F431050

General Info

Members Datasets Scaffolds Average Seq Length
388 191 776 302

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100003298|Ga0070707_1000032984
Length 348
Sequence MARLDQSLLTRWTVGRSLSLVGRRQQLTLWQRWVRQPQNIWLRRAVFQVHLWSGVAIGLYVLMISVTGSVLVYRNELYRAATPSPIISKSTEPRLTDEQLTDAASRLYPGYRVVNLSRARNQDEAVEVSLVRGSDIQRRLFDPRSGSDLGKSVPTGIRLVSFLLDLHDNLLAGQTGRTVNGVGALALIALASTGLVIWWPGIKTWRRSLTLQRGTGWKSMTWHLHSMIGFWTFGFTLMFAASGVYLGFPEWFQDLADRIQPPTPENAGRRIVDDIVYWLAYLHFGRINGIGIPCHGPGLCDQTTKAIWALFGVAPAVMFVTGAIMWWNRVLRPRWKMWENVGSRSHVV

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 14.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100003298 3300005468 Bacteria 15243
2 SwRhRL2b_contig_1210459 2162886007 Bacteria 2402
3 Ga0065704_10084371 3300005289 Bacteria 3342
4 Ga0065715_10090249 3300005293 Bacteria 7357
5 Ga0070658_10028444 3300005327 Bacteria 4488
6 Ga0070690_100003873 3300005330 Bacteria 8247
7 Ga0070690_100134967 3300005330 Bacteria 1670
8 Ga0070690_100192675 3300005330 Bacteria 1414
9 Ga0070670_100065158 3300005331 Bacteria 3126
10 Ga0068869_100022965 3300005334 Unclassified 4302
11 Ga0068869_100092031 3300005334 Bacteria 2282
12 Ga0068869_100337870 3300005334 Unclassified 1225
13 Ga0070666_10000980 3300005335 Bacteria 17428
14 Ga0070666_10009159 3300005335 Bacteria 6172
15 Ga0070680_100104769 3300005336 Unclassified 2351
16 Ga0070682_100378005 3300005337 Archaea 1064
17 Ga0068868_100009429 3300005338 Bacteria 7023
18 Ga0068868_100039202 3300005338 Bacteria 3681
19 Ga0070660_100012604 3300005339 Bacteria 6041
20 Ga0070689_100239471 3300005340 Bacteria 1494
21 Ga0070687_100020515 3300005343 Bacteria 3091
22 Ga0070687_100041103 3300005343 Bacteria 2335
23 Ga0070661_100005214 3300005344 Bacteria 8948
24 Ga0070669_100000694 3300005353 Bacteria 24646
25 Ga0070675_100052539 3300005354 Bacteria 3350
26 Ga0070671_100027700 3300005355 Bacteria 4665
27 Ga0070671_100062379 3300005355 Bacteria 3104
28 Ga0070671_100274081 3300005355 Bacteria 1434
29 Ga0070674_100453976 3300005356 Bacteria 1058
30 Ga0070673_100054194 3300005364 Bacteria 3154
31 Ga0070673_100227065 3300005364 Bacteria 1618
32 Ga0070688_100003850 3300005365 Bacteria 7779
33 Ga0070667_100004342 3300005367 Bacteria 11954
34 Ga0070667_100005034 3300005367 Bacteria 11058
35 Ga0070667_100272811 3300005367 Bacteria 1517
36 Ga0070709_10037954 3300005434 Unclassified 2947
37 Ga0070709_10042325 3300005434 Unclassified 2812
38 Ga0070714_100000896 3300005435 Bacteria 21123
39 Ga0070714_100442350 3300005435 Bacteria 1234
40 Ga0070713_100001124 3300005436 Bacteria 17072
41 Ga0070701_10010989 3300005438 Unclassified 4026
42 Ga0070711_100029091 3300005439 Unclassified 3642
43 Ga0070705_100001044 3300005440 Bacteria 15430
44 Ga0070705_100006415 3300005440 Bacteria 5768
45 Ga0070705_100312593 3300005440 Bacteria 1131
46 Ga0070700_100044907 3300005441 Unclassified 2724
47 Ga0070700_100153995 3300005441 Bacteria 1575
48 Ga0070694_100000621 3300005444 Bacteria 19523
49 Ga0070694_100003216 3300005444 Bacteria 9751
50 Ga0070694_100135132 3300005444 Bacteria 1786
51 Ga0070662_100010902 3300005457 Bacteria 5989
52 Ga0070681_10323056 3300005458 Unclassified 1453
53 Ga0068867_100302754 3300005459 Archaea 1318
54 Ga0070685_10048494 3300005466 Bacteria 2446
55 Ga0070707_100285415 3300005468 Bacteria 1604
56 Ga0070698_100025168 3300005471 Bacteria 6202
57 Ga0070698_100040239 3300005471 Bacteria 4805
58 Ga0070698_100133592 3300005471 Bacteria 2436
59 Ga0070699_100000432 3300005518 Bacteria 40124
60 Ga0070699_100039707 3300005518 Bacteria 4075
61 Ga0070679_100316687 3300005530 Archaea 1510
62 Ga0070684_100007363 3300005535 Bacteria 8557
63 Ga0070684_100016807 3300005535 Bacteria 5990
64 Ga0070684_100112984 3300005535 Bacteria 2437
65 Ga0070684_100744403 3300005535 Bacteria 915
66 Ga0070697_100039613 3300005536 Bacteria 3811
67 Ga0070672_100011027 3300005543 Bacteria 6292
68 Ga0070672_100096453 3300005543 Bacteria 2393
69 Ga0070686_100017697 3300005544 Bacteria 4169
70 Ga0070686_100026508 3300005544 Bacteria 3499
71 Ga0070695_100000455 3300005545 Bacteria 21307
72 Ga0070695_100113711 3300005545 Unclassified 1841
73 Ga0070696_100005704 3300005546 Bacteria 8316
74 Ga0070696_100006987 3300005546 Bacteria 7530
75 Ga0070696_100007974 3300005546 Bacteria 7071
76 Ga0070696_100190279 3300005546 Unclassified 1527
77 Ga0070693_100065506 3300005547 Unclassified 2123
78 Ga0070693_100137850 3300005547 Bacteria 1532
79 Ga0070704_100000931 3300005549 Bacteria 14776
80 Ga0070704_100006081 3300005549 Bacteria 7082
81 Ga0070704_100043015 3300005549 Bacteria 3129
82 Ga0070704_100051681 3300005549 Unclassified 2896
83 Ga0070704_100267640 3300005549 Bacteria 1411
84 Ga0068855_100013416 3300005563 Bacteria 9880
85 Ga0068855_100020666 3300005563 Bacteria 7896
86 Ga0070664_100014400 3300005564 Bacteria 6449
87 Ga0070664_100014582 3300005564 Bacteria 6410
88 Ga0070664_100115641 3300005564 Bacteria 2345
89 Ga0070664_100136521 3300005564 Bacteria 2157
90 Ga0068857_100000508 3300005577 Bacteria 27941
91 Ga0068857_100004781 3300005577 Bacteria 11473
92 Ga0068857_100007006 3300005577 Bacteria 9702
93 Ga0068857_100011949 3300005577 Bacteria 7550
94 Ga0068857_100115022 3300005577 Unclassified 2419
95 Ga0068854_100023105 3300005578 Unclassified 4244
96 Ga0068856_100202606 3300005614 Bacteria 1999
97 Ga0070702_100024203 3300005615 Bacteria 3236
98 Ga0070702_100045232 3300005615 Unclassified 2489
99 Ga0068852_100027544 3300005616 Bacteria 4633
100 Ga0068859_100013065 3300005617 Bacteria 8343
101 Ga0068859_100239622 3300005617 Unclassified 1903
102 Ga0068864_100000613 3300005618 Bacteria 30125
103 Ga0068864_100015517 3300005618 Bacteria 6334
104 Ga0068864_100283243 3300005618 Bacteria 1548
105 Ga0068864_100545367 3300005618 Bacteria 1120
106 Ga0068861_100001174 3300005719 Bacteria 16312
107 Ga0068870_10013089 3300005840 Bacteria 3890
108 Ga0068863_100057817 3300005841 Bacteria 3670
109 Ga0068858_100007204 3300005842 Bacteria 10784
110 Ga0068858_100061667 3300005842 Bacteria 3467
111 Ga0068858_100114646 3300005842 Bacteria 2518
112 Ga0068858_100122625 3300005842 Bacteria 2432
113 Ga0068860_100008845 3300005843 Bacteria 10031
114 Ga0068860_100066707 3300005843 Bacteria 3419
115 Ga0068860_100195461 3300005843 Bacteria 1959
116 Ga0068860_100255823 3300005843 Unclassified 1706
117 Ga0068860_100260727 3300005843 Bacteria 1689
118 Ga0068862_100001144 3300005844 Bacteria 25121
119 Ga0070717_10025053 3300006028 Unclassified 4739
120 Ga0070716_100292139 3300006173 Bacteria 1130
121 Ga0070712_100047094 3300006175 Bacteria 2983
122 Ga0097621_100006571 3300006237 Bacteria 8257
123 Ga0097621_100010241 3300006237 Bacteria 6848
124 Ga0097621_100011186 3300006237 Bacteria 6605
125 Ga0097621_100029529 3300006237 Bacteria 4331
126 Ga0097621_100052970 3300006237 Bacteria 3307
127 Ga0097621_100208261 3300006237 Bacteria 1700
128 Ga0097621_100292835 3300006237 Bacteria 1436
129 Ga0097621_100339596 3300006237 Bacteria 1334
130 Ga0068871_100004244 3300006358 Bacteria 9934
131 Ga0068871_100016217 3300006358 Bacteria 5603
132 Ga0068871_100064515 3300006358 Bacteria 2999
133 Ga0068871_100113839 3300006358 Bacteria 2278
134 Ga0068871_100119986 3300006358 Unclassified 2220
135 Ga0075431_100021538 3300006847 Bacteria 6594
136 Ga0075433_10041891 3300006852 Bacteria 3970
137 Ga0075433_10104283 3300006852 Bacteria 2512
138 Ga0075434_100007344 3300006871 Bacteria 10200
139 Ga0075434_100093185 3300006871 Bacteria 3015
140 Ga0075434_100425456 3300006871 Unclassified 1349
141 Ga0075429_100053144 3300006880 Bacteria 3525
142 Ga0075429_100187869 3300006880 Bacteria 1811
143 Ga0075429_100344318 3300006880 Bacteria 1305
144 Ga0068865_100001355 3300006881 Bacteria 14252
145 Ga0068865_100099806 3300006881 Bacteria 2123
146 Ga0068865_100158179 3300006881 Bacteria 1726
147 Ga0097620_100013065 3300006931 Bacteria 8343
148 Ga0097620_100239622 3300006931 Unclassified 1903
149 Ga0075435_100015940 3300007076 Bacteria 5659
150 Ga0075435_100031058 3300007076 Bacteria 4205
151 Ga0105240_10501800 3300009093 Bacteria 1349
152 Ga0111539_10010124 3300009094 Bacteria 11881
153 Ga0111539_10033913 3300009094 Bacteria 6194
154 Ga0111539_10086419 3300009094 Bacteria 3685
155 Ga0111539_10191922 3300009094 Bacteria 2383
156 Ga0111539_10299394 3300009094 Bacteria 1872
157 Ga0105245_10002229 3300009098 Bacteria 17555
158 Ga0105245_10006621 3300009098 Bacteria 10175
159 Ga0105245_10313958 3300009098 Bacteria 1542
160 Ga0114129_10001076 3300009147 Bacteria 35909
161 Ga0114129_10017799 3300009147 Bacteria 10118
162 Ga0114129_10018129 3300009147 Bacteria 10026
163 Ga0114129_10020296 3300009147 Bacteria 9453
164 Ga0114129_10037176 3300009147 Bacteria 6874
165 Ga0114129_10039501 3300009147 Bacteria 6653
166 Ga0114129_10045470 3300009147 Bacteria 6172
167 Ga0114129_10251314 3300009147 Bacteria 2373
168 Ga0114129_10311074 3300009147 Bacteria 2097
169 Ga0105241_10000303 3300009174 Bacteria 36982
170 Ga0105241_10018914 3300009174 Bacteria 5077
171 Ga0105241_10035599 3300009174 Unclassified 3744
172 Ga0105241_10038579 3300009174 Unclassified 3601
173 Ga0105242_10015325 3300009176 Bacteria 5952
174 Ga0105242_10128452 3300009176 Unclassified 2184
175 Ga0105242_10282829 3300009176 Bacteria 1507
176 Ga0105248_10016933 3300009177 Bacteria 8024
177 Ga0105248_10017287 3300009177 Bacteria 7946
178 Ga0105248_10026956 3300009177 Bacteria 6390
179 Ga0105248_10082467 3300009177 Unclassified 3616
180 Ga0105237_10005683 3300009545 Bacteria 14033
181 Ga0105238_10000684 3300009551 Bacteria 35548
182 Ga0105238_10000871 3300009551 Bacteria 31154
183 Ga0105238_10003498 3300009551 Bacteria 15635
184 Ga0105238_10064848 3300009551 Unclassified 3652
185 Ga0105238_10264070 3300009551 Bacteria 1701
186 Ga0105249_10075045 3300009553 Bacteria 3131
187 Ga0105239_10001988 3300010375 Bacteria 26584
188 Ga0105239_10011097 3300010375 Bacteria 10054
189 Ga0105246_10152864 3300011119 Bacteria 1749
190 Ga0157370_10005967 3300013104 Bacteria 13556
191 Ga0157370_10448061 3300013104 Bacteria 1187
192 Ga0157369_10004420 3300013105 Bacteria 16593
193 Ga0157374_10097286 3300013296 Bacteria 2816
194 Ga0157374_10367255 3300013296 Bacteria 1432
195 Ga0157378_10003201 3300013297 Bacteria 14542
196 Ga0157378_10083896 3300013297 Archaea 2884
197 Ga0157378_10097405 3300013297 Bacteria 2681
198 Ga0163162_10004015 3300013306 Bacteria 14117
199 Ga0163162_10010384 3300013306 Bacteria 9049
200 Ga0157372_10001097 3300013307 Bacteria 29436
201 Ga0157372_10016851 3300013307 Bacteria 7844
202 Ga0157375_10001575 3300013308 Bacteria 19643
203 Ga0157375_10026856 3300013308 Bacteria 5373
204 Ga0157375_10256129 3300013308 Bacteria 1911
205 Ga0163163_10001890 3300014325 Bacteria 17718
206 Ga0163163_10003013 3300014325 Bacteria 14261
207 Ga0163163_10005595 3300014325 Bacteria 10886
208 Ga0163163_10027082 3300014325 Bacteria 5485
209 Ga0163163_10043315 3300014325 Bacteria 4413
210 Ga0163163_10048984 3300014325 Bacteria 4157
211 Ga0157377_10017360 3300014745 Bacteria 3720
212 Ga0157377_10045091 3300014745 Bacteria 2462
213 Ga0157377_10046762 3300014745 Bacteria 2422
214 Ga0157376_10009820 3300014969 Bacteria 6976
215 Ga0157376_10061066 3300014969 Bacteria 3167
216 Ga0157376_10154955 3300014969 Bacteria 2070
217 Ga0157376_10279799 3300014969 Bacteria 1571
218 Ga0207642_10069352 3300025899 Bacteria 1672
219 Ga0207688_10093964 3300025901 Bacteria 1725
220 Ga0207680_10002734 3300025903 Bacteria 8248
221 Ga0207680_10025115 3300025903 Bacteria 3282
222 Ga0207699_10064521 3300025906 Unclassified 2216
223 Ga0207699_10096781 3300025906 Unclassified 1864
224 Ga0207643_10002965 3300025908 Bacteria 9157
225 Ga0207654_10001338 3300025911 Bacteria 13076
226 Ga0207654_10037160 3300025911 Bacteria 2724
227 Ga0207707_10000492 3300025912 Bacteria 40859
228 Ga0207707_10008153 3300025912 Bacteria 9089
229 Ga0207695_10000688 3300025913 Bacteria 66300
230 Ga0207695_10191125 3300025913 Unclassified 1965
231 Ga0207695_10214653 3300025913 Bacteria 1833
232 Ga0207671_10007664 3300025914 Bacteria 9325
233 Ga0207660_10195889 3300025917 Bacteria 1576
234 Ga0207662_10009388 3300025918 Bacteria 5379
235 Ga0207662_10045896 3300025918 Bacteria 2583
236 Ga0207657_10025254 3300025919 Bacteria 5482
237 Ga0207649_10039304 3300025920 Bacteria 2868
238 Ga0207649_10210463 3300025920 Bacteria 1379
239 Ga0207652_10001350 3300025921 Bacteria 21799
240 Ga0207646_10003029 3300025922 Bacteria 19351
241 Ga0207681_10000382 3300025923 Bacteria 31063
242 Ga0207694_10002029 3300025924 Bacteria 16764
243 Ga0207694_10005291 3300025924 Bacteria 9945
244 Ga0207694_10064161 3300025924 Bacteria 2862
245 Ga0207694_10295282 3300025924 Archaea 1333
246 Ga0207659_10000105 3300025926 Bacteria 50176
247 Ga0207659_10437695 3300025926 Bacteria 1099
248 Ga0207700_10002386 3300025928 Bacteria 10805
249 Ga0207700_10023999 3300025928 Bacteria 4216
250 Ga0207664_10001971 3300025929 Bacteria 13513
251 Ga0207644_10019407 3300025931 Unclassified 4612
252 Ga0207706_10087873 3300025933 Unclassified 2733
253 Ga0207686_10002906 3300025934 Bacteria 9238
254 Ga0207686_10013082 3300025934 Bacteria 4582
255 Ga0207686_10020153 3300025934 Unclassified 3805
256 Ga0207686_10024803 3300025934 Unclassified 3480
257 Ga0207686_10054448 3300025934 Unclassified 2506
258 Ga0207670_10204093 3300025936 Bacteria 1503
259 Ga0207704_10024072 3300025938 Bacteria 3294
260 Ga0207704_10275184 3300025938 Bacteria 1277
261 Ga0207704_10359104 3300025938 Bacteria 1137
262 Ga0207691_10011609 3300025940 Bacteria 8455
263 Ga0207691_10021318 3300025940 Bacteria 6119
264 Ga0207691_10071300 3300025940 Bacteria 3136
265 Ga0207711_10007281 3300025941 Bacteria 9270
266 Ga0207711_10078544 3300025941 Bacteria 2879
267 Ga0207711_10162638 3300025941 Archaea 2022
268 Ga0207689_10025897 3300025942 Bacteria 4912
269 Ga0207689_10107356 3300025942 Bacteria 2294
270 Ga0207661_10031947 3300025944 Bacteria 4073
271 Ga0207661_10102407 3300025944 Bacteria 2407
272 Ga0207679_10038860 3300025945 Bacteria 3395
273 Ga0207667_10000671 3300025949 Bacteria 44329
274 Ga0207667_10046001 3300025949 Bacteria 4621
275 Ga0207651_10009142 3300025960 Bacteria 5399
276 Ga0207651_10032486 3300025960 Bacteria 3353
277 Ga0207651_10218133 3300025960 Unclassified 1540
278 Ga0207712_10071584 3300025961 Bacteria 2494
279 Ga0207640_10016899 3300025981 Unclassified 4256
280 Ga0207658_10005177 3300025986 Bacteria 8977
281 Ga0207658_10011105 3300025986 Bacteria 6134
282 Ga0207658_10214377 3300025986 Bacteria 1616
283 Ga0207677_10032018 3300026023 Bacteria 3375
284 Ga0207703_10049626 3300026035 Bacteria 3393
285 Ga0207703_10078830 3300026035 Bacteria 2738
286 Ga0207703_10094752 3300026035 Bacteria 2518
287 Ga0207703_10190912 3300026035 Bacteria 1814
288 Ga0207703_10307253 3300026035 Bacteria 1448
289 Ga0207708_10109735 3300026075 Unclassified 2141
290 Ga0207702_10009956 3300026078 Bacteria 7971
291 Ga0207702_10109809 3300026078 Bacteria 2450
292 Ga0207641_10052645 3300026088 Bacteria 3448
293 Ga0207648_10009076 3300026089 Bacteria 9565
294 Ga0207648_10113524 3300026089 Bacteria 2379
295 Ga0207676_10005144 3300026095 Bacteria 9260
296 Ga0207676_10077739 3300026095 Bacteria 2685
297 Ga0207676_10119353 3300026095 Bacteria 2221
298 Ga0207674_10000101 3300026116 Bacteria 97551
299 Ga0207674_10001735 3300026116 Bacteria 27852
300 Ga0207674_10011912 3300026116 Bacteria 9749
301 Ga0207674_10015459 3300026116 Bacteria 8385
302 Ga0207674_10061166 3300026116 Bacteria 3806
303 Ga0207675_100002997 3300026118 Bacteria 16581
304 Ga0207675_100157510 3300026118 Unclassified 2164
305 Ga0207683_10143515 3300026121 Bacteria 2152
306 Ga0207698_10243121 3300026142 Unclassified 1642
307 Ga0207428_10002002 3300027907 Bacteria 20654
308 Ga0207428_10008925 3300027907 Bacteria 9030
309 Ga0268265_10000499 3300028380 Bacteria 40655
310 Ga0268264_10021988 3300028381 Bacteria 5205
311 Ga0268264_10048313 3300028381 Bacteria 3540
312 Ga0268264_10053878 3300028381 Bacteria 3357
313 Ga0268264_10131551 3300028381 Bacteria 2219
314 Ga0268264_10134299 3300028381 Bacteria 2198
315 Ga0265314_10004692 3300031711 Bacteria 12550
316 Ga0307416_100124484 3300032002 Bacteria 2306
317 Ga0373934_0019036 3300035086 Bacteria 2632
318 Ga0373923_0070206 3300035111 Unclassified 1503
319 Ga0373953_0032352 3300035117 Unclassified 2040
320 Ga0373954_0012505 3300035118 Unclassified 3774
321 Ga0373954_0126223 3300035118 Bacteria 1244
322 Ga0373961_0035361 3300035241 Bacteria 1417
323 Ga0373931_0116999 3300035691 Bacteria 1519
324 Ga0373935_0218776 3300035692 Unclassified 1322
325 Ga0373933_0055408 3300035724 Bacteria 2378
326 Ga0373933_0143669 3300035724 Unclassified 1508
327 Ga0373947_0021619 3300035725 Bacteria 3725
328 Ga0373937_0004222 3300036401 Bacteria 12184
329 Ga0373937_0043896 3300036401 Bacteria 4083
330 Ga0373937_0056365 3300036401 Bacteria 3609
331 Ga0373937_0082073 3300036401 Unclassified 2982
332 Ga0373937_0113888 3300036401 Bacteria 2517
333 Ga0373925_0024669 3300037068 Bacteria 4391
334 Ga0436364_0276730 3300037853 Bacteria 2114
335 Ga0436365_0567352 3300039437 Bacteria 1472
336 Ga0436365_1084179 3300039437 Bacteria 1011
337 Ga0436362_0060466 3300039453 Unclassified 1434
338 Ga0451576_0099127 3300045051 Bacteria 3031
339 Ga0495592_0038719 3300046454 Bacteria 3585
340 Ga0495592_0088602 3300046454 Unclassified 2224
341 Ga0495580_0002468 3300046472 Bacteria 16147
342 Ga0495618_0011676 3300046514 Bacteria 5330
343 Ga0495628_0189580 3300046516 Unclassified 1553
344 Ga0495665_0082066 3300046531 Bacteria 1695
345 Ga0495587_0020913 3300046536 Bacteria 4037
346 Ga0495609_0062790 3300046538 Unclassified 1640
347 Ga0495621_0007714 3300046539 Bacteria 3195
348 Ga0495645_0146422 3300046543 Unclassified 1645
349 Ga0495667_0128596 3300046559 Bacteria 1634
350 Ga0495659_0007022 3300046664 Unclassified 3566
351 Ga0495659_0013378 3300046664 Bacteria 2673
352 Ga0495657_0041397 3300046675 Bacteria 3152
353 Ga0495623_0015092 3300046679 Bacteria 4995
354 Ga0495658_0035763 3300046683 Bacteria 2736
355 Ga0495669_0237682 3300046684 Bacteria 874
356 Ga0495613_0017163 3300046689 Bacteria 5390
357 Ga0495613_0255685 3300046689 Bacteria 1221
358 Ga0495636_0013918 3300047318 Bacteria 3196
359 Ga0495677_0053514 3300047445 Bacteria 1488
360 Ga0495677_0117703 3300047445 Bacteria 1012
361 Ga0495684_0014107 3300047471 Bacteria 6146
362 Ga0495684_0023345 3300047471 Bacteria 4755
363 Ga0495602_0000464 3300048088 Bacteria 37661
364 Ga0495602_0178892 3300048088 Unclassified 1638
365 Ga0496104_0252672 3300048907 Bacteria 1676
366 Ga0496110_0557843 3300048913 Unclassified 1041
367 Ga0501283_002155 3300049779 Bacteria 2555
368 nmdc:mga05p37_115463_c1 3300050507 Bacteria 3300
369 nmdc:mga05p37_13030_c1 3300050507 Bacteria 9950
370 nmdc:mga05p37_151410_c1 3300050507 Bacteria 2837
371 nmdc:mga05p37_59729_c1 3300050507 Bacteria 4695
372 nmdc:mga05p37_6058_c1 3300050507 Bacteria 14237
373 nmdc:mga05p37_8209_c1 3300050507 Bacteria 12347
374 nmdc:mga09592_131189_c1 3300050508 Bacteria 2156
375 nmdc:mga09592_49724_c1 3300050508 Bacteria 3535
376 nmdc:mga09592_56335_c1 3300050508 Bacteria 3322
377 nmdc:mga06r32_38594_c1 3300050510 Unclassified 4526
378 nmdc:mga08y16_197139_c1 3300050511 Bacteria 2087
379 nmdc:mga08y16_240223_c1 3300050511 Bacteria 1872
380 nmdc:mga08y16_29367_c1 3300050511 Bacteria 5794
381 nmdc:mga08y16_4123_c1 3300050511 Bacteria 15163
382 nmdc:mga08y16_550745_c1 3300050511 Unclassified 1167
383 nmdc:mga08y16_69354_c1 3300050511 Bacteria 3675
384 nmdc:mga0n895_107836_c1 3300050512 Bacteria 2799
385 nmdc:mga0n895_573536_c1 3300050512 Unclassified 1133
386 nmdc:mga0a205_40264_c1 3300050515 Bacteria 4498
387 nmdc:mga0a205_58980_c1 3300050515 Bacteria 3708
388 Ga0495601_0204177 3300053077 Unclassified 1291
389 Ga0070707_100003298
390 SwRhRL2b_contig_1210459
391 Ga0065704_10084371
392 Ga0065715_10090249
393 Ga0070658_10028444
394 Ga0070690_100003873
395 Ga0070690_100134967
396 Ga0070690_100192675
397 Ga0070670_100065158
398 Ga0068869_100022965
399 Ga0068869_100092031
400 Ga0068869_100337870
401 Ga0070666_10000980
402 Ga0070666_10009159
403 Ga0070680_100104769
404 Ga0070682_100378005
405 Ga0068868_100009429
406 Ga0068868_100039202
407 Ga0070660_100012604
408 Ga0070689_100239471
409 Ga0070687_100020515
410 Ga0070687_100041103
411 Ga0070661_100005214
412 Ga0070669_100000694
413 Ga0070675_100052539
414 Ga0070671_100027700
415 Ga0070671_100062379
416 Ga0070671_100274081
417 Ga0070674_100453976
418 Ga0070673_100054194
419 Ga0070673_100227065
420 Ga0070688_100003850
421 Ga0070667_100004342
422 Ga0070667_100005034
423 Ga0070667_100272811
424 Ga0070709_10037954
425 Ga0070709_10042325
426 Ga0070714_100000896
427 Ga0070714_100442350
428 Ga0070713_100001124
429 Ga0070701_10010989
430 Ga0070711_100029091
431 Ga0070705_100001044
432 Ga0070705_100006415
433 Ga0070705_100312593
434 Ga0070700_100044907
435 Ga0070700_100153995
436 Ga0070694_100000621
437 Ga0070694_100003216
438 Ga0070694_100135132
439 Ga0070662_100010902
440 Ga0070681_10323056
441 Ga0068867_100302754
442 Ga0070685_10048494
443 Ga0070707_100285415
444 Ga0070698_100025168
445 Ga0070698_100040239
446 Ga0070698_100133592
447 Ga0070699_100000432
448 Ga0070699_100039707
449 Ga0070679_100316687
450 Ga0070684_100007363
451 Ga0070684_100016807
452 Ga0070684_100112984
453 Ga0070684_100744403
454 Ga0070697_100039613
455 Ga0070672_100011027
456 Ga0070672_100096453
457 Ga0070686_100017697
458 Ga0070686_100026508
459 Ga0070695_100000455
460 Ga0070695_100113711
461 Ga0070696_100005704
462 Ga0070696_100006987
463 Ga0070696_100007974
464 Ga0070696_100190279
465 Ga0070693_100065506
466 Ga0070693_100137850
467 Ga0070704_100000931
468 Ga0070704_100006081
469 Ga0070704_100043015
470 Ga0070704_100051681
471 Ga0070704_100267640
472 Ga0068855_100013416
473 Ga0068855_100020666
474 Ga0070664_100014400
475 Ga0070664_100014582
476 Ga0070664_100115641
477 Ga0070664_100136521
478 Ga0068857_100000508
479 Ga0068857_100004781
480 Ga0068857_100007006
481 Ga0068857_100011949
482 Ga0068857_100115022
483 Ga0068854_100023105
484 Ga0068856_100202606
485 Ga0070702_100024203
486 Ga0070702_100045232
487 Ga0068852_100027544
488 Ga0068859_100013065
489 Ga0068859_100239622
490 Ga0068864_100000613
491 Ga0068864_100015517
492 Ga0068864_100283243
493 Ga0068864_100545367
494 Ga0068861_100001174
495 Ga0068870_10013089
496 Ga0068863_100057817
497 Ga0068858_100007204
498 Ga0068858_100061667
499 Ga0068858_100114646
500 Ga0068858_100122625
501 Ga0068860_100008845
502 Ga0068860_100066707
503 Ga0068860_100195461
504 Ga0068860_100255823
505 Ga0068860_100260727
506 Ga0068862_100001144
507 Ga0070717_10025053
508 Ga0070716_100292139
509 Ga0070712_100047094
510 Ga0097621_100006571
511 Ga0097621_100010241
512 Ga0097621_100011186
513 Ga0097621_100029529
514 Ga0097621_100052970
515 Ga0097621_100208261
516 Ga0097621_100292835
517 Ga0097621_100339596
518 Ga0068871_100004244
519 Ga0068871_100016217
520 Ga0068871_100064515
521 Ga0068871_100113839
522 Ga0068871_100119986
523 Ga0075431_100021538
524 Ga0075433_10041891
525 Ga0075433_10104283
526 Ga0075434_100007344
527 Ga0075434_100093185
528 Ga0075434_100425456
529 Ga0075429_100053144
530 Ga0075429_100187869
531 Ga0075429_100344318
532 Ga0068865_100001355
533 Ga0068865_100099806
534 Ga0068865_100158179
535 Ga0097620_100013065
536 Ga0097620_100239622
537 Ga0075435_100015940
538 Ga0075435_100031058
539 Ga0105240_10501800
540 Ga0111539_10010124
541 Ga0111539_10033913
542 Ga0111539_10086419
543 Ga0111539_10191922
544 Ga0111539_10299394
545 Ga0105245_10002229
546 Ga0105245_10006621
547 Ga0105245_10313958
548 Ga0114129_10001076
549 Ga0114129_10017799
550 Ga0114129_10018129
551 Ga0114129_10020296
552 Ga0114129_10037176
553 Ga0114129_10039501
554 Ga0114129_10045470
555 Ga0114129_10251314
556 Ga0114129_10311074
557 Ga0105241_10000303
558 Ga0105241_10018914
559 Ga0105241_10035599
560 Ga0105241_10038579
561 Ga0105242_10015325
562 Ga0105242_10128452
563 Ga0105242_10282829
564 Ga0105248_10016933
565 Ga0105248_10017287
566 Ga0105248_10026956
567 Ga0105248_10082467
568 Ga0105237_10005683
569 Ga0105238_10000684
570 Ga0105238_10000871
571 Ga0105238_10003498
572 Ga0105238_10064848
573 Ga0105238_10264070
574 Ga0105249_10075045
575 Ga0105239_10001988
576 Ga0105239_10011097
577 Ga0105246_10152864
578 Ga0157370_10005967
579 Ga0157370_10448061
580 Ga0157369_10004420
581 Ga0157374_10097286
582 Ga0157374_10367255
583 Ga0157378_10003201
584 Ga0157378_10083896
585 Ga0157378_10097405
586 Ga0163162_10004015
587 Ga0163162_10010384
588 Ga0157372_10001097
589 Ga0157372_10016851
590 Ga0157375_10001575
591 Ga0157375_10026856
592 Ga0157375_10256129
593 Ga0163163_10001890
594 Ga0163163_10003013
595 Ga0163163_10005595
596 Ga0163163_10027082
597 Ga0163163_10043315
598 Ga0163163_10048984
599 Ga0157377_10017360
600 Ga0157377_10045091
601 Ga0157377_10046762
602 Ga0157376_10009820
603 Ga0157376_10061066
604 Ga0157376_10154955
605 Ga0157376_10279799
606 Ga0207642_10069352
607 Ga0207688_10093964
608 Ga0207680_10002734
609 Ga0207680_10025115
610 Ga0207699_10064521
611 Ga0207699_10096781
612 Ga0207643_10002965
613 Ga0207654_10001338
614 Ga0207654_10037160
615 Ga0207707_10000492
616 Ga0207707_10008153
617 Ga0207695_10000688
618 Ga0207695_10191125
619 Ga0207695_10214653
620 Ga0207671_10007664
621 Ga0207660_10195889
622 Ga0207662_10009388
623 Ga0207662_10045896
624 Ga0207657_10025254
625 Ga0207649_10039304
626 Ga0207649_10210463
627 Ga0207652_10001350
628 Ga0207646_10003029
629 Ga0207681_10000382
630 Ga0207694_10002029
631 Ga0207694_10005291
632 Ga0207694_10064161
633 Ga0207694_10295282
634 Ga0207659_10000105
635 Ga0207659_10437695
636 Ga0207700_10002386
637 Ga0207700_10023999
638 Ga0207664_10001971
639 Ga0207644_10019407
640 Ga0207706_10087873
641 Ga0207686_10002906
642 Ga0207686_10013082
643 Ga0207686_10020153
644 Ga0207686_10024803
645 Ga0207686_10054448
646 Ga0207670_10204093
647 Ga0207704_10024072
648 Ga0207704_10275184
649 Ga0207704_10359104
650 Ga0207691_10011609
651 Ga0207691_10021318
652 Ga0207691_10071300
653 Ga0207711_10007281
654 Ga0207711_10078544
655 Ga0207711_10162638
656 Ga0207689_10025897
657 Ga0207689_10107356
658 Ga0207661_10031947
659 Ga0207661_10102407
660 Ga0207679_10038860
661 Ga0207667_10000671
662 Ga0207667_10046001
663 Ga0207651_10009142
664 Ga0207651_10032486
665 Ga0207651_10218133
666 Ga0207712_10071584
667 Ga0207640_10016899
668 Ga0207658_10005177
669 Ga0207658_10011105
670 Ga0207658_10214377
671 Ga0207677_10032018
672 Ga0207703_10049626
673 Ga0207703_10078830
674 Ga0207703_10094752
675 Ga0207703_10190912
676 Ga0207703_10307253
677 Ga0207708_10109735
678 Ga0207702_10009956
679 Ga0207702_10109809
680 Ga0207641_10052645
681 Ga0207648_10009076
682 Ga0207648_10113524
683 Ga0207676_10005144
684 Ga0207676_10077739
685 Ga0207676_10119353
686 Ga0207674_10000101
687 Ga0207674_10001735
688 Ga0207674_10011912
689 Ga0207674_10015459
690 Ga0207674_10061166
691 Ga0207675_100002997
692 Ga0207675_100157510
693 Ga0207683_10143515
694 Ga0207698_10243121
695 Ga0207428_10002002
696 Ga0207428_10008925
697 Ga0268265_10000499
698 Ga0268264_10021988
699 Ga0268264_10048313
700 Ga0268264_10053878
701 Ga0268264_10131551
702 Ga0268264_10134299
703 Ga0265314_10004692
704 Ga0307416_100124484
705 Ga0373934_0019036
706 Ga0373923_0070206
707 Ga0373953_0032352
708 Ga0373954_0012505
709 Ga0373954_0126223
710 Ga0373961_0035361
711 Ga0373931_0116999
712 Ga0373935_0218776
713 Ga0373933_0055408
714 Ga0373933_0143669
715 Ga0373947_0021619
716 Ga0373937_0004222
717 Ga0373937_0043896
718 Ga0373937_0056365
719 Ga0373937_0082073
720 Ga0373937_0113888
721 Ga0373925_0024669
722 Ga0436364_0276730
723 Ga0436365_0567352
724 Ga0436365_1084179
725 Ga0436362_0060466
726 Ga0451576_0099127
727 Ga0495592_0038719
728 Ga0495592_0088602
729 Ga0495580_0002468
730 Ga0495618_0011676
731 Ga0495628_0189580
732 Ga0495665_0082066
733 Ga0495587_0020913
734 Ga0495609_0062790
735 Ga0495621_0007714
736 Ga0495645_0146422
737 Ga0495667_0128596
738 Ga0495659_0007022
739 Ga0495659_0013378
740 Ga0495657_0041397
741 Ga0495623_0015092
742 Ga0495658_0035763
743 Ga0495669_0237682
744 Ga0495613_0017163
745 Ga0495613_0255685
746 Ga0495636_0013918
747 Ga0495677_0053514
748 Ga0495677_0117703
749 Ga0495684_0014107
750 Ga0495684_0023345
751 Ga0495602_0000464
752 Ga0495602_0178892
753 Ga0496104_0252672
754 Ga0496110_0557843
755 Ga0501283_002155
756 nmdc:mga05p37_115463_c1
757 nmdc:mga05p37_13030_c1
758 nmdc:mga05p37_151410_c1
759 nmdc:mga05p37_59729_c1
760 nmdc:mga05p37_6058_c1
761 nmdc:mga05p37_8209_c1
762 nmdc:mga09592_131189_c1
763 nmdc:mga09592_49724_c1
764 nmdc:mga09592_56335_c1
765 nmdc:mga06r32_38594_c1
766 nmdc:mga08y16_197139_c1
767 nmdc:mga08y16_240223_c1
768 nmdc:mga08y16_29367_c1
769 nmdc:mga08y16_4123_c1
770 nmdc:mga08y16_550745_c1
771 nmdc:mga08y16_69354_c1
772 nmdc:mga0n895_107836_c1
773 nmdc:mga0n895_573536_c1
774 nmdc:mga0a205_40264_c1
775 nmdc:mga0a205_58980_c1
776 Ga0495601_0204177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03929

PepSY_TM

PepSY-associated TM region

47

329

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7abw-assembly2.cif.gz_B crystal structure of siderophore reductase foxb 0.4031 15 238
7abw-assembly2.cif.gz_B crystal structure of siderophore reductase foxb 0.3693 15 238
5njd-assembly5.cif.gz_J structure of interleukin 23 in complex with briakinumab fab 0.3451 124 223
5njd-assembly6.cif.gz_L structure of interleukin 23 in complex with briakinumab fab 0.3407 124 223
2iub-assembly2.cif.gz_H crystal structure of a divalent metal ion transporter cora at 2.9 a resolution. 0.3347 81 254
ID Description Score Start End Superfamily
af_P0AC44_1_115_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5035 69 182 1.20.1300.10
af_P0AC44_1_115_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.4471 69 182 1.20.1300.10
af_A0A0P0WF83_318_523_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4387 73 183 1.25.10.10
af_A0A0R0G921_199_314_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.392 77 217 1.20.140.150
af_A0A0R0G921_199_314_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3811 77 217 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V8HXQ8-F1-model_v4 Cytochrome b/b6 domain-containing protein 0.6531 3 248 GO:0016020
AF-A0A2E3YQ37-F1-model_v4 PepSY domain-containing protein 0.6394 2 231 GO:0016020
AF-A0A2V8EHN5-F1-model_v4 PepSY domain-containing protein 0.6347 2 239 GO:0016020
AF-A0A2V8HXQ8-F1-model_v4 Cytochrome b/b6 domain-containing protein 0.6304 3 248 GO:0016020
AF-A0A7X4EU15-F1-model_v4 PepSY domain-containing protein 0.6258 4 238 GO:0016020

Map