 Ga0495671_0066312 3300046692 Bacteria 1776
275 Ga0495671_0095202 3300046692 Bacteria 1457
276 Ga0495671_0122485 3300046692 Bacteria 1268
277 Ga0495649_0080183 3300046694 Bacteria 1746
278 Ga0495649_0330971 3300046694 Bacteria 772
279 Ga0495589_0060990 3300046794 Bacteria 1851
280 Ga0495589_0258007 3300046794 Bacteria 813
281 Ga0495589_0320371 3300046794 Bacteria 716
282 Ga0495589_0337981 3300046794 Bacteria 694
283 Ga0495600_0394477 3300046809 Bacteria 862
284 Ga0495660_0009625 3300046810 Bacteria 5634
285 Ga0495660_0041504 3300046810 Bacteria 2546
286 Ga0495660_0118395 3300046810 Bacteria 1343
287 Ga0495581_0030504 3300047315 Bacteria 3124
288 Ga0495636_0030180 3300047318 Bacteria 2215
289 Ga0495636_0035453 3300047318 Bacteria 2055
290 Ga0495636_0115861 3300047318 Bacteria 1182
291 Ga0495672_0003558 3300047320 Bacteria 13257
292 Ga0495672_0003794 3300047320 Bacteria 12717
293 Ga0495672_0028611 3300047320 Bacteria 3522
294 Ga0495672_0164326 3300047320 Bacteria 1138
295 Ga0495676_0003736 3300047321 Bacteria 13824
296 Ga0495680_0012712 3300047322 Bacteria 7390
297 Ga0495680_0105884 3300047322 Bacteria 2091
298 Ga0495680_0430841 3300047322 Bacteria 906
299 Ga0495683_0000079 3300047323 Bacteria 96333
300 Ga0495683_0019051 3300047323 Bacteria 3542
301 Ga0495683_0033752 3300047323 Bacteria 2602
302 Ga0495683_0044251 3300047323 Bacteria 2239
303 Ga0495683_0093099 3300047323 Bacteria 1458
304 Ga0495683_0103523 3300047323 Bacteria 1366
305 Ga0495683_0272978 3300047323 Bacteria 734
306 Ga0495683_0458429 3300047323 Bacteria 522
307 Ga0495687_074632 3300047443 Bacteria 1348
308 Ga0495687_150604 3300047443 Bacteria 796
309 Ga0495675_0067283 3300047444 Bacteria 2264
310 Ga0495675_0112131 3300047444 Bacteria 1702
311 Ga0495677_0004957 3300047445 Bacteria 5078
312 Ga0495677_0016267 3300047445 Bacteria 2698
313 Ga0495677_0260772 3300047445 Bacteria 678
314 Ga0495679_004871 3300047446 Bacteria 6061
315 Ga0495679_016428 3300047446 Bacteria 2678
316 Ga0495679_048380 3300047446 Bacteria 1286
317 Ga0495685_010170 3300047447 Bacteria 3153
318 Ga0495685_024028 3300047447 Bacteria 2098
319 Ga0495673_0000006 3300047469 Bacteria 908691
320 Ga0495673_0000049 3300047469 Bacteria 265878
321 Ga0495673_0063666 3300047469 Bacteria 1571
322 Ga0495673_0099641 3300047469 Bacteria 1176
323 Ga0495681_0008449 3300047470 Bacteria 6459
324 Ga0495681_0018649 3300047470 Bacteria 3816
325 Ga0495681_0038626 3300047470 Bacteria 2338
326 Ga0495681_0311916 3300047470 Bacteria 606
327 Ga0495686_0016127 3300047472 Bacteria 5077
328 Ga0495686_0070662 3300047472 Bacteria 2150
329 Ga0495686_0213844 3300047472 Bacteria 1100
330 Ga0495686_0305152 3300047472 Bacteria 877
331 Ga0495686_0422483 3300047472 Bacteria 712
332 Ga0495593_0012671 3300047673 Bacteria 4815
333 Ga0495593_0158412 3300047673 Bacteria 1143
334 Ga0495593_0217604 3300047673 Bacteria 958
335 Ga0495614_0005107 3300048089 Bacteria 5921
336 Ga0495614_0013294 3300048089 Bacteria 3610
337 Ga0495626_0006578 3300048091 Bacteria 6591
338 Ga0495626_0007407 3300048091 Bacteria 6113
339 Ga0495626_0012435 3300048091 Bacteria 4462
340 Ga0495626_0037068 3300048091 Bacteria 2319
341 Ga0495626_0056897 3300048091 Bacteria 1789
342 Ga0495626_0072241 3300048091 Bacteria 1548
343 Ga0495626_0149514 3300048091 Bacteria 985
344 Ga0496102_0000196 3300048905 Bacteria 82747
345 Ga0496102_0103228 3300048905 Bacteria 2651
346 Ga0496102_0132231 3300048905 Bacteria 2337
347 Ga0496102_0162324 3300048905 Bacteria 2102
348 Ga0496102_0175515 3300048905 Bacteria 2017
349 Ga0496103_0019453 3300048906 Bacteria 4079
350 Ga0496103_0099471 3300048906 Bacteria 1840
351 Ga0496103_0209476 3300048906 Bacteria 1254
352 Ga0496104_0467082 3300048907 Bacteria 1173
353 Ga0496112_1119955 3300048915 Bacteria 705
354 Ga0496113_0002440 3300048916 Bacteria 10812
355 Ga0496116_0170134 3300048919 Bacteria 1181
356 Ga0496121_0242552 3300048924 Bacteria 1255
357 Ga0496121_0536877 3300048924 Bacteria 734
358 Ga0496122_0028264 3300048925 Bacteria 4766
359 Ga0496122_0033411 3300048925 Bacteria 4232
360 Ga0496123_0009114 3300048926 Bacteria 8982
361 Ga0496123_0058446 3300048926 Bacteria 2501
362 Ga0496124_0016142 3300048927 Bacteria 7121
363 Ga0496124_0041458 3300048927 Bacteria 3972
364 Ga0496124_0054782 3300048927 Bacteria 3374
365 Ga0496126_0007264 3300048929 Bacteria 12179
366 Ga0501310_003869 3300049130 Bacteria 1480
367 Ga0495678_002162 3300049459 Bacteria 13865
368 Ga0495678_002268 3300049459 Bacteria 13342
369 Ga0495678_006254 3300049459 Bacteria 6360
370 Ga0495678_009894 3300049459 Bacteria 4674
371 Ga0495678_012372 3300049459 Bacteria 4049
372 Ga0495682_0011702 3300049460 Bacteria 3372
373 Ga0495682_0075422 3300049460 Bacteria 1213
374 Ga0495682_0150015 3300049460 Bacteria 831
375 Ga0501279_006343 3300049775 Bacteria 1563
376 Ga0501279_007721 3300049775 Bacteria 1428
377 Ga0500594_0221957 3300053118 Bacteria 625
378 Ga0500618_001167 3300053125 Bacteria 12690
379 Ga0500618_039653 3300053125 Bacteria 1084
380 Ga0500586_000757 3300053145 Bacteria 6634
381 Ga0500586_001713 3300053145 Bacteria 4733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0086453 Ga0495653_0086453_1131_1598 140
2 3300046536 Ga0495587_0072411 Ga0495587_0072411_940_1407 140
3 3300047322 Ga0495680_0105884 Ga0495680_0105884_1157_1624 140
4 3300046500 Ga0495596_0001540 Ga0495596_0001540_5040_5495 150
5 3300046518 Ga0495631_0004758 Ga0495631_0004758_2010_2465 150
6 3300046522 Ga0495643_0037163 Ga0495643_0037163_1858_2313 150
7 3300046794 Ga0495589_0258007 Ga0495589_0258007_262_717 150
8 3300047323 Ga0495683_0093099 Ga0495683_0093099_301_756 150
9 3300048091 Ga0495626_0012435 Ga0495626_0012435_41_496 150
10 3300047323 Ga0495683_0458429 Ga0495683_0458429_28_489 152
11 3300003215 JGI25153J46596_10040255 JGI25153J46596_100402552 153
12 3300046463 Ga0495653_0792161 Ga0495653_0792161_79_549 154
13 3300046526 Ga0495666_0125366 Ga0495666_0125366_368_841 154
14 3300046528 Ga0495642_0356551 Ga0495642_0356551_119_604 154
15 3300005293 Ga0065715_10556045 Ga0065715_105560451 155
16 3300025263 Ga0209565_1026908 Ga0209565_10269081 155
17 3300044735 Ga0466968_0030791 Ga0466968_0030791_789_1265 155
18 3300046460 Ga0495638_0018726 Ga0495638_0018726_2028_2510 156
19 3300046500 Ga0495596_0032284 Ga0495596_0032284_504_986 156
20 3300046507 Ga0495606_0085826 Ga0495606_0085826_965_1447 156
21 3300046513 Ga0495616_0132954 Ga0495616_0132954_259_741 156
22 3300046518 Ga0495631_0066109 Ga0495631_0066109_123_605 156
23 3300046519 Ga0495632_0009864 Ga0495632_0009864_1153_1635 156
24 3300046522 Ga0495643_0036406 Ga0495643_0036406_1460_1942 156
25 3300046526 Ga0495666_0025915 Ga0495666_0025915_1314_1835 156
26 3300046528 Ga0495642_0056940 Ga0495642_0056940_51_533 156
27 3300046538 Ga0495609_0012980 Ga0495609_0012980_1434_1916 156
28 3300046542 Ga0495597_0238577 Ga0495597_0238577_131_613 156
29 3300046648 Ga0495611_0025754 Ga0495611_0025754_1944_2426 156
30 3300046665 Ga0495661_0258552 Ga0495661_0258552_264_746 156
31 3300046794 Ga0495589_0337981 Ga0495589_0337981_185_676 156
32 3300047323 Ga0495683_0103523 Ga0495683_0103523_99_581 156
33 3300047445 Ga0495677_0260772 Ga0495677_0260772_16_498 156
34 3300047447 Ga0495685_024028 Ga0495685_024028_1492_1974 156
35 3300047472 Ga0495686_0213844 Ga0495686_0213844_577_1059 156
36 3300048091 Ga0495626_0037068 Ga0495626_0037068_29_520 156
37 3300049460 Ga0495682_0011702 Ga0495682_0011702_1450_1932 156
38 3300046528 Ga0495642_0009170 Ga0495642_0009170_392_922 158
39 3300009176 Ga0105242_10132564 Ga0105242_101325643 160
40 3300015262 Ga0182007_10061015 Ga0182007_100610152 160
41 3300046499 Ga0495594_0031120 Ga0495594_0031120_1419_1922 161
42 3300046471 Ga0495650_0011483 Ga0495650_0011483_75_584 162
43 3300046492 Ga0495585_0003422 Ga0495585_0003422_6749_7255 162
44 3300046691 Ga0495670_0618009 Ga0495670_0618009_43_549 162
45 3300053125 Ga0500618_039653 Ga0500618_039653_523_1047 162
46 3300017792 Ga0163161_10454364 Ga0163161_104543642 163
47 3300048905 Ga0496102_0132231 Ga0496102_0132231_672_1175 163
48 3300006028 Ga0070717_10033076 Ga0070717_100330764 164
49 3300046463 Ga0495653_0018441 Ga0495653_0018441_404_967 164
50 3300046491 Ga0495584_0113542 Ga0495584_0113542_282_794 164
51 3300046506 Ga0495583_0000295 Ga0495583_0000295_11384_11896 164
52 3300046507 Ga0495606_0000232 Ga0495606_0000232_11153_11683 164
53 3300046535 Ga0495586_0011489 Ga0495586_0011489_340_903 164
54 3300046538 Ga0495609_0026488 Ga0495609_0026488_1559_2071 164
55 3300046542 Ga0495597_0019775 Ga0495597_0019775_672_1184 164
56 3300046660 Ga0495625_0590858 Ga0495625_0590858_57_569 164
57 3300046665 Ga0495661_0092913 Ga0495661_0092913_372_884 164
58 3300046674 Ga0495588_0080867 Ga0495588_0080867_979_1500 164
59 3300047470 Ga0495681_0018649 Ga0495681_0018649_908_1420 164
60 3300048091 Ga0495626_0007407 Ga0495626_0007407_5492_6004 164
61 3300048927 Ga0496124_0016142 Ga0496124_0016142_4950_5498 164
62 3300046460 Ga0495638_0062952 Ga0495638_0062952_1396_1938 165
63 3300046474 Ga0495605_0146786 Ga0495605_0146786_198_740 165
64 3300046474 Ga0495605_0269320 Ga0495605_0269320_89_604 165
65 3300046492 Ga0495585_0150210 Ga0495585_0150210_366_881 165
66 3300046506 Ga0495583_0013804 Ga0495583_0013804_2666_3208 165
67 3300046512 Ga0495610_0013231 Ga0495610_0013231_2277_2804 165
68 3300046513 Ga0495616_0007352 Ga0495616_0007352_1611_2153 165
69 3300046518 Ga0495631_0002122 Ga0495631_0002122_6685_7227 165
70 3300046522 Ga0495643_0002336 Ga0495643_0002336_9663_10190 165
71 3300046524 Ga0495648_0059115 Ga0495648_0059115_1223_1750 165
72 3300046528 Ga0495642_0287867 Ga0495642_0287867_70_585 165
73 3300046530 Ga0495654_0002137 Ga0495654_0002137_3857_4399 165
74 3300046538 Ga0495609_0005357 Ga0495609_0005357_5172_5687 165
75 3300046538 Ga0495609_0034575 Ga0495609_0034575_1640_2167 165
76 3300046538 Ga0495609_0076003 Ga0495609_0076003_884_1462 165
77 3300046538 Ga0495609_0096249 Ga0495609_0096249_626_1168 165
78 3300046542 Ga0495597_0115477 Ga0495597_0115477_526_1068 165
79 3300046557 Ga0495622_0153048 Ga0495622_0153048_161_676 165
80 3300046616 Ga0495668_0001678 Ga0495668_0001678_8017_8559 165
81 3300046616 Ga0495668_0030423 Ga0495668_0030423_1461_1976 165
82 3300046648 Ga0495611_0029412 Ga0495611_0029412_1512_2027 165
83 3300046692 Ga0495671_0011145 Ga0495671_0011145_4263_4805 165
84 3300046692 Ga0495671_0095202 Ga0495671_0095202_543_1070 165
85 3300046810 Ga0495660_0041504 Ga0495660_0041504_1994_2536 165
86 3300047318 Ga0495636_0115861 Ga0495636_0115861_285_827 165
87 3300047320 Ga0495672_0003558 Ga0495672_0003558_3468_3995 165
88 3300047445 Ga0495677_0004957 Ga0495677_0004957_1103_1618 165
89 3300047446 Ga0495679_004871 Ga0495679_004871_1901_2443 165
90 3300047447 Ga0495685_010170 Ga0495685_010170_880_1422 165
91 3300047469 Ga0495673_0063666 Ga0495673_0063666_712_1227 165
92 3300047470 Ga0495681_0038626 Ga0495681_0038626_1515_2057 165
93 3300049459 Ga0495678_002268 Ga0495678_002268_4254_4796 165
94 3300049459 Ga0495678_006254 Ga0495678_006254_2263_2790 165
95 3300049460 Ga0495682_0075422 Ga0495682_0075422_607_1149 165
96 3300049775 Ga0501279_007721 Ga0501279_007721_17_514 165
97 3300003771 Ga0055526_1000198 Ga0055526_10001987 166
98 3300009036 Ga0105244_10008385 Ga0105244_100083855 166
99 3300025245 Ga0207425_1000264 Ga0207425_100026423 166
100 3300025294 Ga0209025_1002375 Ga0209025_10023752 166
101 3300025295 Ga0209564_1000009 Ga0209564_1000009435 166
102 3300025297 Ga0209758_1000751 Ga0209758_100075123 166
103 3300025728 Ga0207655_1026827 Ga0207655_10268272 166
104 3300035114 Ga0373939_0059176 Ga0373939_0059176_443_943 166
105 3300046471 Ga0495650_0003542 Ga0495650_0003542_3525_4025 166
106 3300046474 Ga0495605_0000044 Ga0495605_0000044_64939_65439 166
107 3300046520 Ga0495637_0000318 Ga0495637_0000318_29843_30373 166
108 3300046524 Ga0495648_0007327 Ga0495648_0007327_1257_1772 166
109 3300046526 Ga0495666_0001858 Ga0495666_0001858_4874_5434 166
110 3300046530 Ga0495654_0000028 Ga0495654_0000028_47866_48396 166
111 3300046531 Ga0495665_0006409 Ga0495665_0006409_2583_3143 166
112 3300046542 Ga0495597_0181213 Ga0495597_0181213_63_626 166
113 3300046616 Ga0495668_0013860 Ga0495668_0013860_840_1340 166
114 3300046679 Ga0495623_0031521 Ga0495623_0031521_2582_3142 166
115 3300046691 Ga0495670_0355225 Ga0495670_0355225_154_693 166
116 3300046694 Ga0495649_0330971 Ga0495649_0330971_196_759 166
117 3300046810 Ga0495660_0118395 Ga0495660_0118395_496_1026 166
118 3300047322 Ga0495680_0430841 Ga0495680_0430841_101_661 166
119 3300047323 Ga0495683_0272978 Ga0495683_0272978_192_719 166
120 3300047444 Ga0495675_0112131 Ga0495675_0112131_1042_1602 166
121 3300048091 Ga0495626_0006578 Ga0495626_0006578_1188_1751 166
122 3300048091 Ga0495626_0056897 Ga0495626_0056897_1132_1695 166
123 3300048919 Ga0496116_0170134 Ga0496116_0170134_236_736 166
124 3300048927 Ga0496124_0041458 Ga0496124_0041458_755_1255 166
125 iso_pu_bacteria 2738541297 2738829487 166
126 iso_pu_bacteria 2738541357 2739153283 166
127 iso_pu_bacteria 2738543003 2739195203 166
128 iso_pu_bacteria 2738543026 2739321679 166
129 iso_pu_bacteria 2738543029 2739339765 166
130 3300030731 Ga0316177_1200651 Ga0316177_12006513 167
131 3300037312 Ga0395899_0000028 Ga0395899_0000028_318807_319328 167
132 3300042005 Ga0439448_0002726 Ga0439448_0002726_3030_3557 167
133 3300044693 Ga0466961_0046245 Ga0466961_0046245_394_921 167
134 3300044706 Ga0466964_0008159 Ga0466964_0008159_2548_3075 167
135 3300045976 Ga0466967_0036871 Ga0466967_0036871_2892_3419 167
136 3300046471 Ga0495650_0047430 Ga0495650_0047430_152_679 167
137 3300046491 Ga0495584_0009015 Ga0495584_0009015_1129_1722 167
138 3300046491 Ga0495584_0023559 Ga0495584_0023559_1442_2008 167
139 3300046506 Ga0495583_0010195 Ga0495583_0010195_4949_5491 167
140 3300046507 Ga0495606_0239351 Ga0495606_0239351_299_826 167
141 3300046513 Ga0495616_0002071 Ga0495616_0002071_5664_6218 167
142 3300046519 Ga0495632_0004948 Ga0495632_0004948_7035_7553 167
143 3300046522 Ga0495643_0001229 Ga0495643_0001229_16737_17279 167
144 3300046530 Ga0495654_0031832 Ga0495654_0031832_17_610 167
145 3300046530 Ga0495654_0037332 Ga0495654_0037332_1307_1882 167
146 3300046530 Ga0495654_0052811 Ga0495654_0052811_1112_1654 167
147 3300046538 Ga0495609_0025334 Ga0495609_0025334_1061_1654 167
148 3300046542 Ga0495597_0005218 Ga0495597_0005218_4392_4985 167
149 3300046616 Ga0495668_0012216 Ga0495668_0012216_1527_2120 167
150 3300046794 Ga0495589_0320371 Ga0495589_0320371_93_686 167
151 3300046809 Ga0495600_0394477 Ga0495600_0394477_72_635 167
152 3300047320 Ga0495672_0028611 Ga0495672_0028611_1002_1595 167
153 3300047322 Ga0495680_0012712 Ga0495680_0012712_4865_5428 167
154 3300047470 Ga0495681_0311916 Ga0495681_0311916_29_583 167
155 3300047472 Ga0495686_0422483 Ga0495686_0422483_118_660 167
156 3300047673 Ga0495593_0217604 Ga0495593_0217604_189_752 167
157 3300048089 Ga0495614_0005107 Ga0495614_0005107_2599_3162 167
158 3300049459 Ga0495678_009894 Ga0495678_009894_2405_2929 167
159 iso_pu_bacteria 2643221638 2644215701 167
160 3300037312 Ga0395899_0004930 Ga0395899_0004930_9609_10280 168
161 3300038443 Ga0395901_0563458 Ga0395901_0563458_267_797 168
162 3300044765 Ga0466970_0323097 Ga0466970_0323097_77_610 168
163 3300046452 Ga0495617_139869 Ga0495617_139869_231_752 168
164 3300046460 Ga0495638_0019679 Ga0495638_0019679_657_1178 168
165 3300046474 Ga0495605_0080757 Ga0495605_0080757_775_1296 168
166 3300046499 Ga0495594_0030390 Ga0495594_0030390_2323_2889 168
167 3300046501 Ga0495607_0080920 Ga0495607_0080920_58_579 168
168 3300046524 Ga0495648_0070386 Ga0495648_0070386_1456_1992 168
169 3300046535 Ga0495586_0028710 Ga0495586_0028710_2064_2594 168
170 3300046674 Ga0495588_0000137 Ga0495588_0000137_53201_53734 168
171 3300046674 Ga0495588_0010637 Ga0495588_0010637_924_1490 168
172 3300046674 Ga0495588_0015616 Ga0495588_0015616_1716_2252 168
173 3300046674 Ga0495588_0060302 Ga0495588_0060302_263_790 168
174 3300046692 Ga0495671_0122485 Ga0495671_0122485_678_1199 168
175 3300047323 Ga0495683_0033752 Ga0495683_0033752_848_1369 168
176 3300047444 Ga0495675_0067283 Ga0495675_0067283_1025_1555 168
177 3300047469 Ga0495673_0099641 Ga0495673_0099641_558_1079 168
178 3300047673 Ga0495593_0012671 Ga0495593_0012671_3761_4291 168
179 3300048905 Ga0496102_0175515 Ga0496102_0175515_38_553 168
180 3300048915 Ga0496112_1119955 Ga0496112_1119955_63_593 168
181 3300048916 Ga0496113_0002440 Ga0496113_0002440_1168_1695 168
182 3300048925 Ga0496122_0028264 Ga0496122_0028264_1864_2391 168
183 3300048926 Ga0496123_0058446 Ga0496123_0058446_661_1188 168
184 3300049459 Ga0495678_012372 Ga0495678_012372_46_567 168
185 3300049460 Ga0495682_0150015 Ga0495682_0150015_222_743 168
186 3300053118 Ga0500594_0221957 Ga0500594_0221957_61_573 168
187 iso_pu_bacteria 2821131069 2821131357 168
188 3300005344 Ga0070661_101132113 Ga0070661_1011321131 169
189 3300005366 Ga0070659_100185266 Ga0070659_1001852663 169
190 3300005455 Ga0070663_100647934 Ga0070663_1006479342 169
191 3300013102 Ga0157371_10000001 Ga0157371_10000001122 169
192 3300013307 Ga0157372_10421486 Ga0157372_104214862 169
193 3300014497 Ga0182008_10020158 Ga0182008_100201582 169
194 3300025919 Ga0207657_10011869 Ga0207657_100118694 169
195 3300025932 Ga0207690_10045145 Ga0207690_100451453 169
196 3300025949 Ga0207667_10707620 Ga0207667_107076202 169
197 3300026067 Ga0207678_10674899 Ga0207678_106748992 169
198 3300037418 Ga0395900_0133363 Ga0395900_0133363_255_797 169
199 3300037418 Ga0395900_0351022 Ga0395900_0351022_740_1273 169
200 3300046452 Ga0495617_002816 Ga0495617_002816_2044_2574 169
201 3300046455 Ga0495603_0151387 Ga0495603_0151387_264_857 169
202 3300046457 Ga0495590_0000238 Ga0495590_0000238_5980_6513 169
203 3300046473 Ga0495582_0007638 Ga0495582_0007638_4483_5076 169
204 3300046474 Ga0495605_0041811 Ga0495605_0041811_1082_1675 169
205 3300046474 Ga0495605_0062165 Ga0495605_0062165_520_1113 169
206 3300046491 Ga0495584_0000806 Ga0495584_0000806_12376_12906 169
207 3300046491 Ga0495584_0001696 Ga0495584_0001696_8684_9217 169
208 3300046491 Ga0495584_0038384 Ga0495584_0038384_893_1486 169
209 3300046491 Ga0495584_0047194 Ga0495584_0047194_734_1327 169
210 3300046491 Ga0495584_0052317 Ga0495584_0052317_1134_1715 169
211 3300046491 Ga0495584_0094818 Ga0495584_0094818_664_1257 169
212 3300046491 Ga0495584_0102754 Ga0495584_0102754_418_1017 169
213 3300046491 Ga0495584_0194326 Ga0495584_0194326_207_809 169
214 3300046492 Ga0495585_0000122 Ga0495585_0000122_14174_14707 169
215 3300046492 Ga0495585_0001385 Ga0495585_0001385_8085_8615 169
216 3300046492 Ga0495585_0002644 Ga0495585_0002644_3655_4188 169
217 3300046492 Ga0495585_0008853 Ga0495585_0008853_892_1485 169
218 3300046492 Ga0495585_0015785 Ga0495585_0015785_1406_1942 169
219 3300046492 Ga0495585_0054539 Ga0495585_0054539_960_1526 169
220 3300046492 Ga0495585_0184642 Ga0495585_0184642_231_824 169
221 3300046499 Ga0495594_0033862 Ga0495594_0033862_491_1084 169
222 3300046500 Ga0495596_0009563 Ga0495596_0009563_2177_2770 169
223 3300046500 Ga0495596_0009649 Ga0495596_0009649_567_1163 169
224 3300046500 Ga0495596_0013257 Ga0495596_0013257_2417_2959 169
225 3300046500 Ga0495596_0017054 Ga0495596_0017054_429_962 169
226 3300046500 Ga0495596_0046945 Ga0495596_0046945_234_827 169
227 3300046500 Ga0495596_0112689 Ga0495596_0112689_402_995 169
228 3300046501 Ga0495607_0039153 Ga0495607_0039153_1585_2166 169
229 3300046501 Ga0495607_0090040 Ga0495607_0090040_566_1159 169
230 3300046506 Ga0495583_0000230 Ga0495583_0000230_5027_5560 169
231 3300046506 Ga0495583_0028995 Ga0495583_0028995_378_974 169
232 3300046506 Ga0495583_0029583 Ga0495583_0029583_1348_1887 169
233 3300046506 Ga0495583_0063089 Ga0495583_0063089_703_1233 169
234 3300046507 Ga0495606_0007462 Ga0495606_0007462_1897_2427 169
235 3300046507 Ga0495606_0129062 Ga0495606_0129062_914_1441 169
236 3300046507 Ga0495606_0239216 Ga0495606_0239216_365_901 169
237 3300046507 Ga0495606_0300279 Ga0495606_0300279_276_857 169
238 3300046507 Ga0495606_0437859 Ga0495606_0437859_91_621 169
239 3300046513 Ga0495616_0002381 Ga0495616_0002381_506_1036 169
240 3300046513 Ga0495616_0004476 Ga0495616_0004476_433_966 169
241 3300046513 Ga0495616_0033841 Ga0495616_0033841_1880_2473 169
242 3300046518 Ga0495631_0005156 Ga0495631_0005156_4503_5105 169
243 3300046518 Ga0495631_0026920 Ga0495631_0026920_892_1485 169
244 3300046518 Ga0495631_0051892 Ga0495631_0051892_892_1485 169
245 3300046518 Ga0495631_0074488 Ga0495631_0074488_392_985 169
246 3300046522 Ga0495643_0005470 Ga0495643_0005470_4295_4825 169
247 3300046522 Ga0495643_0059460 Ga0495643_0059460_579_1109 169
248 3300046523 Ga0495644_0016046 Ga0495644_0016046_716_1309 169
249 3300046523 Ga0495644_0087375 Ga0495644_0087375_368_934 169
250 3300046524 Ga0495648_0000118 Ga0495648_0000118_83782_84312 169
251 3300046525 Ga0495663_0000893 Ga0495663_0000893_3257_3796 169
252 3300046528 Ga0495642_0015178 Ga0495642_0015178_418_1011 169
253 3300046528 Ga0495642_0038144 Ga0495642_0038144_44_637 169
254 3300046538 Ga0495609_0025927 Ga0495609_0025927_1496_2029 169
255 3300046538 Ga0495609_0043230 Ga0495609_0043230_1457_1990 169
256 3300046538 Ga0495609_0061184 Ga0495609_0061184_49_642 169
257 3300046542 Ga0495597_0015311 Ga0495597_0015311_2097_2693 169
258 3300046542 Ga0495597_0042379 Ga0495597_0042379_484_1074 169
259 3300046542 Ga0495597_0157285 Ga0495597_0157285_256_837 169
260 3300046557 Ga0495622_0027697 Ga0495622_0027697_1561_2154 169
261 3300046557 Ga0495622_0059824 Ga0495622_0059824_465_1058 169
262 3300046558 Ga0495633_0003964 Ga0495633_0003964_2241_2774 169
263 3300046558 Ga0495633_0012700 Ga0495633_0012700_3827_4396 169
264 3300046558 Ga0495633_0014830 Ga0495633_0014830_3096_3698 169
265 3300046558 Ga0495633_0067390 Ga0495633_0067390_799_1365 169
266 3300046558 Ga0495633_0068817 Ga0495633_0068817_445_1038 169
267 3300046615 Ga0495656_0005234 Ga0495656_0005234_31_570 169
268 3300046616 Ga0495668_0030758 Ga0495668_0030758_1501_2094 169
269 3300046616 Ga0495668_0174807 Ga0495668_0174807_399_992 169
270 3300046648 Ga0495611_0007413 Ga0495611_0007413_3117_3710 169
271 3300046648 Ga0495611_0066195 Ga0495611_0066195_663_1256 169
272 3300046660 Ga0495625_0044130 Ga0495625_0044130_1380_1973 169
273 3300046665 Ga0495661_0006572 Ga0495661_0006572_1781_2383 169
274 3300046665 Ga0495661_0017333 Ga0495661_0017333_1506_2075 169
275 3300046665 Ga0495661_0046983 Ga0495661_0046983_264_857 169
276 3300046665 Ga0495661_0196351 Ga0495661_0196351_159_752 169
277 3300046674 Ga0495588_0022360 Ga0495588_0022360_1561_2154 169
278 3300046674 Ga0495588_0037417 Ga0495588_0037417_636_1229 169
279 3300046674 Ga0495588_0130866 Ga0495588_0130866_730_1269 169
280 3300046684 Ga0495669_0000424 Ga0495669_0000424_7095_7688 169
281 3300046689 Ga0495613_0021557 Ga0495613_0021557_1184_1777 169
282 3300046691 Ga0495670_0005740 Ga0495670_0005740_3574_4176 169
283 3300046691 Ga0495670_0006664 Ga0495670_0006664_3203_3772 169
284 3300046691 Ga0495670_0013631 Ga0495670_0013631_2769_3362 169
285 3300046691 Ga0495670_0033792 Ga0495670_0033792_1288_1854 169
286 3300046794 Ga0495589_0060990 Ga0495589_0060990_807_1400 169
287 3300047315 Ga0495581_0030504 Ga0495581_0030504_2009_2602 169
288 3300047318 Ga0495636_0030180 Ga0495636_0030180_330_869 169
289 3300047318 Ga0495636_0035453 Ga0495636_0035453_111_650 169
290 3300047320 Ga0495672_0003794 Ga0495672_0003794_6042_6611 169
291 3300047320 Ga0495672_0164326 Ga0495672_0164326_293_874 169
292 3300047321 Ga0495676_0003736 Ga0495676_0003736_5779_6372 169
293 3300047323 Ga0495683_0000079 Ga0495683_0000079_22519_23052 169
294 3300047323 Ga0495683_0019051 Ga0495683_0019051_1661_2191 169
295 3300047443 Ga0495687_074632 Ga0495687_074632_345_878 169
296 3300047443 Ga0495687_150604 Ga0495687_150604_23_550 169
297 3300047445 Ga0495677_0016267 Ga0495677_0016267_316_918 169
298 3300047446 Ga0495679_048380 Ga0495679_048380_229_822 169
299 3300047470 Ga0495681_0008449 Ga0495681_0008449_2477_3079 169
300 3300047673 Ga0495593_0158412 Ga0495593_0158412_516_1109 169
301 3300048089 Ga0495614_0013294 Ga0495614_0013294_750_1343 169
302 3300048091 Ga0495626_0072241 Ga0495626_0072241_272_808 169
303 3300048091 Ga0495626_0149514 Ga0495626_0149514_222_815 169
304 3300048905 Ga0496102_0103228 Ga0496102_0103228_874_1407 169
305 3300048905 Ga0496102_0162324 Ga0496102_0162324_1285_1824 169
306 3300048906 Ga0496103_0099471 Ga0496103_0099471_892_1425 169
307 3300048906 Ga0496103_0209476 Ga0496103_0209476_136_675 169
308 3300048907 Ga0496104_0467082 Ga0496104_0467082_566_1099 169
309 3300048924 Ga0496121_0242552 Ga0496121_0242552_613_1137 169
310 3300049459 Ga0495678_002162 Ga0495678_002162_6806_7357 169
311 3300031548 Ga0307408_100000576 Ga0307408_1000005764 170
312 3300032002 Ga0307416_100002060 Ga0307416_10000206011 170
313 3300042008 Ga0439450_015719 Ga0439450_015719_951_1499 170
314 3300046452 Ga0495617_000898 Ga0495617_000898_9230_9757 170
315 3300046460 Ga0495638_0353298 Ga0495638_0353298_113_640 170
316 3300046463 Ga0495653_0000038 Ga0495653_0000038_7265_7792 170
317 3300046471 Ga0495650_0000048 Ga0495650_0000048_129011_129547 170
318 3300046471 Ga0495650_0002609 Ga0495650_0002609_10078_10605 170
319 3300046471 Ga0495650_0011183 Ga0495650_0011183_1941_2462 170
320 3300046492 Ga0495585_0009968 Ga0495585_0009968_3285_3812 170
321 3300046507 Ga0495606_0000537 Ga0495606_0000537_4942_5469 170
322 3300046512 Ga0495610_0000003 Ga0495610_0000003_312686_313213 170
323 3300046524 Ga0495648_0005843 Ga0495648_0005843_8741_9268 170
324 3300046530 Ga0495654_0004934 Ga0495654_0004934_1617_2144 170
325 3300046558 Ga0495633_0003752 Ga0495633_0003752_2293_2814 170
326 3300046616 Ga0495668_0006214 Ga0495668_0006214_4848_5375 170
327 3300046679 Ga0495623_0137079 Ga0495623_0137079_540_1103 170
328 3300046692 Ga0495671_0000001 Ga0495671_0000001_355560_356087 170
329 3300046692 Ga0495671_0066312 Ga0495671_0066312_603_1130 170
330 3300046694 Ga0495649_0080183 Ga0495649_0080183_931_1467 170
331 3300046810 Ga0495660_0009625 Ga0495660_0009625_3578_4105 170
332 3300047323 Ga0495683_0044251 Ga0495683_0044251_500_1063 170
333 3300047446 Ga0495679_016428 Ga0495679_016428_14_541 170
334 3300047469 Ga0495673_0000006 Ga0495673_0000006_821469_821996 170
335 3300047469 Ga0495673_0000049 Ga0495673_0000049_246011_246538 170
336 3300047472 Ga0495686_0070662 Ga0495686_0070662_436_1020 170
337 3300047472 Ga0495686_0305152 Ga0495686_0305152_71_607 170
338 3300048905 Ga0496102_0000196 Ga0496102_0000196_3653_4198 170
339 3300048906 Ga0496103_0019453 Ga0496103_0019453_435_980 170
340 3300048924 Ga0496121_0536877 Ga0496121_0536877_49_570 170
341 3300048925 Ga0496122_0033411 Ga0496122_0033411_2587_3114 170
342 3300048926 Ga0496123_0009114 Ga0496123_0009114_862_1389 170
343 3300048927 Ga0496124_0054782 Ga0496124_0054782_1005_1526 170
344 3300048929 Ga0496126_0007264 Ga0496126_0007264_9073_9600 170
345 3300053125 Ga0500618_001167 Ga0500618_001167_7097_7621 170
346 3300053145 Ga0500586_000757 Ga0500586_000757_3359_3880 170
347 3300053145 Ga0500586_001713 Ga0500586_001713_3603_4130 170
348 3300002773 JGI25152J39213_1001380 JGI25152J39213_100138016 171
349 3300002773 JGI25152J39213_1023757 JGI25152J39213_10237572 171
350 3300002774 JGI25150J39212_1000821 JGI25150J39212_10008214 171
351 3300003771 Ga0055526_1003501 Ga0055526_10035013 171
352 3300003771 Ga0055526_1022754 Ga0055526_10227542 171
353 3300003773 Ga0055537_1005707 Ga0055537_10057073 171
354 3300003773 Ga0055537_1006223 Ga0055537_10062231 171
355 3300003775 Ga0055524_1002255 Ga0055524_10022554 171
356 3300003775 Ga0055524_1002308 Ga0055524_10023083 171
357 3300003775 Ga0055524_1014445 Ga0055524_10144454 171
358 3300003784 Ga0055534_1003727 Ga0055534_10037275 171
359 3300003791 Ga0055530_10002937 Ga0055530_100029373 171
360 3300003791 Ga0055530_10003286 Ga0055530_1000328613 171
361 3300003791 Ga0055530_10020935 Ga0055530_100209351 171
362 3300003794 Ga0055531_10001502 Ga0055531_100015024 171
363 3300009176 Ga0105242_10451254 Ga0105242_104512542 171
364 3300025208 Ga0209436_101950 Ga0209436_1019507 171
365 3300025245 Ga0207425_1000001 Ga0207425_10000011598 171
366 3300025245 Ga0207425_1000249 Ga0207425_100024914 171
367 3300025258 Ga0209129_1000001 Ga0209129_1000001775 171
368 3300025258 Ga0209129_1003100 Ga0209129_10031004 171
369 3300025263 Ga0209565_1002036 Ga0209565_100203610 171
370 3300025263 Ga0209565_1002276 Ga0209565_10022762 171
371 3300025263 Ga0209565_1005339 Ga0209565_10053393 171
372 3300025273 Ga0209673_1062343 Ga0209673_10623432 171
373 3300025273 Ga0209673_1083202 Ga0209673_10832021 171
374 3300025291 Ga0209675_1006077 Ga0209675_10060775 171
375 3300025295 Ga0209564_1000178 Ga0209564_1000178150 171
376 3300025297 Ga0209758_1000116 Ga0209758_100011636 171
377 3300025298 Ga0209050_1001038 Ga0209050_100103825 171
378 3300025298 Ga0209050_1003669 Ga0209050_10036693 171
379 3300025298 Ga0209050_1004481 Ga0209050_10044813 171
380 3300025299 Ga0209256_1002696 Ga0209256_10026964 171
381 3300025299 Ga0209256_1009229 Ga0209256_10092296 171
382 3300025304 Ga0209257_1000293 Ga0209257_100029335 171
383 3300025304 Ga0209257_1006683 Ga0209257_10066833 171
384 3300031548 Ga0307408_100003945 Ga0307408_10000394515 171
385 3300046616 Ga0495668_0000155 Ga0495668_0000155_85027_85560 171
386 3300047472 Ga0495686_0016127 Ga0495686_0016127_2990_3523 171
387 3300049130 Ga0501310_003869 Ga0501310_003869_523_1038 171
388 3300049775 Ga0501279_006343 Ga0501279_006343_957_1472 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06271

RDD

RDD family

33

183

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t92-assembly1.cif.gz_C structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.5647 29 159
7t92-assembly1.cif.gz_B structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.5381 8 161
7t92-assembly1.cif.gz_B structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.4935 8 161
7t92-assembly1.cif.gz_A structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.4919 12 164
7t92-assembly1.cif.gz_C structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.4561 29 159
ID Description Score Start End Superfamily
af_O69663_16_156_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7275 7 164 1.10.287.1260
af_Q79FG7_24_134_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7169 11 153 1.10.287.1260
af_O69663_16_156_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7138 7 164 1.10.287.1260
af_Q79FG7_24_134_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6851 11 153 1.10.287.1260
af_O07420_20_145_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6007 11 153 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A850MZ50-F1-model_v4 deleted 0.9714 7 171
AF-A0A4R2VY11-F1-model_v4 deleted 0.9526 1 170
AF-A0A7G6ACB2-F1-model_v4 DUF3106 domain-containing protein 0.9418 6 166 GO:0016020
AF-A0A4R2VY11-F1-model_v4 deleted 0.9417 1 170
AF-A0A1H7RBY5-F1-model_v4 Uncharacterized membrane protein YckC, RDD family 0.9395 8 168 GO:0005886

Feature Viewer

pLDDT pTM Quality
88.89 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map