F430864

General Info

Members Datasets Scaffolds Average Seq Length
387 204 381 211

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10474344|Ga0307513_104743441
Length 233
Sequence MGAAQHAFSLAVVPAGRMASEMFRRQVRWFAALWCGCAVSWSAVAAPDFVGERASDDVRYAASWVLDGADNQGKPFVIVDKRNARVYVFDAAGRLAGASAALLGLAPGDDAIPDIARRAPSSLRPAERTTPAGRFDSQPGHNDKGEDIVWVDYDASLAIHRLRPAPLAERRPERLASALVDDKRISFGCIIVPVAFYEGIVSATLGRQHGVVYVLPEVRAANELFGDMRLGSR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
4 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
5 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
6 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
191 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
192 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
193 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
194 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
195 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
196 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
200 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 1.55
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.32
Nodule 0
Rhizoplane 0.78
Rhizosphere 63.82
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1017167 3300002774 Bacteria 1173
2 JGI25153J46596_10001431 3300003215 Bacteria 14278
3 rootH1_10012335 3300003316 Bacteria 3316
4 rootL2_10005479 3300003322 Bacteria 4204
5 rootH1_10081759 3300003323 Bacteria 3799
6 Ga0055526_1031030 3300003771 Bacteria 1543
7 Ga0065165_1001629 3300005262 Bacteria 22844
8 Ga0070676_10010733 3300005328 Bacteria 4971
9 Ga0070690_100015924 3300005330 Bacteria 4493
10 Ga0070670_100015970 3300005331 Bacteria 6442
11 Ga0070670_100097840 3300005331 Bacteria 2525
12 Ga0070670_100136123 3300005331 Unclassified 2123
13 Ga0070670_100160871 3300005331 Bacteria 1946
14 Ga0070677_10167880 3300005333 Unclassified 1035
15 Ga0068869_100001957 3300005334 Bacteria 12337
16 Ga0068869_100041765 3300005334 Bacteria 3285
17 Ga0068869_100347394 3300005334 Bacteria 1208
18 Ga0068868_100029651 3300005338 Bacteria 4191
19 Ga0068868_100035763 3300005338 Bacteria 3841
20 Ga0068868_100054992 3300005338 Bacteria 3139
21 Ga0068868_100293201 3300005338 Bacteria 1380
22 Ga0070660_100158790 3300005339 Bacteria 1821
23 Ga0070661_100077627 3300005344 Bacteria 2449
24 Ga0070668_100027356 3300005347 Bacteria 4330
25 Ga0070668_100340943 3300005347 Bacteria 1266
26 Ga0070669_100009364 3300005353 Bacteria 6977
27 Ga0070669_100248083 3300005353 Bacteria 1417
28 Ga0070675_100022210 3300005354 Bacteria 5068
29 Ga0070675_100141081 3300005354 Bacteria 2060
30 Ga0070675_100778303 3300005354 Bacteria 874
31 Ga0070674_100058227 3300005356 Bacteria 2685
32 Ga0070674_100099697 3300005356 Bacteria 2114
33 Ga0070674_100184472 3300005356 Bacteria 1600
34 Ga0070673_100018156 3300005364 Bacteria 5021
35 Ga0070673_100033551 3300005364 Bacteria 3878
36 Ga0070673_100056225 3300005364 Bacteria 3104
37 Ga0070673_100933320 3300005364 Bacteria 806
38 Ga0070688_100150067 3300005365 Bacteria 1592
39 Ga0070659_100373418 3300005366 Bacteria 1200
40 Ga0070659_100517776 3300005366 Bacteria 1018
41 Ga0070659_100610603 3300005366 Bacteria 938
42 Ga0070667_100000975 3300005367 Bacteria 26309
43 Ga0070667_100040558 3300005367 Bacteria 3904
44 Ga0070667_100108284 3300005367 Bacteria 2407
45 Ga0070667_100446450 3300005367 Bacteria 1181
46 Ga0070663_100178894 3300005455 Bacteria 1644
47 Ga0070663_100366218 3300005455 Bacteria 1170
48 Ga0070663_100649913 3300005455 Bacteria 892
49 Ga0070678_100011861 3300005456 Bacteria 5392
50 Ga0070662_100002116 3300005457 Bacteria 12176
51 Ga0070662_100037830 3300005457 Bacteria 3424
52 Ga0070662_100260432 3300005457 Bacteria 1397
53 Ga0068867_100001098 3300005459 Bacteria 18476
54 Ga0070706_100001239 3300005467 Bacteria 27289
55 Ga0070707_100048557 3300005468 Bacteria 4065
56 Ga0070672_100098323 3300005543 Bacteria 2370
57 Ga0070672_100339774 3300005543 Bacteria 1278
58 Ga0070686_100101891 3300005544 Bacteria 1941
59 Ga0070665_100003420 3300005548 Bacteria 16958
60 Ga0070665_100053787 3300005548 Bacteria 4038
61 Ga0070665_100330707 3300005548 Unclassified 1528
62 Ga0070665_100610147 3300005548 Bacteria 1104
63 Ga0070664_100098699 3300005564 Bacteria 2537
64 Ga0068857_100014101 3300005577 Bacteria 6958
65 Ga0068852_100023231 3300005616 Bacteria 4988
66 Ga0068852_100208214 3300005616 Bacteria 1854
67 Ga0068859_100112508 3300005617 Bacteria 2786
68 Ga0068859_100510693 3300005617 Bacteria 1297
69 Ga0068859_100658558 3300005617 Bacteria 1139
70 Ga0068864_100004564 3300005618 Bacteria 11370
71 Ga0068864_100159176 3300005618 Bacteria 2052
72 Ga0068861_100002467 3300005719 Bacteria 12062
73 Ga0068861_100006700 3300005719 Bacteria 7871
74 Ga0068851_10075983 3300005834 Bacteria 1746
75 Ga0068863_100007420 3300005841 Bacteria 10731
76 Ga0068863_100016507 3300005841 Bacteria 7082
77 Ga0068863_100154294 3300005841 Bacteria 2198
78 Ga0068858_100027193 3300005842 Bacteria 5315
79 Ga0068858_100041134 3300005842 Bacteria 4287
80 Ga0068860_100003409 3300005843 Bacteria 16341
81 Ga0068860_100187395 3300005843 Unclassified 2001
82 Ga0068860_100468558 3300005843 Bacteria 1254
83 Ga0068860_100580866 3300005843 Bacteria 1125
84 Ga0068862_100008823 3300005844 Bacteria 8348
85 Ga0068862_100076088 3300005844 Bacteria 2904
86 Ga0068862_100188539 3300005844 Bacteria 1854
87 Ga0075365_10021077 3300006038 Bacteria 4058
88 Ga0075368_10001719 3300006042 Bacteria 7048
89 Ga0075368_10004738 3300006042 Bacteria 4629
90 Ga0075368_10045396 3300006042 Bacteria 1736
91 Ga0075363_100029491 3300006048 Bacteria 2833
92 Ga0075363_100111411 3300006048 Bacteria 1522
93 Ga0075363_100117738 3300006048 Bacteria 1481
94 Ga0075362_10000656 3300006177 Bacteria 10183
95 Ga0075362_10001320 3300006177 Bacteria 7855
96 Ga0075362_10049645 3300006177 Bacteria 1875
97 Ga0075367_10000315 3300006178 Bacteria 17086
98 Ga0075367_10022706 3300006178 Bacteria 3522
99 Ga0075367_10159939 3300006178 Bacteria 1400
100 Ga0075366_10000111 3300006195 Bacteria 33316
101 Ga0075366_10000773 3300006195 Bacteria 15241
102 Ga0075366_10001511 3300006195 Bacteria 11607
103 Ga0075366_10002824 3300006195 Bacteria 8993
104 Ga0075366_10021313 3300006195 Bacteria 3767
105 Ga0075366_10042656 3300006195 Bacteria 2686
106 Ga0075366_10049917 3300006195 Bacteria 2483
107 Ga0075366_10091861 3300006195 Bacteria 1818
108 Ga0075366_10128021 3300006195 Bacteria 1532
109 Ga0097621_100149062 3300006237 Bacteria 2005
110 Ga0075370_10000184 3300006353 Bacteria 21841
111 Ga0075370_10009871 3300006353 Bacteria 4974
112 Ga0075370_10030535 3300006353 Bacteria 3007
113 Ga0075370_10066384 3300006353 Unclassified 2058
114 Ga0075370_10088269 3300006353 Bacteria 1788
115 Ga0075434_101257100 3300006871 Bacteria 752
116 Ga0068865_100028238 3300006881 Bacteria 3713
117 Ga0068865_100066018 3300006881 Bacteria 2552
118 Ga0097620_100112509 3300006931 Bacteria 2786
119 Ga0097620_100510722 3300006931 Bacteria 1297
120 Ga0097620_100658585 3300006931 Bacteria 1139
121 Ga0105240_10034526 3300009093 Bacteria 6522
122 Ga0105245_10009748 3300009098 Bacteria 8370
123 Ga0114129_10545519 3300009147 Bacteria 1508
124 Ga0105243_10007766 3300009148 Bacteria 8249
125 Ga0105243_10025107 3300009148 Bacteria 4551
126 Ga0105243_10122713 3300009148 Bacteria 2193
127 Ga0105241_10509379 3300009174 Bacteria 1074
128 Ga0105248_10081229 3300009177 Bacteria 3644
129 Ga0105248_10437668 3300009177 Bacteria 1473
130 Ga0105248_10882628 3300009177 Bacteria 1010
131 Ga0105237_10008024 3300009545 Bacteria 11487
132 Ga0105237_10448976 3300009545 Bacteria 1295
133 Ga0105249_10034727 3300009553 Bacteria 4570
134 Ga0105249_10037530 3300009553 Bacteria 4397
135 Ga0105249_11104718 3300009553 Archaea 863
136 Ga0105239_10131485 3300010375 Bacteria 2784
137 Ga0105246_10709385 3300011119 Unclassified 883
138 Ga0157374_10186835 3300013296 Unclassified 2026
139 Ga0157378_10002645 3300013297 Bacteria 15968
140 Ga0163162_10003350 3300013306 Bacteria 15323
141 Ga0163162_10061809 3300013306 Bacteria 3784
142 Ga0163162_10205621 3300013306 Bacteria 2098
143 Ga0157375_10145351 3300013308 Bacteria 2502
144 Ga0157375_10339690 3300013308 Bacteria 1667
145 Ga0163163_10024190 3300014325 Bacteria 5778
146 Ga0163163_10728465 3300014325 Bacteria 1055
147 Ga0157380_10019441 3300014326 Bacteria 5062
148 Ga0157380_10034131 3300014326 Bacteria 3923
149 Ga0157380_10197898 3300014326 Bacteria 1780
150 Ga0157379_10012359 3300014968 Bacteria 7459
151 Ga0157379_10067166 3300014968 Bacteria 3206
152 Ga0157379_10561634 3300014968 Bacteria 1063
153 Ga0157376_10190324 3300014969 Bacteria 1881
154 Ga0157376_10227364 3300014969 Bacteria 1731
155 Ga0157376_10713733 3300014969 Bacteria 1009
156 Ga0163161_10041989 3300017792 Bacteria 3288
157 Ga0163161_10124648 3300017792 Bacteria 1938
158 Ga0163161_10384102 3300017792 Bacteria 1123
159 Ga0207425_1000546 3300025245 Bacteria 22428
160 Ga0209129_1000041 3300025258 Bacteria 307590
161 Ga0209673_1025682 3300025273 Bacteria 1953
162 Ga0209564_1000029 3300025295 Bacteria 505995
163 Ga0209758_1000043 3300025297 Bacteria 402310
164 Ga0209050_1000672 3300025298 Bacteria 51771
165 Ga0209256_1013841 3300025299 Bacteria 2962
166 Ga0209051_1057622 3300025303 Bacteria 1244
167 Ga0209257_1020113 3300025304 Bacteria 2482
168 Ga0207656_10086471 3300025321 Bacteria 1417
169 Ga0207680_10033882 3300025903 Bacteria 2917
170 Ga0207643_10078196 3300025908 Bacteria 1913
171 Ga0207684_10010775 3300025910 Bacteria 8024
172 Ga0207671_10175708 3300025914 Bacteria 1665
173 Ga0207649_10163927 3300025920 Bacteria 1542
174 Ga0207681_10006462 3300025923 Bacteria 7198
175 Ga0207681_10088193 3300025923 Bacteria 2209
176 Ga0207650_10069901 3300025925 Bacteria 2638
177 Ga0207650_10301084 3300025925 Unclassified 1309
178 Ga0207650_10350247 3300025925 Bacteria 1215
179 Ga0207644_10069436 3300025931 Bacteria 2573
180 Ga0207690_10936050 3300025932 Bacteria 719
181 Ga0207706_10013122 3300025933 Bacteria 7537
182 Ga0207706_10085235 3300025933 Bacteria 2778
183 Ga0207706_10296294 3300025933 Bacteria 1410
184 Ga0207709_10028425 3300025935 Bacteria 3233
185 Ga0207669_10077008 3300025937 Bacteria 2119
186 Ga0207669_10725523 3300025937 Bacteria 819
187 Ga0207704_10032046 3300025938 Bacteria 2969
188 Ga0207704_10052238 3300025938 Bacteria 2477
189 Ga0207691_10015905 3300025940 Bacteria 7147
190 Ga0207691_10026107 3300025940 Bacteria 5482
191 Ga0207691_10079532 3300025940 Bacteria 2950
192 Ga0207691_10198414 3300025940 Bacteria 1747
193 Ga0207711_10149375 3300025941 Bacteria 2107
194 Ga0207711_10576209 3300025941 Bacteria 1050
195 Ga0207689_10002506 3300025942 Bacteria 17061
196 Ga0207689_10071794 3300025942 Bacteria 2843
197 Ga0207689_10170461 3300025942 Bacteria 1794
198 Ga0207679_10043140 3300025945 Bacteria 3246
199 Ga0207651_10080858 3300025960 Bacteria 2341
200 Ga0207712_10019143 3300025961 Bacteria 4467
201 Ga0207712_10032695 3300025961 Bacteria 3512
202 Ga0207668_10023581 3300025972 Bacteria 3958
203 Ga0207668_10208825 3300025972 Bacteria 1560
204 Ga0207640_10034459 3300025981 Bacteria 3160
205 Ga0207640_10343654 3300025981 Bacteria 1196
206 Ga0207658_10002242 3300025986 Bacteria 14325
207 Ga0207658_10088282 3300025986 Bacteria 2397
208 Ga0207658_10266344 3300025986 Bacteria 1462
209 Ga0207658_10536314 3300025986 Unclassified 1046
210 Ga0207677_10091145 3300026023 Bacteria 2217
211 Ga0207677_10333249 3300026023 Bacteria 1265
212 Ga0207677_10517531 3300026023 Bacteria 1034
213 Ga0207703_10065799 3300026035 Bacteria 2980
214 Ga0207703_10281613 3300026035 Bacteria 1510
215 Ga0207678_10020461 3300026067 Bacteria 5803
216 Ga0207678_10214045 3300026067 Bacteria 1649
217 Ga0207641_10009069 3300026088 Bacteria 8216
218 Ga0207641_10400006 3300026088 Bacteria 1318
219 Ga0207648_10000847 3300026089 Bacteria 34532
220 Ga0207648_10111270 3300026089 Bacteria 2404
221 Ga0207648_10218030 3300026089 Bacteria 1695
222 Ga0207648_11058976 3300026089 Bacteria 760
223 Ga0207676_10126954 3300026095 Bacteria 2162
224 Ga0207676_10300493 3300026095 Bacteria 1465
225 Ga0207674_10009979 3300026116 Bacteria 10807
226 Ga0207674_10014053 3300026116 Bacteria 8847
227 Ga0207675_100000247 3300026118 Bacteria 51569
228 Ga0207675_100029363 3300026118 Bacteria 5124
229 Ga0207683_10005596 3300026121 Bacteria 10775
230 Ga0207683_10020427 3300026121 Bacteria 5665
231 Ga0207698_10414194 3300026142 Bacteria 1291
232 Ga0209813_10001853 3300027866 Bacteria 4770
233 Ga0209813_10046114 3300027866 Bacteria 1345
234 Ga0268266_10146452 3300028379 Bacteria 2124
235 Ga0268265_10012889 3300028380 Bacteria 5675
236 Ga0268265_10027135 3300028380 Bacteria 4083
237 Ga0268265_10085792 3300028380 Bacteria 2500
238 Ga0268265_10495309 3300028380 Bacteria 1150
239 Ga0268264_10050290 3300028381 Bacteria 3470
240 Ga0268264_10420398 3300028381 Bacteria 1289
241 Ga0268264_10571900 3300028381 Unclassified 1111
242 Ga0307517_10040214 3300028786 Bacteria 5099
243 Ga0307517_10061688 3300028786 Bacteria 3542
244 Ga0307517_10100575 3300028786 Bacteria 2282
245 Ga0307517_10127295 3300028786 Bacteria 1852
246 Ga0307517_10223881 3300028786 Bacteria 1139
247 Ga0307515_10022943 3300028794 Bacteria 10975
248 Ga0307515_10232552 3300028794 Bacteria 1632
249 Ga0307515_10337647 3300028794 Unclassified 1161
250 Ga0307513_10045089 3300031456 Bacteria 4821
251 Ga0307513_10094467 3300031456 Bacteria 3035
252 Ga0307513_10135189 3300031456 Bacteria 2402
253 Ga0307513_10474344 3300031456 Bacteria 972
254 Ga0307509_10001648 3300031507 Bacteria 37411
255 Ga0307509_10002250 3300031507 Bacteria 31597
256 Ga0307509_10021038 3300031507 Bacteria 7388
257 Ga0307509_10023831 3300031507 Bacteria 6860
258 Ga0307509_10178607 3300031507 Bacteria 1992
259 Ga0307408_100265103 3300031548 Bacteria 1424
260 Ga0307508_10000296 3300031616 Bacteria 60826
261 Ga0307508_10005343 3300031616 Bacteria 12235
262 Ga0307508_10570842 3300031616 Bacteria 730
263 Ga0307514_10082789 3300031649 Bacteria 2368
264 Ga0307514_10195554 3300031649 Bacteria 1280
265 Ga0307516_10065330 3300031730 Bacteria 3514
266 Ga0307516_10099577 3300031730 Bacteria 2723
267 Ga0307516_10237911 3300031730 Unclassified 1521
268 Ga0307412_10222468 3300031911 Bacteria 1448
269 Ga0307507_10027713 3300033179 Bacteria 6062
270 Ga0307507_10190920 3300033179 Bacteria 1440
271 Ga0307510_10000677 3300033180 Bacteria 34775
272 Ga0307510_10009142 3300033180 Bacteria 11796
273 Ga0307510_10018561 3300033180 Bacteria 8181
274 Ga0307510_10075879 3300033180 Bacteria 3310
275 Ga0307510_10266229 3300033180 Bacteria 1192
276 Ga0373944_0012405 3300035089 Bacteria 2348
277 Ga0373946_0225123 3300035171 Unclassified 907
278 Ga0373931_0014288 3300035691 Bacteria 3878
279 Ga0373931_0177257 3300035691 Bacteria 1260
280 Ga0373935_0280620 3300035692 Bacteria 1173
281 Ga0373927_0279719 3300035695 Bacteria 1097
282 Ga0373937_0284808 3300036401 Unclassified 1561
283 Ga0373925_0011256 3300037068 Bacteria 6489
284 Ga0373925_0221155 3300037068 Bacteria 1511
285 Ga0451793_1144917 3300041452 Bacteria 1264
286 Ga0495592_0000202 3300046454 Bacteria 50799
287 Ga0495629_0324225 3300046459 Bacteria 1053
288 Ga0495629_0545872 3300046459 Bacteria 778
289 Ga0495638_0045633 3300046460 Bacteria 2756
290 Ga0495638_0359698 3300046460 Unclassified 766
291 Ga0495650_0137659 3300046471 Bacteria 886
292 Ga0495583_0181548 3300046506 Bacteria 861
293 Ga0495606_0286330 3300046507 Bacteria 899
294 Ga0495610_0013033 3300046512 Bacteria 4964
295 Ga0495620_0090966 3300046515 Bacteria 1224
296 Ga0495632_0011011 3300046519 Bacteria 5302
297 Ga0495632_0039915 3300046519 Bacteria 2366
298 Ga0495648_0127438 3300046524 Bacteria 1358
299 Ga0495598_0025219 3300046537 Bacteria 1620
300 Ga0495597_0018349 3300046542 Bacteria 3283
301 Ga0495597_0061462 3300046542 Bacteria 1636
302 Ga0495622_0036319 3300046557 Bacteria 2298
303 Ga0495625_0032741 3300046660 Bacteria 3851
304 Ga0495625_0189497 3300046660 Bacteria 1363
305 Ga0495658_0024574 3300046683 Bacteria 3211
306 Ga0495658_0027836 3300046683 Bacteria 3045
307 Ga0495658_0215664 3300046683 Bacteria 1200
308 Ga0495649_0013295 3300046694 Bacteria 4753
309 Ga0495660_0038787 3300046810 Bacteria 2647
310 Ga0495676_0034139 3300047321 Bacteria 4272
311 Ga0495687_000292 3300047443 Bacteria 65859
312 Ga0495687_009918 3300047443 Bacteria 5269
313 Ga0495687_009919 3300047443 Bacteria 5269
314 Ga0495686_0000906 3300047472 Bacteria 37300
315 Ga0496104_0072508 3300048907 Bacteria 3275
316 Ga0496105_0040596 3300048908 Bacteria 3837
317 Ga0501308_001858 3300049128 Bacteria 1769
318 Ga0501309_030161 3300049129 Unclassified 797
319 Ga0501310_012089 3300049130 Unclassified 985
320 Ga0501304_000578 3300049160 Bacteria 1982
321 Ga0501305_011994 3300049161 Unclassified 1179
322 Ga0495678_091694 3300049459 Bacteria 1069
323 Ga0501312_010534 3300049528 Bacteria 1240
324 Ga0501067_0074114 3300049583 Bacteria 1886
325 Ga0501257_047404 3300049686 Unclassified 1066
326 nmdc:mga03683_46574_c1 3300050489 Unclassified 1798
327 nmdc:mga03683_55883_c1 3300050489 Bacteria 1659
328 nmdc:mga03683_78576_c1 3300050489 Bacteria 1421
329 nmdc:mga03683_9538_c2 3300050489 Bacteria 800
330 nmdc:mga03n38_2869_c1 3300050490 Bacteria 5427
331 nmdc:mga00v17_35633_c1 3300050491 Bacteria 2963
332 nmdc:mga00v17_43885_c1 3300050491 Bacteria 2694
333 nmdc:mga0yw44_9673_c1 3300050492 Bacteria 4892
334 nmdc:mga0k408_112894_c1 3300050493 Bacteria 1607
335 nmdc:mga0k408_1252_c1 3300050493 Bacteria 13868
336 nmdc:mga0k408_140621_c1 3300050493 Bacteria 1436
337 nmdc:mga0k408_145661_c1 3300050493 Bacteria 1410
338 nmdc:mga0k408_210_c1 3300050493 Bacteria 31303
339 nmdc:mga0k408_340_c2 3300050493 Bacteria 13289
340 nmdc:mga0k408_3515_c1 3300050493 Bacteria 8283
341 nmdc:mga0k408_47480_c1 3300050493 Bacteria 2482
342 nmdc:mga0k408_6462_c1 3300050493 Bacteria 6248
343 nmdc:mga0k408_98430_c1 3300050493 Bacteria 1723
344 nmdc:mga06z11_129583_c1 3300050494 Bacteria 1415
345 nmdc:mga06z11_14368_c1 3300050494 Bacteria 3506
346 nmdc:mga06z11_19050_c1 3300050494 Bacteria 3147
347 nmdc:mga06z11_214823_c1 3300050494 Bacteria 1122
348 nmdc:mga04h51_76145_c1 3300050495 Bacteria 1182
349 nmdc:mga04h51_894_c1 3300050495 Bacteria 6855
350 nmdc:mga07m45_10952_c1 3300050496 Bacteria 4752
351 nmdc:mga07m45_1543_c1 3300050496 Bacteria 10592
352 nmdc:mga07m45_20376_c1 3300050496 Bacteria 3602
353 nmdc:mga07m45_246362_c1 3300050496 Unclassified 1040
354 nmdc:mga07m45_26471_c1 3300050496 Bacteria 3189
355 nmdc:mga07m45_7519_c1 3300050496 Bacteria 5570
356 nmdc:mga0sz30_89866_c1 3300050516 Bacteria 1335
357 Ga0500578_0000049 3300053086 Bacteria 124281
358 Ga0500578_0117800 3300053086 Bacteria 1671
359 Ga0500644_0000987 3300053088 Bacteria 8871
360 Ga0500646_0008709 3300053090 Bacteria 2599
361 Ga0500583_0021408 3300053092 Bacteria 2689
362 Ga0500583_0050980 3300053092 Bacteria 1921
363 Ga0500651_0002142 3300053093 Bacteria 10294
364 Ga0500651_0044437 3300053093 Bacteria 2797
365 Ga0500650_0003881 3300053098 Bacteria 5298
366 Ga0500562_026355 3300053108 Bacteria 1523
367 Ga0500592_017968 3300053116 Bacteria 1135
368 Ga0500628_001534 3300053129 Bacteria 3934
369 Ga0500642_0003878 3300053130 Bacteria 4598
370 Ga0500652_000820 3300053131 Bacteria 10362
371 Ga0500655_001408 3300053133 Bacteria 4561
372 Ga0500658_0076318 3300053134 Bacteria 1424
373 Ga0500559_0000021 3300053136 Bacteria 129980
374 Ga0500559_0178532 3300053136 Bacteria 1000
375 Ga0500561_0068766 3300053137 Bacteria 1009
376 Ga0500577_0013076 3300053142 Bacteria 2525
377 Ga0500604_0017148 3300053151 Bacteria 2000
378 Ga0500622_0000797 3300053156 Bacteria 27224
379 Ga0500622_0112790 3300053156 Bacteria 1326
380 Ga0500636_0127382 3300053177 Bacteria 1422
381 Ga0500645_011911 3300053730 Bacteria 2825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585428057 2587729828 181
2 3300026067 Ga0207678_10214045 Ga0207678_102140452 182
3 3300031456 Ga0307513_10094467 Ga0307513_100944673 182
4 3300009147 Ga0114129_10545519 Ga0114129_105455193 184
5 3300053136 Ga0500559_0178532 Ga0500559_0178532_387_974 184
6 3300041452 Ga0451793_1144917 Ga0451793_1144917_592_1185 189
7 3300046507 Ga0495606_0286330 Ga0495606_0286330_22_615 189
8 3300025298 Ga0209050_1000672 Ga0209050_10006726 190
9 3300025303 Ga0209051_1057622 Ga0209051_10576222 190
10 3300005331 Ga0070670_100015970 Ga0070670_1000159702 191
11 3300005334 Ga0068869_100001957 Ga0068869_10000195710 191
12 3300005354 Ga0070675_100022210 Ga0070675_1000222104 191
13 3300005364 Ga0070673_100018156 Ga0070673_1000181562 191
14 3300005366 Ga0070659_100517776 Ga0070659_1005177761 191
15 3300005367 Ga0070667_100108284 Ga0070667_1001082843 191
16 3300006195 Ga0075366_10128021 Ga0075366_101280212 191
17 3300025931 Ga0207644_10069436 Ga0207644_100694362 191
18 3300025942 Ga0207689_10002506 Ga0207689_1000250613 191
19 3300025960 Ga0207651_10080858 Ga0207651_100808583 191
20 3300025986 Ga0207658_10088282 Ga0207658_100882822 191
21 3300026023 Ga0207677_10091145 Ga0207677_100911452 191
22 3300026116 Ga0207674_10014053 Ga0207674_100140536 191
23 3300050493 nmdc:mga0k408_98430_c1 nmdc:mga0k408_98430_c1_837_1475 191
24 3300005328 Ga0070676_10010733 Ga0070676_100107335 192
25 3300005338 Ga0068868_100035763 Ga0068868_1000357632 192
26 3300009148 Ga0105243_10122713 Ga0105243_101227132 192
27 3300025935 Ga0207709_10028425 Ga0207709_100284252 192
28 3300025940 Ga0207691_10079532 Ga0207691_100795323 192
29 3300053090 Ga0500646_0008709 Ga0500646_0008709_936_1598 192
30 3300053093 Ga0500651_0002142 Ga0500651_0002142_4926_5588 192
31 3300053129 Ga0500628_001534 Ga0500628_001534_189_851 192
32 3300053131 Ga0500652_000820 Ga0500652_000820_6481_7143 192
33 3300053142 Ga0500577_0013076 Ga0500577_0013076_253_915 192
34 3300033180 Ga0307510_10000677 Ga0307510_1000067710 193
35 3300035691 Ga0373931_0014288 Ga0373931_0014288_366_1010 193
36 3300046460 Ga0495638_0045633 Ga0495638_0045633_586_1236 193
37 3300049129 Ga0501309_030161 Ga0501309_030161_11_694 193
38 3300053092 Ga0500583_0021408 Ga0500583_0021408_347_997 193
39 3300053098 Ga0500650_0003881 Ga0500650_0003881_2118_2768 193
40 3300053116 Ga0500592_017968 Ga0500592_017968_32_682 193
41 3300053130 Ga0500642_0003878 Ga0500642_0003878_1360_2010 193
42 3300053133 Ga0500655_001408 Ga0500655_001408_3091_3741 193
43 3300053151 Ga0500604_0017148 Ga0500604_0017148_383_1033 193
44 3300053156 Ga0500622_0000797 Ga0500622_0000797_20091_20741 193
45 3300036401 Ga0373937_0284808 Ga0373937_0284808_905_1510 194
46 3300046519 Ga0495632_0011011 Ga0495632_0011011_2032_2694 194
47 3300025321 Ga0207656_10086471 Ga0207656_100864712 195
48 3300025932 Ga0207690_10936050 Ga0207690_109360501 196
49 3300035691 Ga0373931_0177257 Ga0373931_0177257_267_902 196
50 3300046459 Ga0495629_0545872 Ga0495629_0545872_82_723 196
51 3300046557 Ga0495622_0036319 Ga0495622_0036319_33_674 196
52 3300047321 Ga0495676_0034139 Ga0495676_0034139_1589_2230 196
53 3300005548 Ga0070665_100003420 Ga0070665_10000342012 197
54 3300049130 Ga0501310_012089 Ga0501310_012089_258_953 197
55 3300005334 Ga0068869_100041765 Ga0068869_1000417654 198
56 3300005347 Ga0070668_100340943 Ga0070668_1003409432 198
57 3300005353 Ga0070669_100248083 Ga0070669_1002480832 198
58 3300005356 Ga0070674_100058227 Ga0070674_1000582272 198
59 3300005455 Ga0070663_100366218 Ga0070663_1003662182 198
60 3300005459 Ga0068867_100001098 Ga0068867_1000010984 198
61 3300005719 Ga0068861_100002467 Ga0068861_1000024677 198
62 3300005842 Ga0068858_100041134 Ga0068858_1000411344 198
63 3300005843 Ga0068860_100003409 Ga0068860_1000034092 198
64 3300005844 Ga0068862_100008823 Ga0068862_1000088232 198
65 3300006881 Ga0068865_100028238 Ga0068865_1000282383 198
66 3300009553 Ga0105249_10034727 Ga0105249_100347274 198
67 3300013297 Ga0157378_10002645 Ga0157378_100026456 198
68 3300013306 Ga0163162_10003350 Ga0163162_1000335015 198
69 3300014968 Ga0157379_10067166 Ga0157379_100671663 198
70 3300014969 Ga0157376_10227364 Ga0157376_102273642 198
71 3300017792 Ga0163161_10384102 Ga0163161_103841021 198
72 3300025923 Ga0207681_10006462 Ga0207681_100064624 198
73 3300025937 Ga0207669_10077008 Ga0207669_100770082 198
74 3300025938 Ga0207704_10052238 Ga0207704_100522383 198
75 3300025942 Ga0207689_10170461 Ga0207689_101704612 198
76 3300025961 Ga0207712_10019143 Ga0207712_100191432 198
77 3300025972 Ga0207668_10208825 Ga0207668_102088252 198
78 3300026035 Ga0207703_10065799 Ga0207703_100657993 198
79 3300026089 Ga0207648_10000847 Ga0207648_1000084719 198
80 3300026118 Ga0207675_100000247 Ga0207675_1000002477 198
81 3300026142 Ga0207698_10414194 Ga0207698_104141942 198
82 3300028380 Ga0268265_10027135 Ga0268265_100271352 198
83 3300028381 Ga0268264_10050290 Ga0268264_100502902 198
84 iso_pu_bacteria 2643221654 2644303450 199
85 3300005467 Ga0070706_100001239 Ga0070706_1000012396 200
86 3300005468 Ga0070707_100048557 Ga0070707_1000485574 200
87 3300006042 Ga0075368_10004738 Ga0075368_100047382 200
88 3300006048 Ga0075363_100117738 Ga0075363_1001177382 200
89 3300006178 Ga0075367_10159939 Ga0075367_101599392 200
90 3300006195 Ga0075366_10042656 Ga0075366_100426563 200
91 3300006353 Ga0075370_10030535 Ga0075370_100305352 200
92 3300025910 Ga0207684_10010775 Ga0207684_100107752 200
93 3300027866 Ga0209813_10046114 Ga0209813_100461142 200
94 3300047472 Ga0495686_0000906 Ga0495686_0000906_29355_29999 200
95 iso_pu_bacteria 2588253510 2588291526 200
96 iso_pu_bacteria 2643221592 2643970657 200
97 iso_pu_bacteria 2643221625 2644139061 200
98 iso_pu_bacteria 2643221648 2644274671 200
99 3300005719 Ga0068861_100006700 Ga0068861_1000067004 201
100 3300014326 Ga0157380_10019441 Ga0157380_100194414 201
101 3300053086 Ga0500578_0000049 Ga0500578_0000049_47017_47688 201
102 3300005330 Ga0070690_100015924 Ga0070690_1000159244 202
103 3300005331 Ga0070670_100097840 Ga0070670_1000978401 202
104 3300005331 Ga0070670_100160871 Ga0070670_1001608712 202
105 3300005333 Ga0070677_10167880 Ga0070677_101678802 202
106 3300005338 Ga0068868_100054992 Ga0068868_1000549924 202
107 3300005339 Ga0070660_100158790 Ga0070660_1001587902 202
108 3300005344 Ga0070661_100077627 Ga0070661_1000776272 202
109 3300005347 Ga0070668_100027356 Ga0070668_1000273564 202
110 3300005353 Ga0070669_100009364 Ga0070669_1000093644 202
111 3300005354 Ga0070675_100141081 Ga0070675_1001410813 202
112 3300005354 Ga0070675_100778303 Ga0070675_1007783031 202
113 3300005356 Ga0070674_100099697 Ga0070674_1000996973 202
114 3300005364 Ga0070673_100033551 Ga0070673_1000335514 202
115 3300005364 Ga0070673_100933320 Ga0070673_1009333201 202
116 3300005365 Ga0070688_100150067 Ga0070688_1001500672 202
117 3300005366 Ga0070659_100373418 Ga0070659_1003734182 202
118 3300005366 Ga0070659_100610603 Ga0070659_1006106031 202
119 3300005367 Ga0070667_100040558 Ga0070667_1000405584 202
120 3300005455 Ga0070663_100649913 Ga0070663_1006499131 202
121 3300005456 Ga0070678_100011861 Ga0070678_1000118615 202
122 3300005457 Ga0070662_100037830 Ga0070662_1000378304 202
123 3300005543 Ga0070672_100098323 Ga0070672_1000983233 202
124 3300005543 Ga0070672_100339774 Ga0070672_1003397742 202
125 3300005544 Ga0070686_100101891 Ga0070686_1001018913 202
126 3300005564 Ga0070664_100098699 Ga0070664_1000986992 202
127 3300005616 Ga0068852_100208214 Ga0068852_1002082142 202
128 3300005617 Ga0068859_100112508 Ga0068859_1001125082 202
129 3300005618 Ga0068864_100159176 Ga0068864_1001591763 202
130 3300005834 Ga0068851_10075983 Ga0068851_100759832 202
131 3300005841 Ga0068863_100016507 Ga0068863_1000165076 202
132 3300005842 Ga0068858_100027193 Ga0068858_1000271935 202
133 3300006195 Ga0075366_10002824 Ga0075366_100028244 202
134 3300006881 Ga0068865_100066018 Ga0068865_1000660183 202
135 3300006931 Ga0097620_100112509 Ga0097620_1001125092 202
136 3300009148 Ga0105243_10025107 Ga0105243_100251074 202
137 3300009177 Ga0105248_10081229 Ga0105248_100812293 202
138 3300009177 Ga0105248_10882628 Ga0105248_108826281 202
139 3300009553 Ga0105249_10037530 Ga0105249_100375304 202
140 3300013306 Ga0163162_10061809 Ga0163162_100618093 202
141 3300013306 Ga0163162_10205621 Ga0163162_102056211 202
142 3300013308 Ga0157375_10339690 Ga0157375_103396902 202
143 3300014325 Ga0163163_10024190 Ga0163163_100241902 202
144 3300014326 Ga0157380_10034131 Ga0157380_100341311 202
145 3300014968 Ga0157379_10012359 Ga0157379_100123596 202
146 3300014969 Ga0157376_10713733 Ga0157376_107137332 202
147 3300017792 Ga0163161_10041989 Ga0163161_100419893 202
148 3300017792 Ga0163161_10124648 Ga0163161_101246482 202
149 3300025903 Ga0207680_10033882 Ga0207680_100338821 202
150 3300025908 Ga0207643_10078196 Ga0207643_100781962 202
151 3300025920 Ga0207649_10163927 Ga0207649_101639272 202
152 3300025923 Ga0207681_10088193 Ga0207681_100881933 202
153 3300025925 Ga0207650_10069901 Ga0207650_100699014 202
154 3300025925 Ga0207650_10350247 Ga0207650_103502472 202
155 3300025933 Ga0207706_10013122 Ga0207706_100131225 202
156 3300025933 Ga0207706_10085235 Ga0207706_100852352 202
157 3300025938 Ga0207704_10032046 Ga0207704_100320463 202
158 3300025940 Ga0207691_10015905 Ga0207691_100159055 202
159 3300025940 Ga0207691_10026107 Ga0207691_100261074 202
160 3300025940 Ga0207691_10198414 Ga0207691_101984142 202
161 3300025941 Ga0207711_10149375 Ga0207711_101493752 202
162 3300025941 Ga0207711_10576209 Ga0207711_105762092 202
163 3300025945 Ga0207679_10043140 Ga0207679_100431401 202
164 3300025961 Ga0207712_10032695 Ga0207712_100326952 202
165 3300025972 Ga0207668_10023581 Ga0207668_100235814 202
166 3300025986 Ga0207658_10266344 Ga0207658_102663442 202
167 3300026023 Ga0207677_10333249 Ga0207677_103332491 202
168 3300026023 Ga0207677_10517531 Ga0207677_105175312 202
169 3300026035 Ga0207703_10281613 Ga0207703_102816132 202
170 3300026088 Ga0207641_10400006 Ga0207641_104000062 202
171 3300026089 Ga0207648_10111270 Ga0207648_101112702 202
172 3300026089 Ga0207648_11058976 Ga0207648_110589761 202
173 3300026095 Ga0207676_10126954 Ga0207676_101269543 202
174 3300026095 Ga0207676_10300493 Ga0207676_103004932 202
175 3300026118 Ga0207675_100029363 Ga0207675_1000293635 202
176 3300026121 Ga0207683_10005596 Ga0207683_1000559610 202
177 3300026121 Ga0207683_10020427 Ga0207683_100204274 202
178 3300028380 Ga0268265_10495309 Ga0268265_104953092 202
179 3300046459 Ga0495629_0324225 Ga0495629_0324225_387_1013 202
180 3300046537 Ga0495598_0025219 Ga0495598_0025219_48_674 202
181 3300046683 Ga0495658_0215664 Ga0495658_0215664_558_1184 202
182 3300048907 Ga0496104_0072508 Ga0496104_0072508_936_1562 202
183 3300048908 Ga0496105_0040596 Ga0496105_0040596_1299_1925 202
184 3300050493 nmdc:mga0k408_6462_c1 nmdc:mga0k408_6462_c1_1343_1963 202
185 3300005331 Ga0070670_100136123 Ga0070670_1001361232 203
186 3300005338 Ga0068868_100029651 Ga0068868_1000296515 203
187 3300005548 Ga0070665_100330707 Ga0070665_1003307073 203
188 3300005617 Ga0068859_100510693 Ga0068859_1005106932 203
189 3300005618 Ga0068864_100004564 Ga0068864_1000045646 203
190 3300005841 Ga0068863_100007420 Ga0068863_1000074205 203
191 3300005841 Ga0068863_100154294 Ga0068863_1001542941 203
192 3300005843 Ga0068860_100187395 Ga0068860_1001873955 203
193 3300006931 Ga0097620_100510722 Ga0097620_1005107221 203
194 3300009098 Ga0105245_10009748 Ga0105245_100097487 203
195 3300011119 Ga0105246_10709385 Ga0105246_107093851 203
196 3300013296 Ga0157374_10186835 Ga0157374_101868354 203
197 3300014969 Ga0157376_10190324 Ga0157376_101903244 203
198 3300025925 Ga0207650_10301084 Ga0207650_103010842 203
199 3300026088 Ga0207641_10009069 Ga0207641_100090692 203
200 3300028381 Ga0268264_10571900 Ga0268264_105719002 203
201 3300031507 Ga0307509_10001648 Ga0307509_1000164832 203
202 3300031649 Ga0307514_10082789 Ga0307514_100827892 203
203 3300033180 Ga0307510_10009142 Ga0307510_1000914212 203
204 3300046454 Ga0495592_0000202 Ga0495592_0000202_32780_33442 203
205 3300046524 Ga0495648_0127438 Ga0495648_0127438_628_1290 203
206 3300005262 Ga0065165_1001629 Ga0065165_100162915 204
207 3300025273 Ga0209673_1025682 Ga0209673_10256822 204
208 3300028786 Ga0307517_10127295 Ga0307517_101272952 204
209 3300053108 Ga0500562_026355 Ga0500562_026355_323_958 204
210 3300053137 Ga0500561_0068766 Ga0500561_0068766_97_732 204
211 3300053156 Ga0500622_0112790 Ga0500622_0112790_237_872 204
212 3300025981 Ga0207640_10343654 Ga0207640_103436542 205
213 3300031548 Ga0307408_100265103 Ga0307408_1002651032 205
214 3300031911 Ga0307412_10222468 Ga0307412_102224682 205
215 3300005367 Ga0070667_100000975 Ga0070667_10000097519 206
216 3300005457 Ga0070662_100260432 Ga0070662_1002604322 206
217 3300005548 Ga0070665_100053787 Ga0070665_1000537873 206
218 3300005843 Ga0068860_100468558 Ga0068860_1004685582 206
219 3300009177 Ga0105248_10437668 Ga0105248_104376682 206
220 3300013308 Ga0157375_10145351 Ga0157375_101453512 206
221 3300014968 Ga0157379_10561634 Ga0157379_105616342 206
222 3300025933 Ga0207706_10296294 Ga0207706_102962942 206
223 3300025986 Ga0207658_10002242 Ga0207658_100022424 206
224 3300025986 Ga0207658_10536314 Ga0207658_105363141 206
225 3300028379 Ga0268266_10146452 Ga0268266_101464522 206
226 3300028381 Ga0268264_10420398 Ga0268264_104203982 206
227 3300028786 Ga0307517_10040214 Ga0307517_100402142 206
228 3300031456 Ga0307513_10045089 Ga0307513_100450893 206
229 3300031616 Ga0307508_10005343 Ga0307508_1000534313 206
230 3300031730 Ga0307516_10065330 Ga0307516_100653302 206
231 3300033180 Ga0307510_10018561 Ga0307510_100185616 206
232 3300035171 Ga0373946_0225123 Ga0373946_0225123_99_740 206
233 3300037068 Ga0373925_0221155 Ga0373925_0221155_501_1142 206
234 3300046460 Ga0495638_0359698 Ga0495638_0359698_37_681 206
235 3300046512 Ga0495610_0013033 Ga0495610_0013033_1232_1876 206
236 3300046515 Ga0495620_0090966 Ga0495620_0090966_238_882 206
237 3300046660 Ga0495625_0189497 Ga0495625_0189497_183_818 206
238 3300049583 Ga0501067_0074114 Ga0501067_0074114_851_1510 206
239 3300050493 nmdc:mga0k408_47480_c1 nmdc:mga0k408_47480_c1_341_1006 206
240 3300050494 nmdc:mga06z11_214823_c1 nmdc:mga06z11_214823_c1_307_972 206
241 3300050495 nmdc:mga04h51_76145_c1 nmdc:mga04h51_76145_c1_154_819 206
242 3300050496 nmdc:mga07m45_10952_c1 nmdc:mga07m45_10952_c1_3582_4247 206
243 3300053088 Ga0500644_0000987 Ga0500644_0000987_7910_8554 206
244 3300053092 Ga0500583_0050980 Ga0500583_0050980_501_1136 206
245 3300053093 Ga0500651_0044437 Ga0500651_0044437_1018_1662 206
246 3300053136 Ga0500559_0000021 Ga0500559_0000021_31840_32484 206
247 3300053177 Ga0500636_0127382 Ga0500636_0127382_35_679 206
248 3300005356 Ga0070674_100184472 Ga0070674_1001844721 207
249 3300005844 Ga0068862_100188539 Ga0068862_1001885391 207
250 3300006195 Ga0075366_10001511 Ga0075366_1000151116 207
251 3300006353 Ga0075370_10088269 Ga0075370_100882692 207
252 3300025937 Ga0207669_10725523 Ga0207669_107255231 207
253 3300028380 Ga0268265_10085792 Ga0268265_100857924 207
254 3300028786 Ga0307517_10061688 Ga0307517_100616883 207
255 3300028794 Ga0307515_10022943 Ga0307515_100229438 207
256 3300028794 Ga0307515_10232552 Ga0307515_102325521 207
257 3300031507 Ga0307509_10002250 Ga0307509_1000225014 207
258 3300031507 Ga0307509_10023831 Ga0307509_100238311 207
259 3300031616 Ga0307508_10000296 Ga0307508_1000029636 207
260 3300031616 Ga0307508_10570842 Ga0307508_105708421 207
261 3300033179 Ga0307507_10027713 Ga0307507_100277132 207
262 3300033179 Ga0307507_10190920 Ga0307507_101909202 207
263 3300033180 Ga0307510_10075879 Ga0307510_100758793 207
264 3300035089 Ga0373944_0012405 Ga0373944_0012405_821_1474 207
265 3300035692 Ga0373935_0280620 Ga0373935_0280620_379_1032 207
266 3300035695 Ga0373927_0279719 Ga0373927_0279719_280_933 207
267 3300037068 Ga0373925_0011256 Ga0373925_0011256_3305_3958 207
268 3300046683 Ga0495658_0024574 Ga0495658_0024574_2273_2926 207
269 3300046683 Ga0495658_0027836 Ga0495658_0027836_1687_2325 207
270 3300005844 Ga0068862_100076088 Ga0068862_1000760881 208
271 3300009148 Ga0105243_10007766 Ga0105243_1000776615 208
272 3300028380 Ga0268265_10012889 Ga0268265_100128895 208
273 3300031507 Ga0307509_10178607 Ga0307509_101786072 208
274 3300003316 rootH1_10012335 rootH1_100123352 209
275 3300003322 rootL2_10005479 rootL2_100054792 209
276 3300005843 Ga0068860_100580866 Ga0068860_1005808662 209
277 3300006177 Ga0075362_10049645 Ga0075362_100496452 209
278 3300006871 Ga0075434_101257100 Ga0075434_1012571001 209
279 3300014325 Ga0163163_10728465 Ga0163163_107284652 209
280 3300014326 Ga0157380_10197898 Ga0157380_101978983 209
281 3300046660 Ga0495625_0032741 Ga0495625_0032741_2504_3154 209
282 3300050489 nmdc:mga03683_46574_c1 nmdc:mga03683_46574_c1_1100_1750 209
283 3300050516 nmdc:mga0sz30_89866_c1 nmdc:mga0sz30_89866_c1_540_1190 209
284 3300005334 Ga0068869_100347394 Ga0068869_1003473942 210
285 3300005338 Ga0068868_100293201 Ga0068868_1002932012 210
286 3300005364 Ga0070673_100056225 Ga0070673_1000562252 210
287 3300005367 Ga0070667_100446450 Ga0070667_1004464502 210
288 3300005455 Ga0070663_100178894 Ga0070663_1001788942 210
289 3300005457 Ga0070662_100002116 Ga0070662_1000021166 210
290 3300005548 Ga0070665_100610147 Ga0070665_1006101471 210
291 3300005577 Ga0068857_100014101 Ga0068857_1000141012 210
292 3300005616 Ga0068852_100023231 Ga0068852_1000232312 210
293 3300006038 Ga0075365_10021077 Ga0075365_100210774 210
294 3300006042 Ga0075368_10001719 Ga0075368_100017192 210
295 3300006042 Ga0075368_10045396 Ga0075368_100453963 210
296 3300006048 Ga0075363_100029491 Ga0075363_1000294912 210
297 3300006048 Ga0075363_100111411 Ga0075363_1001114112 210
298 3300006177 Ga0075362_10000656 Ga0075362_100006562 210
299 3300006177 Ga0075362_10001320 Ga0075362_100013207 210
300 3300006178 Ga0075367_10000315 Ga0075367_100003154 210
301 3300006178 Ga0075367_10022706 Ga0075367_100227064 210
302 3300006195 Ga0075366_10000111 Ga0075366_1000011115 210
303 3300006195 Ga0075366_10000773 Ga0075366_100007736 210
304 3300006195 Ga0075366_10049917 Ga0075366_100499172 210
305 3300006195 Ga0075366_10091861 Ga0075366_100918611 210
306 3300006353 Ga0075370_10000184 Ga0075370_1000018423 210
307 3300006353 Ga0075370_10066384 Ga0075370_100663843 210
308 3300009093 Ga0105240_10034526 Ga0105240_100345265 210
309 3300009174 Ga0105241_10509379 Ga0105241_105093791 210
310 3300009545 Ga0105237_10008024 Ga0105237_100080245 210
311 3300009553 Ga0105249_11104718 Ga0105249_111047181 210
312 3300010375 Ga0105239_10131485 Ga0105239_101314852 210
313 3300025914 Ga0207671_10175708 Ga0207671_101757082 210
314 3300025942 Ga0207689_10071794 Ga0207689_100717943 210
315 3300025981 Ga0207640_10034459 Ga0207640_100344592 210
316 3300026067 Ga0207678_10020461 Ga0207678_100204613 210
317 3300026089 Ga0207648_10218030 Ga0207648_102180302 210
318 3300026116 Ga0207674_10009979 Ga0207674_100099792 210
319 3300027866 Ga0209813_10001853 Ga0209813_100018534 210
320 3300028786 Ga0307517_10223881 Ga0307517_102238812 210
321 3300031649 Ga0307514_10195554 Ga0307514_101955542 210
322 3300031730 Ga0307516_10099577 Ga0307516_100995774 210
323 3300046471 Ga0495650_0137659 Ga0495650_0137659_26_679 210
324 3300046506 Ga0495583_0181548 Ga0495583_0181548_16_669 210
325 3300046519 Ga0495632_0039915 Ga0495632_0039915_996_1649 210
326 3300046542 Ga0495597_0018349 Ga0495597_0018349_1529_2182 210
327 3300046542 Ga0495597_0061462 Ga0495597_0061462_726_1379 210
328 3300046694 Ga0495649_0013295 Ga0495649_0013295_2663_3316 210
329 3300046810 Ga0495660_0038787 Ga0495660_0038787_372_1025 210
330 3300047443 Ga0495687_000292 Ga0495687_000292_18621_19274 210
331 3300047443 Ga0495687_009918 Ga0495687_009918_2546_3199 210
332 3300047443 Ga0495687_009919 Ga0495687_009919_2546_3199 210
333 3300049459 Ga0495678_091694 Ga0495678_091694_242_895 210
334 3300050489 nmdc:mga03683_55883_c1 nmdc:mga03683_55883_c1_411_1064 210
335 3300050489 nmdc:mga03683_78576_c1 nmdc:mga03683_78576_c1_500_1153 210
336 3300050489 nmdc:mga03683_9538_c2 nmdc:mga03683_9538_c2_69_722 210
337 3300050490 nmdc:mga03n38_2869_c1 nmdc:mga03n38_2869_c1_907_1560 210
338 3300050491 nmdc:mga00v17_35633_c1 nmdc:mga00v17_35633_c1_92_745 210
339 3300050491 nmdc:mga00v17_43885_c1 nmdc:mga00v17_43885_c1_1225_1878 210
340 3300050492 nmdc:mga0yw44_9673_c1 nmdc:mga0yw44_9673_c1_3462_4115 210
341 3300050493 nmdc:mga0k408_112894_c1 nmdc:mga0k408_112894_c1_735_1388 210
342 3300050493 nmdc:mga0k408_1252_c1 nmdc:mga0k408_1252_c1_6259_6912 210
343 3300050493 nmdc:mga0k408_145661_c1 nmdc:mga0k408_145661_c1_200_853 210
344 3300050493 nmdc:mga0k408_210_c1 nmdc:mga0k408_210_c1_20781_21431 210
345 3300050493 nmdc:mga0k408_340_c2 nmdc:mga0k408_340_c2_7279_7932 210
346 3300050493 nmdc:mga0k408_3515_c1 nmdc:mga0k408_3515_c1_3990_4643 210
347 3300050494 nmdc:mga06z11_129583_c1 nmdc:mga06z11_129583_c1_215_868 210
348 3300050494 nmdc:mga06z11_14368_c1 nmdc:mga06z11_14368_c1_2443_3096 210
349 3300050494 nmdc:mga06z11_19050_c1 nmdc:mga06z11_19050_c1_2159_2812 210
350 3300050495 nmdc:mga04h51_894_c1 nmdc:mga04h51_894_c1_2340_2993 210
351 3300050496 nmdc:mga07m45_1543_c1 nmdc:mga07m45_1543_c1_2122_2775 210
352 3300050496 nmdc:mga07m45_20376_c1 nmdc:mga07m45_20376_c1_1013_1663 210
353 3300050496 nmdc:mga07m45_246362_c1 nmdc:mga07m45_246362_c1_305_958 210
354 3300050496 nmdc:mga07m45_7519_c1 nmdc:mga07m45_7519_c1_1579_2232 210
355 3300053086 Ga0500578_0117800 Ga0500578_0117800_88_741 210
356 3300053134 Ga0500658_0076318 Ga0500658_0076318_740_1393 210
357 3300053730 Ga0500645_011911 Ga0500645_011911_525_1178 210
358 3300005617 Ga0068859_100658558 Ga0068859_1006585581 211
359 3300006195 Ga0075366_10021313 Ga0075366_100213132 211
360 3300006237 Ga0097621_100149062 Ga0097621_1001490623 211
361 3300006353 Ga0075370_10009871 Ga0075370_100098715 211
362 3300006931 Ga0097620_100658585 Ga0097620_1006585852 211
363 3300009545 Ga0105237_10448976 Ga0105237_104489762 211
364 3300028786 Ga0307517_10100575 Ga0307517_101005752 211
365 3300028794 Ga0307515_10337647 Ga0307515_103376472 211
366 3300031456 Ga0307513_10135189 Ga0307513_101351893 211
367 3300031507 Ga0307509_10021038 Ga0307509_100210389 211
368 3300031730 Ga0307516_10237911 Ga0307516_102379112 211
369 3300033180 Ga0307510_10266229 Ga0307510_102662291 211
370 3300049128 Ga0501308_001858 Ga0501308_001858_633_1373 211
371 3300049160 Ga0501304_000578 Ga0501304_000578_627_1367 211
372 3300049161 Ga0501305_011994 Ga0501305_011994_34_774 211
373 3300049528 Ga0501312_010534 Ga0501312_010534_20_760 211
374 3300049686 Ga0501257_047404 Ga0501257_047404_243_983 211
375 3300050493 nmdc:mga0k408_140621_c1 nmdc:mga0k408_140621_c1_281_937 211
376 3300050496 nmdc:mga07m45_26471_c1 nmdc:mga07m45_26471_c1_1486_2142 211
377 3300003323 rootH1_10081759 rootH1_100817591 216
378 3300031456 Ga0307513_10474344 Ga0307513_104743441 218
379 3300002774 JGI25150J39212_1017167 JGI25150J39212_10171671 224
380 3300003215 JGI25153J46596_10001431 JGI25153J46596_100014315 224
381 3300003771 Ga0055526_1031030 Ga0055526_10310302 224
382 3300025245 Ga0207425_1000546 Ga0207425_10005466 224
383 3300025258 Ga0209129_1000041 Ga0209129_1000041195 224
384 3300025295 Ga0209564_1000029 Ga0209564_1000029341 224
385 3300025297 Ga0209758_1000043 Ga0209758_100004399 224
386 3300025299 Ga0209256_1013841 Ga0209256_10138414 224
387 3300025304 Ga0209257_1020113 Ga0209257_10201132 224

Structural Annotation

Top 5 Hits

ID Description Score Start End
8okv-assembly4.cif.gz_D lipoprotein bt2095 from bacteroides thetaiotamicron bound to cyanocobalamin cncbl 0.9458 75 88
3fw0-assembly1.cif.gz_A structure of peptidyl-alpha-hydroxyglycine alpha-amidating lyase (pal) bound to alpha-hydroxyhippuric acid (non-peptidic substrate) 0.8507 73 89
2mhd-assembly1.cif.gz_A nmr structure of the protein bacuni_03114 from bacteroides uniformis atcc 8492 0.8382 67 92
6r5x-assembly1.cif.gz_A 8-bladed beta-propeller formed by four 2-bladed fragments 0.8358 74 90
6xg7-assembly1.cif.gz_A 1.3 a resolution structure of the of the nhl repeat region of d. melanogaster thin 0.8254 72 89
ID Description Score Start End Superfamily
3dsmA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 1.02 75 88 2.130.10.10
af_E9PYP2_2370_2578_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9545 75 88 2.130.10.10
af_Q8RXC4_214_475_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9003 74 90 2.130.10.10
af_O16302_981_1150_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.8951 73 88 2.110.10.10
af_O94698_188_346_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8895 73 88 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A317RET2-F1-model_v4 L,D-transpeptidase-like protein 0.979 44 216
AF-A0A5C6Z9M9-F1-model_v4 L,D-transpeptidase 0.9773 42 207
AF-A0A3D3D0V2-F1-model_v4 deleted 0.9765 39 216
AF-A0A7L8SPZ6-F1-model_v4 L,D-transpeptidase 0.9741 44 216
AF-A0A0Q7SNM5-F1-model_v4 YkuD domain-containing protein 0.9741 44 213

Feature Viewer

pLDDT pTM Quality
84.51 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map