F430682

General Info

Members Datasets Scaffolds Average Seq Length
386 278 772 339

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221575|2643885780
Length 380
Sequence LTAPSGFRHSEHEDDARGCGDGCGIRSTQNRHRFANEGLAPVVELTKREGGEDDHHVSTGSLQGWDKVEALTADAYAFGLGETRGLVADYIPILAETDPELFGVCVAEVDGSIHSAGDAAVEFSIQSISKAFVYALVCEELGHDLVKEHVGVNNTGLAFNSVMAIELNYGHPMNPMVNAGALATTALVPGGSPAEQWELIRQGLSRFAGHPLELDGEVYRSEMATNQRNMAIARLLESYRRIEIDPLKVVDVYTKQCALRVSARDIAVMGATLADGGVNPITGEQVVSAAVCRDTLSVLAANGMYERSGEWLFEIGLPGKSGVAGGIVTISPGKAGIGVFSPRLDSAGNSVRGQAATSFLSRSLGLNIFASDVSPTRLEP

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 2643221575 Microbacterium sp. Root61 Isolate Unclassified
252 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
253 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
254 2643221566 Microbacterium sp. Root166 Isolate Unclassified
255 2643221572 Leifsonia sp. Root60 Isolate Unclassified
256 2643221613 Oerskovia sp. Root22 Isolate Unclassified
257 2643221616 Leifsonia sp. Root227 Isolate Unclassified
258 2643221630 Microbacterium sp. Root322 Isolate Unclassified
259 2643221649 Leifsonia sp. Root4 Isolate Unclassified
260 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
261 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
262 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
263 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
264 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
265 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
266 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
267 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
268 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
269 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
270 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
271 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
272 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
273 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
274 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
275 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
276 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
277 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
278 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0
Rhizoplane 7.25
Rhizosphere 81.09
Stem 0
Stem Tuber 0.26
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005286 3300001977 Bacteria 2018
2 JGI24743J22301_10004666 3300001991 Bacteria 2245
3 JGI25162J39368_1010040 3300002737 Bacteria 1223
4 JGI25154J39366_1001702 3300002738 Bacteria 7211
5 JGI25164J39214_1000658 3300002772 Bacteria 14139
6 JGI25165J46597_1000005 3300003214 Bacteria 623702
7 rootH2_10009998 3300003320 Bacteria 5926
8 JGI25404J52841_10007563 3300003659 Bacteria 2300
9 Ga0065714_10085576 3300005288 Bacteria 2142
10 Ga0070658_10221679 3300005327 Bacteria 1599
11 Ga0070683_100087079 3300005329 Bacteria 2929
12 Ga0070690_100107175 3300005330 Bacteria 1860
13 Ga0070690_100241154 3300005330 Unclassified 1275
14 Ga0068869_100026450 3300005334 Bacteria 4040
15 Ga0070680_100050860 3300005336 Bacteria 3380
16 Ga0070682_100073871 3300005337 Bacteria 2188
17 Ga0068868_100022734 3300005338 Bacteria 4737
18 Ga0068868_100130323 3300005338 Bacteria 2057
19 Ga0068868_100298189 3300005338 Bacteria 1368
20 Ga0070660_100242227 3300005339 Bacteria 1469
21 Ga0070689_100149788 3300005340 Bacteria 1881
22 Ga0070691_10059957 3300005341 Bacteria 1829
23 Ga0070661_100063836 3300005344 Bacteria 2705
24 Ga0070692_10138388 3300005345 Bacteria 1375
25 Ga0070692_10167341 3300005345 Unclassified 1264
26 Ga0070668_100126531 3300005347 Bacteria 2047
27 Ga0070668_100206927 3300005347 Bacteria 1612
28 Ga0070669_100079456 3300005353 Bacteria 2439
29 Ga0070675_100134071 3300005354 Bacteria 2113
30 Ga0070675_100206924 3300005354 Bacteria 1705
31 Ga0070675_100255111 3300005354 Bacteria 1536
32 Ga0070671_100349175 3300005355 Bacteria 1262
33 Ga0070673_100163093 3300005364 Bacteria 1897
34 Ga0070688_100042006 3300005365 Bacteria 2810
35 Ga0070688_100055596 3300005365 Bacteria 2483
36 Ga0070659_100096203 3300005366 Bacteria 2378
37 Ga0070659_100213959 3300005366 Bacteria 1589
38 Ga0070667_100096587 3300005367 Bacteria 2548
39 Ga0070667_100140476 3300005367 Bacteria 2114
40 Ga0070703_10067021 3300005406 Bacteria 1189
41 Ga0070713_100199344 3300005436 Bacteria 1807
42 Ga0070713_100298959 3300005436 Bacteria 1481
43 Ga0070710_10015183 3300005437 Bacteria 3893
44 Ga0070710_10039608 3300005437 Bacteria 2593
45 Ga0070710_10126102 3300005437 Bacteria 1555
46 Ga0070701_10043038 3300005438 Bacteria 2308
47 Ga0070711_100032631 3300005439 Bacteria 3463
48 Ga0070711_100114782 3300005439 Bacteria 1982
49 Ga0070711_100148659 3300005439 Bacteria 1764
50 Ga0070705_100083417 3300005440 Bacteria 1969
51 Ga0070705_100158867 3300005440 Bacteria 1509
52 Ga0070700_100099577 3300005441 Bacteria 1912
53 Ga0070700_100125277 3300005441 Unclassified 1726
54 Ga0070694_100034047 3300005444 Bacteria 3357
55 Ga0070663_100117596 3300005455 Unclassified 2004
56 Ga0070678_100098817 3300005456 Bacteria 2257
57 Ga0070662_100125865 3300005457 Bacteria 1970
58 Ga0070662_100159251 3300005457 Bacteria 1765
59 Ga0070681_10029252 3300005458 Bacteria 5531
60 Ga0068867_100045964 3300005459 Bacteria 3205
61 Ga0068867_100125338 3300005459 Bacteria 1990
62 Ga0070685_10033414 3300005466 Bacteria 2890
63 Ga0070685_10135226 3300005466 Bacteria 1546
64 Ga0070679_100093474 3300005530 Bacteria 2995
65 Ga0070684_100168737 3300005535 Bacteria 1987
66 Ga0068853_100202073 3300005539 Bacteria 1809
67 Ga0070672_100207283 3300005543 Unclassified 1641
68 Ga0070695_100097252 3300005545 Bacteria 1977
69 Ga0070695_100120574 3300005545 Bacteria 1793
70 Ga0070696_100055483 3300005546 Bacteria 2762
71 Ga0070696_100120367 3300005546 Bacteria 1899
72 Ga0070693_100046755 3300005547 Bacteria 2459
73 Ga0070665_100233042 3300005548 Bacteria 1841
74 Ga0070665_100271296 3300005548 Bacteria 1698
75 Ga0070704_100170964 3300005549 Bacteria 1728
76 Ga0070704_100182336 3300005549 Bacteria 1680
77 Ga0068855_100444792 3300005563 Bacteria 1415
78 Ga0068857_100123414 3300005577 Bacteria 2333
79 Ga0068854_100040993 3300005578 Bacteria 3269
80 Ga0068854_100050498 3300005578 Bacteria 2976
81 Ga0068854_100119021 3300005578 Bacteria 2002
82 Ga0070702_100075833 3300005615 Bacteria 2000
83 Ga0070702_100080872 3300005615 Bacteria 1945
84 Ga0070702_100117475 3300005615 Bacteria 1659
85 Ga0068852_100095944 3300005616 Bacteria 2664
86 Ga0068852_100158070 3300005616 Bacteria 2113
87 Ga0068859_100080312 3300005617 Bacteria 3302
88 Ga0068859_100254272 3300005617 Bacteria 1847
89 Ga0068859_100341121 3300005617 Bacteria 1592
90 Ga0068864_100040667 3300005618 Bacteria 3976
91 Ga0068864_100317991 3300005618 Bacteria 1461
92 Ga0068866_10211500 3300005718 Bacteria 1165
93 Ga0068861_100094200 3300005719 Unclassified 2369
94 Ga0068861_100155360 3300005719 Bacteria 1881
95 Ga0068858_100048638 3300005842 Bacteria 3928
96 Ga0068858_100158381 3300005842 Bacteria 2131
97 Ga0068860_100274397 3300005843 Unclassified 1646
98 Ga0068862_100178207 3300005844 Bacteria 1906
99 Ga0081540_1000487 3300005983 Bacteria 38975
100 Ga0070715_10045678 3300006163 Bacteria 1858
101 Ga0070712_100008907 3300006175 Bacteria 6322
102 Ga0070712_100082332 3300006175 Bacteria 2334
103 Ga0097621_100173297 3300006237 Bacteria 1861
104 Ga0097621_100268666 3300006237 Bacteria 1498
105 Ga0097621_100321160 3300006237 Bacteria 1371
106 Ga0068865_100095574 3300006881 Bacteria 2165
107 Ga0068865_100331807 3300006881 Bacteria 1227
108 Ga0097620_100080313 3300006931 Bacteria 3302
109 Ga0097620_100254257 3300006931 Bacteria 1847
110 Ga0097620_100341102 3300006931 Bacteria 1592
111 Ga0105250_10099639 3300009092 Bacteria 1185
112 Ga0105240_10217540 3300009093 Bacteria 2228
113 Ga0105245_10181973 3300009098 Bacteria 2009
114 Ga0105245_10275730 3300009098 Bacteria 1642
115 Ga0105247_10018001 3300009101 Bacteria 4238
116 Ga0105247_10052379 3300009101 Bacteria 2516
117 Ga0105243_10084012 3300009148 Bacteria 2606
118 Ga0105243_10144098 3300009148 Bacteria 2036
119 Ga0105243_10333373 3300009148 Bacteria 1387
120 Ga0105241_10193966 3300009174 Bacteria 1692
121 Ga0105242_10064335 3300009176 Bacteria 3023
122 Ga0105248_10198007 3300009177 Bacteria 2264
123 Ga0105248_10233434 3300009177 Bacteria 2071
124 Ga0105237_10213346 3300009545 Bacteria 1930
125 Ga0105237_10257924 3300009545 Unclassified 1746
126 Ga0105238_10213018 3300009551 Bacteria 1908
127 Ga0105238_10294212 3300009551 Bacteria 1606
128 Ga0105249_10175114 3300009553 Bacteria 2083
129 Ga0105249_10178639 3300009553 Bacteria 2063
130 Ga0105239_10109875 3300010375 Bacteria 3056
131 Ga0105239_10201243 3300010375 Unclassified 2231
132 Ga0105246_10018882 3300011119 Bacteria 4397
133 Ga0105246_10104814 3300011119 Bacteria 2066
134 Ga0157347_1001950 3300012502 Bacteria 1705
135 Ga0157371_10077558 3300013102 Bacteria 2353
136 Ga0157374_10048525 3300013296 Bacteria 3939
137 Ga0157374_10247045 3300013296 Bacteria 1755
138 Ga0157374_10456670 3300013296 Bacteria 1279
139 Ga0157378_10041895 3300013297 Bacteria 4062
140 Ga0157378_10228340 3300013297 Bacteria 1772
141 Ga0163162_10122037 3300013306 Bacteria 2711
142 Ga0163162_10140522 3300013306 Bacteria 2528
143 Ga0163162_10373796 3300013306 Bacteria 1558
144 Ga0157372_10261161 3300013307 Bacteria 2011
145 Ga0157375_10349381 3300013308 Bacteria 1645
146 Ga0163163_10069068 3300014325 Bacteria 3517
147 Ga0163163_10106087 3300014325 Bacteria 2835
148 Ga0163163_10243057 3300014325 Bacteria 1850
149 Ga0157380_10242963 3300014326 Bacteria 1624
150 Ga0157377_10084238 3300014745 Bacteria 1864
151 Ga0157377_10213310 3300014745 Bacteria 1232
152 Ga0157379_10440961 3300014968 Unclassified 1201
153 Ga0157376_10172401 3300014969 Bacteria 1971
154 Ga0157376_10398820 3300014969 Bacteria 1330
155 Ga0163161_10062105 3300017792 Bacteria 2721
156 Ga0163161_10095724 3300017792 Bacteria 2203
157 Ga0207427_100028 3300025231 Bacteria 388949
158 Ga0209437_100211 3300025233 Bacteria 108544
159 Ga0209646_1000092 3300025246 Bacteria 185930
160 Ga0209233_1000001 3300025261 Bacteria 2992747
161 Ga0207653_10034423 3300025885 Bacteria 1645
162 Ga0207692_10065631 3300025898 Bacteria 1894
163 Ga0207692_10146647 3300025898 Bacteria 1347
164 Ga0207642_10051558 3300025899 Bacteria 1862
165 Ga0207710_10049682 3300025900 Bacteria 1880
166 Ga0207688_10044556 3300025901 Bacteria 2472
167 Ga0207688_10062356 3300025901 Bacteria 2102
168 Ga0207680_10326212 3300025903 Bacteria 1074
169 Ga0207685_10063128 3300025905 Bacteria 1474
170 Ga0207685_10132226 3300025905 Bacteria 1109
171 Ga0207654_10165074 3300025911 Bacteria 1433
172 Ga0207671_10118125 3300025914 Bacteria 2025
173 Ga0207693_10007872 3300025915 Bacteria 8752
174 Ga0207693_10084211 3300025915 Bacteria 2491
175 Ga0207663_10110748 3300025916 Bacteria 1862
176 Ga0207663_10115296 3300025916 Bacteria 1830
177 Ga0207662_10035700 3300025918 Bacteria 2904
178 Ga0207657_10208055 3300025919 Bacteria 1571
179 Ga0207649_10067195 3300025920 Bacteria 2275
180 Ga0207681_10041212 3300025923 Bacteria 3078
181 Ga0207687_10207295 3300025927 Bacteria 1536
182 Ga0207700_10065189 3300025928 Bacteria 2778
183 Ga0207664_10022253 3300025929 Bacteria 4730
184 Ga0207644_10163005 3300025931 Bacteria 1734
185 Ga0207690_10091063 3300025932 Bacteria 2155
186 Ga0207706_10031088 3300025933 Bacteria 4758
187 Ga0207706_10064247 3300025933 Bacteria 3231
188 Ga0207706_10065881 3300025933 Bacteria 3188
189 Ga0207686_10078525 3300025934 Bacteria 2147
190 Ga0207709_10188111 3300025935 Bacteria 1464
191 Ga0207669_10064164 3300025937 Bacteria 2271
192 Ga0207704_10088372 3300025938 Unclassified 2027
193 Ga0207704_10143403 3300025938 Bacteria 1674
194 Ga0207704_10165704 3300025938 Bacteria 1578
195 Ga0207665_10006623 3300025939 Bacteria 7685
196 Ga0207665_10015897 3300025939 Bacteria 4941
197 Ga0207665_10024492 3300025939 Bacteria 3979
198 Ga0207689_10017789 3300025942 Bacteria 6006
199 Ga0207689_10033748 3300025942 Bacteria 4251
200 Ga0207689_10059801 3300025942 Bacteria 3134
201 Ga0207679_10121063 3300025945 Bacteria 2083
202 Ga0207712_10163458 3300025961 Bacteria 1733
203 Ga0207668_10207284 3300025972 Bacteria 1565
204 Ga0207640_10190830 3300025981 Bacteria 1544
205 Ga0207658_10112610 3300025986 Bacteria 2154
206 Ga0207677_10016470 3300026023 Bacteria 4381
207 Ga0207677_10119637 3300026023 Bacteria 1978
208 Ga0207639_10098142 3300026041 Bacteria 2360
209 Ga0207639_10208413 3300026041 Bacteria 1681
210 Ga0207678_10005119 3300026067 Bacteria 11759
211 Ga0207678_10105441 3300026067 Unclassified 2405
212 Ga0207708_10096462 3300026075 Bacteria 2285
213 Ga0207708_10149987 3300026075 Bacteria 1834
214 Ga0207641_10039260 3300026088 Bacteria 3959
215 Ga0207648_10008805 3300026089 Bacteria 9722
216 Ga0207648_10062339 3300026089 Bacteria 3250
217 Ga0207674_10063502 3300026116 Bacteria 3728
218 Ga0207675_100112496 3300026118 Bacteria 2570
219 Ga0207675_100205046 3300026118 Bacteria 1895
220 Ga0207675_100325337 3300026118 Bacteria 1502
221 Ga0207683_10018398 3300026121 Bacteria 5962
222 Ga0207683_10176561 3300026121 Bacteria 1936
223 Ga0207698_10182001 3300026142 Bacteria 1862
224 Ga0268266_10087924 3300028379 Bacteria 2720
225 Ga0268266_10226929 3300028379 Bacteria 1719
226 Ga0268265_10067939 3300028380 Bacteria 2761
227 Ga0268264_10166335 3300028381 Bacteria 1991
228 Ga0307406_10000101 3300031901 Bacteria 49370
229 Ga0307409_100140052 3300031995 Bacteria 2083
230 Ga0307415_100029662 3300032126 Bacteria 3499
231 Ga0373930_0006918 3300034816 Bacteria 1934
232 Ga0373926_0004607 3300035083 Bacteria 4525
233 Ga0373934_0003014 3300035086 Bacteria 6154
234 Ga0373944_0016496 3300035089 Bacteria 2084
235 Ga0373932_0004221 3300035112 Bacteria 3414
236 Ga0373936_0009724 3300035113 Bacteria 3627
237 Ga0373945_0016516 3300035116 Bacteria 2490
238 Ga0373953_0097055 3300035117 Bacteria 1237
239 Ga0373954_0088944 3300035118 Bacteria 1481
240 Ga0373956_0020901 3300035119 Bacteria 2790
241 Ga0373957_0003543 3300035120 Bacteria 4631
242 Ga0373943_0001529 3300035170 Bacteria 10470
243 Ga0373955_0001588 3300035172 Bacteria 9720
244 Ga0373942_0021658 3300035207 Bacteria 1624
245 Ga0316574_0110061 3300035398 Bacteria 1765
246 Ga0373924_0000085 3300035410 Bacteria 25341
247 Ga0373931_0072675 3300035691 Bacteria 1881
248 Ga0373927_0007572 3300035695 Bacteria 7348
249 Ga0373933_0003231 3300035724 Bacteria 9103
250 Ga0373947_0004578 3300035725 Bacteria 8112
251 Ga0373947_0094877 3300035725 Unclassified 1866
252 Ga0373937_0373189 3300036401 Unclassified 1352
253 Ga0373925_0007677 3300037068 Bacteria 7858
254 Ga0436361_0267822 3300039447 Bacteria 3076
255 Ga0466970_0027213 3300044765 Bacteria 2999
256 Ga0466960_0017615 3300044901 Bacteria 3118
257 Ga0495627_005060 3300046453 Bacteria 5389
258 Ga0495603_0007258 3300046455 Bacteria 6656
259 Ga0495653_0006255 3300046463 Bacteria 9769
260 Ga0495580_0013865 3300046472 Bacteria 6138
261 Ga0495582_0012944 3300046473 Bacteria 4596
262 Ga0495639_0017121 3300046475 Bacteria 3147
263 Ga0495664_0010231 3300046477 Bacteria 5262
264 Ga0495594_0007230 3300046499 Bacteria 5711
265 Ga0495606_0000578 3300046507 Bacteria 58225
266 Ga0495608_0163871 3300046511 Bacteria 1412
267 Ga0495618_0039227 3300046514 Bacteria 2977
268 Ga0495628_0022239 3300046516 Bacteria 5211
269 Ga0495630_0086203 3300046517 Bacteria 2371
270 Ga0495666_0035403 3300046526 Bacteria 2434
271 Ga0495652_0057386 3300046529 Bacteria 3301
272 Ga0495665_0008167 3300046531 Bacteria 5676
273 Ga0495640_0064644 3300046533 Bacteria 2472
274 Ga0495586_0013174 3300046535 Bacteria 4383
275 Ga0495586_0125699 3300046535 Bacteria 1434
276 Ga0495587_0148416 3300046536 Bacteria 1336
277 Ga0495645_0183681 3300046543 Bacteria 1430
278 Ga0495668_0002025 3300046616 Bacteria 17678
279 Ga0495625_0000749 3300046660 Bacteria 45382
280 Ga0495623_0041177 3300046679 Bacteria 2948
281 Ga0495646_0001369 3300046680 Bacteria 14434
282 Ga0495647_0010788 3300046681 Bacteria 3119
283 Ga0495658_0002174 3300046683 Bacteria 9917
284 Ga0495613_0008527 3300046689 Bacteria 7606
285 Ga0495624_0024908 3300046690 Bacteria 3936
286 Ga0495600_0005286 3300046809 Bacteria 7776
287 Ga0495604_0107484 3300047317 Bacteria 2039
288 Ga0495674_0012579 3300047319 Bacteria 7972
289 Ga0495674_0037261 3300047319 Bacteria 4369
290 Ga0495676_0003136 3300047321 Bacteria 14948
291 Ga0495680_0057692 3300047322 Bacteria 3001
292 Ga0495683_0042443 3300047323 Bacteria 2293
293 Ga0495684_0008285 3300047471 Bacteria 8049
294 Ga0495593_0005433 3300047673 Bacteria 7526
295 Ga0495614_0026344 3300048089 Bacteria 2505
296 Ga0495626_0000046 3300048091 Bacteria 162660
297 Ga0496100_0171043 3300048903 Bacteria 1565
298 Ga0496101_0188857 3300048904 Bacteria 1589
299 Ga0496102_0031731 3300048905 Bacteria 4742
300 Ga0496102_0215325 3300048905 Bacteria 1810
301 Ga0496102_0237822 3300048905 Bacteria 1717
302 Ga0496102_0460769 3300048905 Bacteria 1192
303 Ga0496103_0066410 3300048906 Bacteria 2251
304 Ga0496104_0050340 3300048907 Bacteria 3930
305 Ga0496105_0068520 3300048908 Bacteria 2931
306 Ga0496105_0109869 3300048908 Bacteria 2276
307 Ga0496105_0218489 3300048908 Bacteria 1552
308 Ga0496106_0072571 3300048909 Bacteria 2632
309 Ga0496106_0119314 3300048909 Bacteria 2060
310 Ga0496106_0333413 3300048909 Bacteria 1218
311 Ga0496107_0073401 3300048910 Bacteria 2488
312 Ga0496107_0121495 3300048910 Bacteria 1924
313 Ga0496108_0000807 3300048911 Bacteria 24310
314 Ga0496109_0001725 3300048912 Bacteria 18234
315 Ga0496110_0028552 3300048913 Bacteria 4793
316 Ga0496110_0063745 3300048913 Bacteria 3257
317 Ga0496111_0176183 3300048914 Bacteria 1589
318 Ga0496112_0300260 3300048915 Bacteria 1551
319 Ga0496113_0081271 3300048916 Bacteria 2483
320 Ga0496114_0058877 3300048917 Bacteria 3208
321 Ga0496114_0095144 3300048917 Bacteria 2534
322 Ga0496114_0098870 3300048917 Bacteria 2488
323 Ga0496115_0151645 3300048918 Bacteria 1914
324 Ga0496115_0212562 3300048918 Bacteria 1597
325 Ga0496117_0001098 3300048920 Bacteria 40887
326 Ga0496117_0010419 3300048920 Bacteria 8478
327 Ga0496117_0169949 3300048920 Bacteria 1266
328 Ga0496118_0052036 3300048921 Bacteria 3128
329 Ga0496122_0000756 3300048925 Bacteria 62664
330 Ga0496122_0125053 3300048925 Bacteria 1648
331 Ga0496123_0000172 3300048926 Bacteria 130598
332 Ga0496124_0001516 3300048927 Bacteria 33813
333 Ga0496125_0000640 3300048928 Bacteria 58381
334 Ga0496125_0023376 3300048928 Bacteria 5706
335 Ga0496125_0041918 3300048928 Bacteria 3907
336 Ga0496126_0001762 3300048929 Bacteria 32014
337 Ga0496126_0002423 3300048929 Bacteria 25250
338 Ga0496126_0038783 3300048929 Bacteria 4428
339 Ga0496126_0239578 3300048929 Bacteria 1516
340 Ga0501032_0067328 3300049569 Bacteria 2392
341 Ga0501033_0020843 3300049570 Bacteria 4949
342 Ga0501034_0108185 3300049571 Bacteria 2771
343 Ga0501034_0198298 3300049571 Bacteria 1966
344 Ga0501036_0098340 3300049572 Bacteria 2474
345 Ga0501038_0029962 3300049574 Bacteria 4818
346 Ga0501039_0173990 3300049575 Bacteria 1693
347 Ga0501047_0057724 3300049581 Bacteria 3753
348 Ga0501044_0034817 3300049823 Bacteria 5279
349 Ga0501044_0104649 3300049823 Bacteria 2844
350 Ga0495601_0024584 3300053077 Bacteria 3711
351 Ga0495612_0002609 3300053078 Bacteria 7437
352 Ga0500635_0000016 3300053080 Bacteria 124879
353 Ga0495595_0064010 3300053084 Bacteria 1727
354 Ga0495619_0006660 3300053085 Bacteria 7310
355 Ga0500556_0000467 3300053104 Bacteria 28516
356 Ga0500568_0001019 3300053139 Bacteria 19182
357 Ga0500616_0000113 3300053153 Bacteria 150722
358 Ga0500616_0000701 3300053153 Bacteria 38992
359 2643885780 2643221575 Bacteria 4022601
360 2555230350 2554235227 Bacteria 3637389
361 2588108555 2585428157 Bacteria 3018951
362 2643847645 2643221566 Bacteria 3460379
363 2643875651 2643221572 Bacteria 3614809
364 2644081213 2643221613 Bacteria 4622396
365 2644097759 2643221616 Bacteria 4066575
366 2644170876 2643221630 Bacteria 3601215
367 2644278537 2643221649 Bacteria 3867359
368 2644382706 2643221669 Bacteria 3611286
369 2655033945 2654587600 Bacteria 3911798
370 2747952859 2747842429 Bacteria 3914386
371 2852664589 2852663356 Bacteria 4090475
372 2857723835 2857723135 Bacteria 4217853
373 2857731464 2857729791 Bacteria 4040535
374 2884766987 2884763398 Bacteria 4091164
375 2910813653 2910809715 Bacteria 4982797
376 2932431818 2932431166 Bacteria 4215299
377 2935892248 2935890801 Bacteria 4593001
378 2939659555 2939657138 Bacteria 3740283
379 2945971183 2945968032 Bacteria 4111363
380 2946041752 2946041624 Bacteria 4191385
381 2995727483 2995726249 Bacteria 3470435
382 8001787047 8001781756 Bacteria 9586736
383 8004185869 8004182704 Bacteria 3391155
384 8045832015 8045830549 Bacteria 4444727
385 8055037811 8055034563 Bacteria 3562128
386 8055039095 8055037949 Bacteria 3337834
387 JGI24746J21847_1005286
388 JGI24743J22301_10004666
389 JGI25162J39368_1010040
390 JGI25154J39366_1001702
391 JGI25164J39214_1000658
392 JGI25165J46597_1000005
393 rootH2_10009998
394 JGI25404J52841_10007563
395 Ga0065714_10085576
396 Ga0070658_10221679
397 Ga0070683_100087079
398 Ga0070690_100107175
399 Ga0070690_100241154
400 Ga0068869_100026450
401 Ga0070680_100050860
402 Ga0070682_100073871
403 Ga0068868_100022734
404 Ga0068868_100130323
405 Ga0068868_100298189
406 Ga0070660_100242227
407 Ga0070689_100149788
408 Ga0070691_10059957
409 Ga0070661_100063836
410 Ga0070692_10138388
411 Ga0070692_10167341
412 Ga0070668_100126531
413 Ga0070668_100206927
414 Ga0070669_100079456
415 Ga0070675_100134071
416 Ga0070675_100206924
417 Ga0070675_100255111
418 Ga0070671_100349175
419 Ga0070673_100163093
420 Ga0070688_100042006
421 Ga0070688_100055596
422 Ga0070659_100096203
423 Ga0070659_100213959
424 Ga0070667_100096587
425 Ga0070667_100140476
426 Ga0070703_10067021
427 Ga0070713_100199344
428 Ga0070713_100298959
429 Ga0070710_10015183
430 Ga0070710_10039608
431 Ga0070710_10126102
432 Ga0070701_10043038
433 Ga0070711_100032631
434 Ga0070711_100114782
435 Ga0070711_100148659
436 Ga0070705_100083417
437 Ga0070705_100158867
438 Ga0070700_100099577
439 Ga0070700_100125277
440 Ga0070694_100034047
441 Ga0070663_100117596
442 Ga0070678_100098817
443 Ga0070662_100125865
444 Ga0070662_100159251
445 Ga0070681_10029252
446 Ga0068867_100045964
447 Ga0068867_100125338
448 Ga0070685_10033414
449 Ga0070685_10135226
450 Ga0070679_100093474
451 Ga0070684_100168737
452 Ga0068853_100202073
453 Ga0070672_100207283
454 Ga0070695_100097252
455 Ga0070695_100120574
456 Ga0070696_100055483
457 Ga0070696_100120367
458 Ga0070693_100046755
459 Ga0070665_100233042
460 Ga0070665_100271296
461 Ga0070704_100170964
462 Ga0070704_100182336
463 Ga0068855_100444792
464 Ga0068857_100123414
465 Ga0068854_100040993
466 Ga0068854_100050498
467 Ga0068854_100119021
468 Ga0070702_100075833
469 Ga0070702_100080872
470 Ga0070702_100117475
471 Ga0068852_100095944
472 Ga0068852_100158070
473 Ga0068859_100080312
474 Ga0068859_100254272
475 Ga0068859_100341121
476 Ga0068864_100040667
477 Ga0068864_100317991
478 Ga0068866_10211500
479 Ga0068861_100094200
480 Ga0068861_100155360
481 Ga0068858_100048638
482 Ga0068858_100158381
483 Ga0068860_100274397
484 Ga0068862_100178207
485 Ga0081540_1000487
486 Ga0070715_10045678
487 Ga0070712_100008907
488 Ga0070712_100082332
489 Ga0097621_100173297
490 Ga0097621_100268666
491 Ga0097621_100321160
492 Ga0068865_100095574
493 Ga0068865_100331807
494 Ga0097620_100080313
495 Ga0097620_100254257
496 Ga0097620_100341102
497 Ga0105250_10099639
498 Ga0105240_10217540
499 Ga0105245_10181973
500 Ga0105245_10275730
501 Ga0105247_10018001
502 Ga0105247_10052379
503 Ga0105243_10084012
504 Ga0105243_10144098
505 Ga0105243_10333373
506 Ga0105241_10193966
507 Ga0105242_10064335
508 Ga0105248_10198007
509 Ga0105248_10233434
510 Ga0105237_10213346
511 Ga0105237_10257924
512 Ga0105238_10213018
513 Ga0105238_10294212
514 Ga0105249_10175114
515 Ga0105249_10178639
516 Ga0105239_10109875
517 Ga0105239_10201243
518 Ga0105246_10018882
519 Ga0105246_10104814
520 Ga0157347_1001950
521 Ga0157371_10077558
522 Ga0157374_10048525
523 Ga0157374_10247045
524 Ga0157374_10456670
525 Ga0157378_10041895
526 Ga0157378_10228340
527 Ga0163162_10122037
528 Ga0163162_10140522
529 Ga0163162_10373796
530 Ga0157372_10261161
531 Ga0157375_10349381
532 Ga0163163_10069068
533 Ga0163163_10106087
534 Ga0163163_10243057
535 Ga0157380_10242963
536 Ga0157377_10084238
537 Ga0157377_10213310
538 Ga0157379_10440961
539 Ga0157376_10172401
540 Ga0157376_10398820
541 Ga0163161_10062105
542 Ga0163161_10095724
543 Ga0207427_100028
544 Ga0209437_100211
545 Ga0209646_1000092
546 Ga0209233_1000001
547 Ga0207653_10034423
548 Ga0207692_10065631
549 Ga0207692_10146647
550 Ga0207642_10051558
551 Ga0207710_10049682
552 Ga0207688_10044556
553 Ga0207688_10062356
554 Ga0207680_10326212
555 Ga0207685_10063128
556 Ga0207685_10132226
557 Ga0207654_10165074
558 Ga0207671_10118125
559 Ga0207693_10007872
560 Ga0207693_10084211
561 Ga0207663_10110748
562 Ga0207663_10115296
563 Ga0207662_10035700
564 Ga0207657_10208055
565 Ga0207649_10067195
566 Ga0207681_10041212
567 Ga0207687_10207295
568 Ga0207700_10065189
569 Ga0207664_10022253
570 Ga0207644_10163005
571 Ga0207690_10091063
572 Ga0207706_10031088
573 Ga0207706_10064247
574 Ga0207706_10065881
575 Ga0207686_10078525
576 Ga0207709_10188111
577 Ga0207669_10064164
578 Ga0207704_10088372
579 Ga0207704_10143403
580 Ga0207704_10165704
581 Ga0207665_10006623
582 Ga0207665_10015897
583 Ga0207665_10024492
584 Ga0207689_10017789
585 Ga0207689_10033748
586 Ga0207689_10059801
587 Ga0207679_10121063
588 Ga0207712_10163458
589 Ga0207668_10207284
590 Ga0207640_10190830
591 Ga0207658_10112610
592 Ga0207677_10016470
593 Ga0207677_10119637
594 Ga0207639_10098142
595 Ga0207639_10208413
596 Ga0207678_10005119
597 Ga0207678_10105441
598 Ga0207708_10096462
599 Ga0207708_10149987
600 Ga0207641_10039260
601 Ga0207648_10008805
602 Ga0207648_10062339
603 Ga0207674_10063502
604 Ga0207675_100112496
605 Ga0207675_100205046
606 Ga0207675_100325337
607 Ga0207683_10018398
608 Ga0207683_10176561
609 Ga0207698_10182001
610 Ga0268266_10087924
611 Ga0268266_10226929
612 Ga0268265_10067939
613 Ga0268264_10166335
614 Ga0307406_10000101
615 Ga0307409_100140052
616 Ga0307415_100029662
617 Ga0373930_0006918
618 Ga0373926_0004607
619 Ga0373934_0003014
620 Ga0373944_0016496
621 Ga0373932_0004221
622 Ga0373936_0009724
623 Ga0373945_0016516
624 Ga0373953_0097055
625 Ga0373954_0088944
626 Ga0373956_0020901
627 Ga0373957_0003543
628 Ga0373943_0001529
629 Ga0373955_0001588
630 Ga0373942_0021658
631 Ga0316574_0110061
632 Ga0373924_0000085
633 Ga0373931_0072675
634 Ga0373927_0007572
635 Ga0373933_0003231
636 Ga0373947_0004578
637 Ga0373947_0094877
638 Ga0373937_0373189
639 Ga0373925_0007677
640 Ga0436361_0267822
641 Ga0466970_0027213
642 Ga0466960_0017615
643 Ga0495627_005060
644 Ga0495603_0007258
645 Ga0495653_0006255
646 Ga0495580_0013865
647 Ga0495582_0012944
648 Ga0495639_0017121
649 Ga0495664_0010231
650 Ga0495594_0007230
651 Ga0495606_0000578
652 Ga0495608_0163871
653 Ga0495618_0039227
654 Ga0495628_0022239
655 Ga0495630_0086203
656 Ga0495666_0035403
657 Ga0495652_0057386
658 Ga0495665_0008167
659 Ga0495640_0064644
660 Ga0495586_0013174
661 Ga0495586_0125699
662 Ga0495587_0148416
663 Ga0495645_0183681
664 Ga0495668_0002025
665 Ga0495625_0000749
666 Ga0495623_0041177
667 Ga0495646_0001369
668 Ga0495647_0010788
669 Ga0495658_0002174
670 Ga0495613_0008527
671 Ga0495624_0024908
672 Ga0495600_0005286
673 Ga0495604_0107484
674 Ga0495674_0012579
675 Ga0495674_0037261
676 Ga0495676_0003136
677 Ga0495680_0057692
678 Ga0495683_0042443
679 Ga0495684_0008285
680 Ga0495593_0005433
681 Ga0495614_0026344
682 Ga0495626_0000046
683 Ga0496100_0171043
684 Ga0496101_0188857
685 Ga0496102_0031731
686 Ga0496102_0215325
687 Ga0496102_0237822
688 Ga0496102_0460769
689 Ga0496103_0066410
690 Ga0496104_0050340
691 Ga0496105_0068520
692 Ga0496105_0109869
693 Ga0496105_0218489
694 Ga0496106_0072571
695 Ga0496106_0119314
696 Ga0496106_0333413
697 Ga0496107_0073401
698 Ga0496107_0121495
699 Ga0496108_0000807
700 Ga0496109_0001725
701 Ga0496110_0028552
702 Ga0496110_0063745
703 Ga0496111_0176183
704 Ga0496112_0300260
705 Ga0496113_0081271
706 Ga0496114_0058877
707 Ga0496114_0095144
708 Ga0496114_0098870
709 Ga0496115_0151645
710 Ga0496115_0212562
711 Ga0496117_0001098
712 Ga0496117_0010419
713 Ga0496117_0169949
714 Ga0496118_0052036
715 Ga0496122_0000756
716 Ga0496122_0125053
717 Ga0496123_0000172
718 Ga0496124_0001516
719 Ga0496125_0000640
720 Ga0496125_0023376
721 Ga0496125_0041918
722 Ga0496126_0001762
723 Ga0496126_0002423
724 Ga0496126_0038783
725 Ga0496126_0239578
726 Ga0501032_0067328
727 Ga0501033_0020843
728 Ga0501034_0108185
729 Ga0501034_0198298
730 Ga0501036_0098340
731 Ga0501038_0029962
732 Ga0501039_0173990
733 Ga0501047_0057724
734 Ga0501044_0034817
735 Ga0501044_0104649
736 Ga0495601_0024584
737 Ga0495612_0002609
738 Ga0500635_0000016
739 Ga0495595_0064010
740 Ga0495619_0006660
741 Ga0500556_0000467
742 Ga0500568_0001019
743 Ga0500616_0000113
744 Ga0500616_0000701
745 2643885780
746 2555230350
747 2588108555
748 2643847645
749 2643875651
750 2644081213
751 2644097759
752 2644170876
753 2644278537
754 2644382706
755 2655033945
756 2747952859
757 2852664589
758 2857723835
759 2857731464
760 2884766987
761 2910813653
762 2932431818
763 2935892248
764 2939659555
765 2945971183
766 2946041752
767 2995727483
768 8001787047
769 8004185869
770 8045832015
771 8055037811
772 8055039095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04960

Glutaminase

Glutaminase

85

369

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u60-assembly1.cif.gz_A mcsg apc5046 probable glutaminase ybas 0.9709 16 325
1u60-assembly1.cif.gz_A mcsg apc5046 probable glutaminase ybas 0.9679 16 325
8ec6-assembly1.cif.gz_E cryo-em structure of the glutaminase c core filament (fgac) 0.9435 16 313
5jyo-assembly1.cif.gz_D allosteric inhibition of kidney isoform of glutaminase 0.9413 16 324
5jyp-assembly1.cif.gz_A allosteric inhibition of kidney isoform of glutaminase 0.9413 16 324
ID Description Score Start End Superfamily
1u60D00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9706 16 325 3.40.710.10
1u60D00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9675 16 325 3.40.710.10
af_F1RDU2_183_512_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9467 16 328 3.40.710.10
af_P0A6W0_5_308_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.939 22 323 3.40.710.10
1mkiB02 Mainly Alpha;Orthogonal Bundle;Probable Glutaminase Ybgj; Chain: A, domain 2; 0.9356 82 212 1.10.1500.10
ID Description Score Start End GO Terms
AF-A0A4R6S253-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9821 2 333 GO:0004359
GO:0006537
GO:0006543
AF-A0A6G0ABF4-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9811 17 255 GO:0004359
GO:0006537
GO:0006543
AF-A0A1P8NIL4-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9808 2 331 GO:0004359
GO:0006537
GO:0006543
AF-A0A653XA51-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9788 8 328 GO:0004359
GO:0006537
GO:0006543
AF-A0A3N5KTY6-F1-model_v4 Glutaminase (EC 3.5.1.2) 0.9759 16 323 GO:0004359
GO:0006537
GO:0006543

Map