F430548

General Info

Members Datasets Scaffolds Average Seq Length
386 241 772 252

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10046533|Ga0307513_100465333
Length 277
Sequence MKHPKKMLRFAPHFPGDPATRLLTRLALWLALPLVLFVFWWLATANSENFYVPPLRDILSTFPEVWTWDRLRADVLPSLIRLAVGYTIAVFAGISLGVLVGSNRWVRAVLEPVLEFFRAIPPPVLVPVIMLFAGIGDTMKVVVIAVGCVWPILLNTVEGVRAVDGVLADTCRSYGITGSSRLGHLVLRSASPQIAAGMRQALSIGIILMVISEMFAASNGLGFAIVQFQRSFAIPDMWSGILLLGLLGLALSVLFRLVESWALAWYHGQRRAQRGPS

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
26 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
48 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
49 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
50 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
51 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
55 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
56 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
57 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
58 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
59 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
60 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
64 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
65 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
66 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
67 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
68 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
69 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
70 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
71 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
72 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
171 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
179 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
182 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
183 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
186 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
189 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
190 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
191 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
194 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
195 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
196 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
199 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
200 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
201 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
202 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
203 2643221647 Streptomyces sp. Root369 Isolate Unclassified
204 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
205 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
206 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
207 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
208 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
209 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
210 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
211 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
212 2808606448 Streptomyces sp. 193411 Isolate Unclassified
213 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
214 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
215 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
216 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
217 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
218 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
219 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
220 2867428634 Streptomyces sp. RP5T Isolate Unclassified
221 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
222 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
223 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
224 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
225 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
226 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
227 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
228 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
229 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
230 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
231 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
232 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
233 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
234 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
235 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
236 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
237 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
238 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
239 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
240 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
241 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.82
Metatranscriptomes 0.52
Isolates 11.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.92
Nodule 0.52
Rhizoplane 1.04
Rhizosphere 61.92
Stem 0
Stem Tuber 0.26
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10046533 3300031456 Bacteria 4728
2 JGI25406J46586_10003116 3300003203 Bacteria 7793
3 rootH1_10078521 3300003323 Bacteria 3816
4 Ga0006562J51391_1057538 3300003578 Bacteria 3430
5 Ga0006562J51391_1152031 3300003578 Bacteria 1103
6 Ga0070668_100001214 3300005347 Bacteria 18317
7 Ga0070668_100050775 3300005347 Bacteria 3194
8 Ga0068853_100130159 3300005539 Bacteria 2252
9 Ga0068855_100408623 3300005563 Bacteria 1487
10 Ga0068854_100534467 3300005578 Bacteria 992
11 Ga0068854_100680348 3300005578 Bacteria 886
12 Ga0068870_10266074 3300005840 Bacteria 1069
13 Ga0081455_10049039 3300005937 Bacteria 3643
14 Ga0081539_10000420 3300005985 Bacteria 90166
15 Ga0075365_10089289 3300006038 Bacteria 2098
16 Ga0075365_10117385 3300006038 Bacteria 1833
17 Ga0075365_10441292 3300006038 Bacteria 919
18 Ga0075368_10005276 3300006042 Bacteria 4435
19 Ga0075363_100013243 3300006048 Bacteria 3992
20 Ga0075363_100151803 3300006048 Bacteria 1308
21 Ga0075367_10000070 3300006178 Bacteria 25863
22 Ga0075367_10001013 3300006178 Bacteria 11552
23 Ga0075370_10065402 3300006353 Bacteria 2074
24 Ga0075428_100001025 3300006844 Bacteria 29580
25 Ga0075430_100062717 3300006846 Bacteria 3121
26 Ga0075431_100250227 3300006847 Bacteria 1801
27 Ga0075429_100255567 3300006880 Bacteria 1534
28 Ga0114129_10776062 3300009147 Bacteria 1225
29 Ga0105246_10064062 3300011119 Bacteria 2567
30 Ga0182008_10003129 3300014497 Bacteria 10119
31 Ga0182007_10002031 3300015262 Bacteria 10406
32 Ga0183367_1001 3300015688 Bacteria 1225545
33 Ga0207687_10480928 3300025927 Bacteria 1034
34 Ga0207668_10024688 3300025972 Bacteria 3882
35 Ga0207668_10393678 3300025972 Bacteria 1169
36 Ga0207640_10569085 3300025981 Bacteria 955
37 Ga0209371_1017942 3300027312 Bacteria 1815
38 Ga0268265_10033961 3300028380 Bacteria 3714
39 Ga0307517_10032028 3300028786 Bacteria 6095
40 Ga0307517_10036002 3300028786 Bacteria 5582
41 Ga0307517_10036198 3300028786 Bacteria 5559
42 Ga0307517_10147154 3300028786 Bacteria 1630
43 Ga0307515_10000441 3300028794 Bacteria 99819
44 Ga0307515_10004188 3300028794 Bacteria 30009
45 Ga0307515_10009025 3300028794 Bacteria 19354
46 Ga0307515_10009142 3300028794 Bacteria 19211
47 Ga0307515_10024321 3300028794 Bacteria 10561
48 Ga0307515_10034349 3300028794 Bacteria 8307
49 Ga0307515_10036333 3300028794 Bacteria 7973
50 Ga0307515_10054535 3300028794 Bacteria 5866
51 Ga0307515_10055209 3300028794 Bacteria 5811
52 Ga0307515_10069758 3300028794 Bacteria 4796
53 Ga0307511_10000078 3300030521 Bacteria 81896
54 Ga0307511_10003617 3300030521 Bacteria 15831
55 Ga0307511_10059637 3300030521 Bacteria 2932
56 Ga0307511_10098632 3300030521 Bacteria 1933
57 Ga0307512_10007424 3300030522 Bacteria 10881
58 Ga0307512_10009925 3300030522 Bacteria 9130
59 Ga0307512_10016644 3300030522 Bacteria 6779
60 Ga0307512_10075210 3300030522 Bacteria 2472
61 Ga0316176_1054763 3300030732 Bacteria 1423
62 Ga0307513_10006446 3300031456 Bacteria 15334
63 Ga0307513_10010869 3300031456 Bacteria 11370
64 Ga0307513_10015623 3300031456 Bacteria 9190
65 Ga0307513_10022771 3300031456 Bacteria 7352
66 Ga0307513_10099078 3300031456 Bacteria 2944
67 Ga0307513_10119639 3300031456 Bacteria 2605
68 Ga0307513_10144765 3300031456 Bacteria 2296
69 Ga0307513_10286039 3300031456 Bacteria 1423
70 Ga0307509_10010252 3300031507 Bacteria 11521
71 Ga0307509_10025362 3300031507 Bacteria 6621
72 Ga0307509_10066860 3300031507 Bacteria 3769
73 Ga0307509_10096380 3300031507 Bacteria 3010
74 Ga0307508_10002224 3300031616 Bacteria 20663
75 Ga0307508_10012136 3300031616 Bacteria 7878
76 Ga0307508_10040146 3300031616 Bacteria 4202
77 Ga0307508_10074235 3300031616 Bacteria 2977
78 Ga0307508_10115810 3300031616 Bacteria 2282
79 Ga0307508_10206862 3300031616 Bacteria 1563
80 Ga0307514_10003178 3300031649 Bacteria 16050
81 Ga0307514_10054613 3300031649 Bacteria 3076
82 Ga0307514_10075814 3300031649 Bacteria 2506
83 Ga0307516_10003173 3300031730 Bacteria 21387
84 Ga0307516_10003260 3300031730 Bacteria 21043
85 Ga0307516_10013898 3300031730 Bacteria 8544
86 Ga0307516_10015617 3300031730 Bacteria 7982
87 Ga0307516_10041962 3300031730 Bacteria 4542
88 Ga0307516_10057602 3300031730 Bacteria 3784
89 Ga0307516_10113044 3300031730 Bacteria 2514
90 Ga0307516_10142105 3300031730 Bacteria 2168
91 Ga0307518_10112563 3300031838 Bacteria 1937
92 Ga0307410_10231493 3300031852 Bacteria 1427
93 Ga0307410_10233679 3300031852 Bacteria 1421
94 Ga0307406_10030467 3300031901 Bacteria 3277
95 Ga0307406_10230492 3300031901 Bacteria 1383
96 Ga0307406_10299269 3300031901 Bacteria 1235
97 Ga0307407_10252858 3300031903 Bacteria 1208
98 Ga0307409_100366368 3300031995 Bacteria 1365
99 Ga0307409_100554458 3300031995 Bacteria 1129
100 Ga0307416_100141515 3300032002 Bacteria 2187
101 Ga0307416_100680271 3300032002 Bacteria 1116
102 Ga0307415_100258290 3300032126 Bacteria 1420
103 Ga0307415_100467334 3300032126 Bacteria 1095
104 Ga0307507_10000498 3300033179 Bacteria 82993
105 Ga0307507_10023205 3300033179 Bacteria 6818
106 Ga0307507_10041105 3300033179 Bacteria 4633
107 Ga0307507_10045437 3300033179 Bacteria 4320
108 Ga0307507_10072289 3300033179 Bacteria 3110
109 Ga0307510_10006665 3300033180 Bacteria 13778
110 Ga0307510_10048757 3300033180 Bacteria 4515
111 Ga0307510_10050447 3300033180 Bacteria 4414
112 Ga0307510_10069273 3300033180 Bacteria 3535
113 Ga0307510_10087821 3300033180 Bacteria 2972
114 Ga0373934_0053981 3300035086 Bacteria 1595
115 Ga0373953_0174542 3300035117 Bacteria 926
116 Ga0373955_0093015 3300035172 Bacteria 1721
117 Ga0373937_0000565 3300036401 Bacteria 32865
118 Ga0395898_0474755 3300037466 Bacteria 1190
119 Ga0451795_0908031 3300041456 Bacteria 1342
120 Ga0451800_0296048 3300041459 Bacteria 1236
121 Ga0451802_1935095 3300041460 Bacteria 1841
122 Ga0451833_1412585 3300041491 Bacteria 1212
123 Ga0451837_0219619 3300041494 Bacteria 1166
124 Ga0451841_0369202 3300041498 Bacteria 1007
125 Ga0451841_1015579 3300041498 Bacteria 1339
126 Ga0451843_0020547 3300041509 Bacteria 1566
127 Ga0451853_1049431 3300041512 Bacteria 4810
128 Ga0451853_1321921 3300041512 Bacteria 10037
129 Ga0439449_0010854 3300042007 Bacteria 3437
130 Ga0439455_0014743 3300042012 Bacteria 1788
131 Ga0439457_001855 3300042014 Bacteria 6236
132 Ga0439457_022168 3300042014 Bacteria 1406
133 Ga0450890_006528 3300042127 Bacteria 1491
134 Ga0450894_000677 3300042131 Bacteria 5690
135 Ga0450896_001070 3300042133 Bacteria 3226
136 Ga0450898_005199 3300042134 Bacteria 1955
137 Ga0450899_001491 3300042135 Bacteria 2617
138 Ga0450903_000253 3300042138 Bacteria 11811
139 Ga0450906_000888 3300042145 Bacteria 6537
140 Ga0439458_0001694 3300042157 Bacteria 5505
141 Ga0466972_0072233 3300044658 Bacteria 1646
142 Ga0466966_0079362 3300044684 Bacteria 2046
143 Ga0466961_0078779 3300044693 Bacteria 2087
144 Ga0466957_0021137 3300044842 Bacteria 3833
145 Ga0466957_0111032 3300044842 Bacteria 1738
146 Ga0466960_0130124 3300044901 Bacteria 1327
147 Ga0466967_0047748 3300045976 Bacteria 3734
148 Ga0495617_049107 3300046452 Bacteria 1404
149 Ga0495627_020167 3300046453 Bacteria 2225
150 Ga0495592_0005513 3300046454 Bacteria 9357
151 Ga0495592_0007404 3300046454 Bacteria 8217
152 Ga0495603_0002970 3300046455 Bacteria 10027
153 Ga0495603_0003705 3300046455 Bacteria 9098
154 Ga0495629_0014353 3300046459 Bacteria 5698
155 Ga0495629_0028194 3300046459 Bacteria 3986
156 Ga0495629_0136951 3300046459 Bacteria 1704
157 Ga0495629_0349071 3300046459 Bacteria 1009
158 Ga0495638_0014154 3300046460 Bacteria 5401
159 Ga0495638_0129300 3300046460 Bacteria 1485
160 Ga0495651_0001536 3300046462 Bacteria 17839
161 Ga0495651_0014030 3300046462 Bacteria 6197
162 Ga0495653_0221940 3300046463 Bacteria 1270
163 Ga0495580_0031921 3300046472 Bacteria 3803
164 Ga0495582_0013281 3300046473 Bacteria 4534
165 Ga0495639_0006002 3300046475 Bacteria 5223
166 Ga0495662_0000340 3300046476 Bacteria 20432
167 Ga0495662_0000920 3300046476 Bacteria 14414
168 Ga0495662_0047839 3300046476 Bacteria 2064
169 Ga0495664_0002668 3300046477 Bacteria 9609
170 Ga0495664_0004187 3300046477 Bacteria 7880
171 Ga0495584_0203851 3300046491 Bacteria 1005
172 Ga0495585_0054337 3300046492 Bacteria 2214
173 Ga0495594_0007399 3300046499 Bacteria 5650
174 Ga0495594_0053445 3300046499 Bacteria 2225
175 Ga0495607_0047490 3300046501 Bacteria 2515
176 Ga0495606_0009298 3300046507 Bacteria 8334
177 Ga0495610_0157958 3300046512 Bacteria 961
178 Ga0495620_0035236 3300046515 Bacteria 2252
179 Ga0495620_0049270 3300046515 Bacteria 1803
180 Ga0495628_0051946 3300046516 Bacteria 3239
181 Ga0495631_0065036 3300046518 Bacteria 1578
182 Ga0495632_0021446 3300046519 Bacteria 3481
183 Ga0495632_0068284 3300046519 Bacteria 1713
184 Ga0495643_0003447 3300046522 Bacteria 11567
185 Ga0495643_0040447 3300046522 Bacteria 2547
186 Ga0495666_0048739 3300046526 Bacteria 2039
187 Ga0495652_0022647 3300046529 Bacteria 5574
188 Ga0495640_0037149 3300046533 Bacteria 3438
189 Ga0495640_0130247 3300046533 Bacteria 1628
190 Ga0495586_0067111 3300046535 Bacteria 1956
191 Ga0495586_0189919 3300046535 Bacteria 1163
192 Ga0495587_0001314 3300046536 Bacteria 16508
193 Ga0495587_0010746 3300046536 Bacteria 5812
194 Ga0495609_0082374 3300046538 Bacteria 1405
195 Ga0495597_0104685 3300046542 Bacteria 1190
196 Ga0495645_0020908 3300046543 Bacteria 4729
197 Ga0495645_0024367 3300046543 Bacteria 4390
198 Ga0495622_0030580 3300046557 Bacteria 2516
199 Ga0495622_0159529 3300046557 Bacteria 1017
200 Ga0495634_0001180 3300046642 Bacteria 24199
201 Ga0495634_0009864 3300046642 Bacteria 7025
202 Ga0495625_0033440 3300046660 Bacteria 3802
203 Ga0495625_0083593 3300046660 Bacteria 2219
204 Ga0495635_0005290 3300046663 Bacteria 8978
205 Ga0495635_0013055 3300046663 Bacteria 5816
206 Ga0495635_0291366 3300046663 Bacteria 1095
207 Ga0495661_0073006 3300046665 Bacteria 2000
208 Ga0495588_0006190 3300046674 Bacteria 5376
209 Ga0495588_0018163 3300046674 Bacteria 3425
210 Ga0495588_0020914 3300046674 Bacteria 3219
211 Ga0495588_0122903 3300046674 Bacteria 1368
212 Ga0495657_0002749 3300046675 Bacteria 14671
213 Ga0495657_0013325 3300046675 Bacteria 6072
214 Ga0495657_0049006 3300046675 Bacteria 2847
215 Ga0495623_0090340 3300046679 Bacteria 1881
216 Ga0495623_0170222 3300046679 Bacteria 1273
217 Ga0495646_0000209 3300046680 Bacteria 28984
218 Ga0495646_0005170 3300046680 Bacteria 8231
219 Ga0495658_0008051 3300046683 Bacteria 5219
220 Ga0495613_0001493 3300046689 Bacteria 17818
221 Ga0495613_0002386 3300046689 Bacteria 14226
222 Ga0495613_0002939 3300046689 Bacteria 12758
223 Ga0495613_0013127 3300046689 Bacteria 6154
224 Ga0495613_0017134 3300046689 Bacteria 5394
225 Ga0495670_0012888 3300046691 Bacteria 4109
226 Ga0495670_0121420 3300046691 Bacteria 1357
227 Ga0495671_0004656 3300046692 Bacteria 8126
228 Ga0495671_0049595 3300046692 Bacteria 2092
229 Ga0495671_0126912 3300046692 Bacteria 1244
230 Ga0495649_0120222 3300046694 Bacteria 1389
231 Ga0495589_0017311 3300046794 Bacteria 3699
232 Ga0495589_0032176 3300046794 Bacteria 2638
233 Ga0495600_0012419 3300046809 Bacteria 5325
234 Ga0495600_0037674 3300046809 Bacteria 3145
235 Ga0495600_0053938 3300046809 Bacteria 2625
236 Ga0495660_0030811 3300046810 Bacteria 3020
237 Ga0495581_0003700 3300047315 Bacteria 8807
238 Ga0495581_0003850 3300047315 Bacteria 8633
239 Ga0495581_0141827 3300047315 Bacteria 1402
240 Ga0495604_0006801 3300047317 Bacteria 9065
241 Ga0495604_0009015 3300047317 Bacteria 7891
242 Ga0495604_0170191 3300047317 Bacteria 1533
243 Ga0495636_0002681 3300047318 Bacteria 6873
244 Ga0495636_0006582 3300047318 Bacteria 4568
245 Ga0495672_0021587 3300047320 Bacteria 4198
246 Ga0495676_0015259 3300047321 Bacteria 6846
247 Ga0495676_0016034 3300047321 Bacteria 6654
248 Ga0495676_0075458 3300047321 Bacteria 2578
249 Ga0495683_0113395 3300047323 Bacteria 1292
250 Ga0495687_001186 3300047443 Bacteria 25042
251 Ga0495687_001678 3300047443 Bacteria 19766
252 Ga0495687_016151 3300047443 Bacteria 3764
253 Ga0495687_029296 3300047443 Bacteria 2550
254 Ga0495687_030491 3300047443 Bacteria 2482
255 Ga0495687_124781 3300047443 Bacteria 922
256 Ga0495675_0096981 3300047444 Bacteria 1848
257 Ga0495685_003040 3300047447 Bacteria 5315
258 Ga0495685_012587 3300047447 Bacteria 2866
259 Ga0495685_027937 3300047447 Bacteria 1940
260 Ga0495681_0002340 3300047470 Bacteria 13618
261 Ga0495681_0015822 3300047470 Bacteria 4256
262 Ga0495681_0080365 3300047470 Bacteria 1456
263 Ga0495684_0185409 3300047471 Bacteria 1541
264 Ga0495684_0214654 3300047471 Bacteria 1413
265 Ga0495686_0024560 3300047472 Bacteria 3958
266 Ga0495686_0055554 3300047472 Bacteria 2475
267 Ga0495686_0071508 3300047472 Bacteria 2135
268 Ga0495593_0000662 3300047673 Bacteria 19850
269 Ga0495593_0002309 3300047673 Bacteria 11440
270 Ga0495614_0005297 3300048089 Bacteria 5819
271 Ga0495614_0034686 3300048089 Bacteria 2168
272 Ga0496109_0027914 3300048912 Bacteria 5045
273 Ga0496126_0422724 3300048929 Bacteria 1077
274 Ga0495678_055149 3300049459 Bacteria 1518
275 Ga0495678_092138 3300049459 Bacteria 1065
276 Ga0501031_0090539 3300049568 Bacteria 1995
277 Ga0501032_0015503 3300049569 Bacteria 5374
278 Ga0501033_0034979 3300049570 Bacteria 3765
279 Ga0501034_0065239 3300049571 Bacteria 3653
280 Ga0501036_0133490 3300049572 Bacteria 2095
281 Ga0501037_0049540 3300049573 Bacteria 3075
282 Ga0501038_0065360 3300049574 Bacteria 3099
283 Ga0501042_0208706 3300049578 Bacteria 1408
284 Ga0501043_0010933 3300049579 Bacteria 7110
285 Ga0501043_0028537 3300049579 Bacteria 4381
286 Ga0501046_0006238 3300049580 Bacteria 10582
287 Ga0501047_0050250 3300049581 Bacteria 4026
288 Ga0501047_0097729 3300049581 Bacteria 2814
289 Ga0501048_0011121 3300049582 Bacteria 6710
290 Ga0501048_0092328 3300049582 Bacteria 2135
291 Ga0501070_0060840 3300049586 Bacteria 3130
292 Ga0501070_0392115 3300049586 Bacteria 1124
293 Ga0501074_0205434 3300049590 Bacteria 1404
294 Ga0501035_0022206 3300049822 Bacteria 5829
295 Ga0501044_0012264 3300049823 Bacteria 9277
296 Ga0501044_0036859 3300049823 Bacteria 5114
297 Ga0501044_0294518 3300049823 Bacteria 1553
298 Ga0501045_0141956 3300049824 Bacteria 1786
299 nmdc:mga03n38_12418_c1 3300050490 Bacteria 3204
300 nmdc:mga03n38_61791_c1 3300050490 Bacteria 1707
301 nmdc:mga0yw44_354354_c1 3300050492 Bacteria 988
302 nmdc:mga06z11_1567_c1 3300050494 Bacteria 8505
303 nmdc:mga06z11_4243_c1 3300050494 Bacteria 5621
304 nmdc:mga04h51_23719_c1 3300050495 Bacteria 1871
305 nmdc:mga07m45_153433_c1 3300050496 Bacteria 1336
306 nmdc:mga07m45_95177_c1 3300050496 Bacteria 1708
307 nmdc:mga05p37_619215_c1 3300050507 Bacteria 1218
308 nmdc:mga0qj67_109690_c1 3300050509 Bacteria 2227
309 nmdc:mga06r32_4464_c1 3300050510 Bacteria 12530
310 Ga0500610_0049874 3300053079 Bacteria 2178
311 Ga0495655_0038968 3300053083 Bacteria 1202
312 Ga0495619_0066685 3300053085 Bacteria 2402
313 Ga0500578_0023355 3300053086 Bacteria 3970
314 Ga0500644_0010140 3300053088 Bacteria 2542
315 Ga0500566_0058459 3300053094 Bacteria 2189
316 Ga0500640_002872 3300053095 Bacteria 5838
317 Ga0500641_0007103 3300053096 Bacteria 3986
318 Ga0500654_045469 3300053099 Bacteria 2432
319 Ga0500660_054004 3300053100 Bacteria 1972
320 Ga0500556_0031650 3300053104 Bacteria 1802
321 Ga0500560_004406 3300053107 Bacteria 2990
322 Ga0500560_019147 3300053107 Bacteria 1921
323 Ga0500569_034120 3300053109 Bacteria 1450
324 Ga0500569_098637 3300053109 Bacteria 955
325 Ga0500572_016325 3300053111 Bacteria 1889
326 Ga0500594_0063137 3300053118 Bacteria 1072
327 Ga0500614_008553 3300053123 Bacteria 2171
328 Ga0500628_027037 3300053129 Bacteria 1214
329 Ga0500652_052997 3300053131 Bacteria 1659
330 Ga0500561_0000533 3300053137 Bacteria 6151
331 Ga0500573_0021607 3300053140 Bacteria 3690
332 Ga0500579_047418 3300053143 Bacteria 2652
333 Ga0500600_0025440 3300053149 Bacteria 3519
334 Ga0500600_0096581 3300053149 Bacteria 1567
335 Ga0500616_0001294 3300053153 Bacteria 24859
336 Ga0500616_0008545 3300053153 Bacteria 6345
337 Ga0500624_012776 3300053157 Bacteria 1246
338 Ga0500633_0087145 3300053160 Bacteria 1136
339 Ga0500634_0010335 3300053161 Bacteria 4765
340 Ga0500587_001908 3300053739 Bacteria 2973
341 Ga0530510_0058763 3300061734 Bacteria 2781
342 2585303962 2582581313 Bacteria 10042643
343 2585311919 2582581314 Bacteria 11452267
344 2616699071 2616644814 Bacteria 11555299
345 2623500962 2622736605 Bacteria 4992138
346 2623589744 2622736626 Bacteria 7181580
347 2644263742 2643221647 Bacteria 10741251
348 2644438059 2643221678 Bacteria 9540101
349 2676490941 2675903060 Bacteria 10051191
350 2784591837 2784132148 Bacteria 8627943
351 2785339394 2784746763 Bacteria 9783172
352 2785372857 2784746768 Bacteria 10036182
353 2786675119 2786546132 Bacteria 10419719
354 2808845202 2808606359 Bacteria 9866990
355 2808914815 2808606375 Bacteria 9466072
356 2809235457 2808606448 Bacteria 8656184
357 2816506921 2816332139 Bacteria 9138787
358 2837272711 2837268691 Bacteria 7850704
359 2862283170 2862281513 Bacteria 9621493
360 2862386699 2862382967 Bacteria 10317375
361 2862515154 2862507626 Bacteria 9425308
362 2863408210 2863404153 Bacteria 9672205
363 2863410128 2863404153 Bacteria 9672205
364 2867319940 2867319477 Bacteria 7069771
365 2867429088 2867428634 Bacteria 9590268
366 2877677837 2877676314 Bacteria 9512378
367 2895436299 2895427314 Bacteria 13147766
368 2899370934 2899370129 Bacteria 6781179
369 2912716107 2912715099 Bacteria 9460473
370 2919470990 2919468124 Bacteria 9133025
371 2954009064 2954002825 Bacteria 9173742
372 2954382626 2954380949 Bacteria 10050426
373 2954680256 2954673503 Bacteria 9685905
374 2954683895 2954682443 Bacteria 9862841
375 2954708542 2954701450 Bacteria 10834262
376 2954713119 2954711539 Bacteria 10867210
377 2954723079 2954721474 Bacteria 10456478
378 2954738751 2954731030 Bacteria 10243860
379 2954741986 2954740390 Bacteria 10229294
380 2954757608 2954749733 Bacteria 10366972
381 2954760963 2954759201 Bacteria 9358192
382 2990067576 2990059506 Bacteria 9321252
383 3006324427 3006321560 Bacteria 8247479
384 3006501723 3006493962 Bacteria 8825450
385 8008564151 8008558824 Bacteria 10610750
386 8048411296 8048406513 Bacteria 8936924
387 Ga0307513_10046533
388 JGI25406J46586_10003116
389 rootH1_10078521
390 Ga0006562J51391_1057538
391 Ga0006562J51391_1152031
392 Ga0070668_100001214
393 Ga0070668_100050775
394 Ga0068853_100130159
395 Ga0068855_100408623
396 Ga0068854_100534467
397 Ga0068854_100680348
398 Ga0068870_10266074
399 Ga0081455_10049039
400 Ga0081539_10000420
401 Ga0075365_10089289
402 Ga0075365_10117385
403 Ga0075365_10441292
404 Ga0075368_10005276
405 Ga0075363_100013243
406 Ga0075363_100151803
407 Ga0075367_10000070
408 Ga0075367_10001013
409 Ga0075370_10065402
410 Ga0075428_100001025
411 Ga0075430_100062717
412 Ga0075431_100250227
413 Ga0075429_100255567
414 Ga0114129_10776062
415 Ga0105246_10064062
416 Ga0182008_10003129
417 Ga0182007_10002031
418 Ga0183367_1001
419 Ga0207687_10480928
420 Ga0207668_10024688
421 Ga0207668_10393678
422 Ga0207640_10569085
423 Ga0209371_1017942
424 Ga0268265_10033961
425 Ga0307517_10032028
426 Ga0307517_10036002
427 Ga0307517_10036198
428 Ga0307517_10147154
429 Ga0307515_10000441
430 Ga0307515_10004188
431 Ga0307515_10009025
432 Ga0307515_10009142
433 Ga0307515_10024321
434 Ga0307515_10034349
435 Ga0307515_10036333
436 Ga0307515_10054535
437 Ga0307515_10055209
438 Ga0307515_10069758
439 Ga0307511_10000078
440 Ga0307511_10003617
441 Ga0307511_10059637
442 Ga0307511_10098632
443 Ga0307512_10007424
444 Ga0307512_10009925
445 Ga0307512_10016644
446 Ga0307512_10075210
447 Ga0316176_1054763
448 Ga0307513_10006446
449 Ga0307513_10010869
450 Ga0307513_10015623
451 Ga0307513_10022771
452 Ga0307513_10099078
453 Ga0307513_10119639
454 Ga0307513_10144765
455 Ga0307513_10286039
456 Ga0307509_10010252
457 Ga0307509_10025362
458 Ga0307509_10066860
459 Ga0307509_10096380
460 Ga0307508_10002224
461 Ga0307508_10012136
462 Ga0307508_10040146
463 Ga0307508_10074235
464 Ga0307508_10115810
465 Ga0307508_10206862
466 Ga0307514_10003178
467 Ga0307514_10054613
468 Ga0307514_10075814
469 Ga0307516_10003173
470 Ga0307516_10003260
471 Ga0307516_10013898
472 Ga0307516_10015617
473 Ga0307516_10041962
474 Ga0307516_10057602
475 Ga0307516_10113044
476 Ga0307516_10142105
477 Ga0307518_10112563
478 Ga0307410_10231493
479 Ga0307410_10233679
480 Ga0307406_10030467
481 Ga0307406_10230492
482 Ga0307406_10299269
483 Ga0307407_10252858
484 Ga0307409_100366368
485 Ga0307409_100554458
486 Ga0307416_100141515
487 Ga0307416_100680271
488 Ga0307415_100258290
489 Ga0307415_100467334
490 Ga0307507_10000498
491 Ga0307507_10023205
492 Ga0307507_10041105
493 Ga0307507_10045437
494 Ga0307507_10072289
495 Ga0307510_10006665
496 Ga0307510_10048757
497 Ga0307510_10050447
498 Ga0307510_10069273
499 Ga0307510_10087821
500 Ga0373934_0053981
501 Ga0373953_0174542
502 Ga0373955_0093015
503 Ga0373937_0000565
504 Ga0395898_0474755
505 Ga0451795_0908031
506 Ga0451800_0296048
507 Ga0451802_1935095
508 Ga0451833_1412585
509 Ga0451837_0219619
510 Ga0451841_0369202
511 Ga0451841_1015579
512 Ga0451843_0020547
513 Ga0451853_1049431
514 Ga0451853_1321921
515 Ga0439449_0010854
516 Ga0439455_0014743
517 Ga0439457_001855
518 Ga0439457_022168
519 Ga0450890_006528
520 Ga0450894_000677
521 Ga0450896_001070
522 Ga0450898_005199
523 Ga0450899_001491
524 Ga0450903_000253
525 Ga0450906_000888
526 Ga0439458_0001694
527 Ga0466972_0072233
528 Ga0466966_0079362
529 Ga0466961_0078779
530 Ga0466957_0021137
531 Ga0466957_0111032
532 Ga0466960_0130124
533 Ga0466967_0047748
534 Ga0495617_049107
535 Ga0495627_020167
536 Ga0495592_0005513
537 Ga0495592_0007404
538 Ga0495603_0002970
539 Ga0495603_0003705
540 Ga0495629_0014353
541 Ga0495629_0028194
542 Ga0495629_0136951
543 Ga0495629_0349071
544 Ga0495638_0014154
545 Ga0495638_0129300
546 Ga0495651_0001536
547 Ga0495651_0014030
548 Ga0495653_0221940
549 Ga0495580_0031921
550 Ga0495582_0013281
551 Ga0495639_0006002
552 Ga0495662_0000340
553 Ga0495662_0000920
554 Ga0495662_0047839
555 Ga0495664_0002668
556 Ga0495664_0004187
557 Ga0495584_0203851
558 Ga0495585_0054337
559 Ga0495594_0007399
560 Ga0495594_0053445
561 Ga0495607_0047490
562 Ga0495606_0009298
563 Ga0495610_0157958
564 Ga0495620_0035236
565 Ga0495620_0049270
566 Ga0495628_0051946
567 Ga0495631_0065036
568 Ga0495632_0021446
569 Ga0495632_0068284
570 Ga0495643_0003447
571 Ga0495643_0040447
572 Ga0495666_0048739
573 Ga0495652_0022647
574 Ga0495640_0037149
575 Ga0495640_0130247
576 Ga0495586_0067111
577 Ga0495586_0189919
578 Ga0495587_0001314
579 Ga0495587_0010746
580 Ga0495609_0082374
581 Ga0495597_0104685
582 Ga0495645_0020908
583 Ga0495645_0024367
584 Ga0495622_0030580
585 Ga0495622_0159529
586 Ga0495634_0001180
587 Ga0495634_0009864
588 Ga0495625_0033440
589 Ga0495625_0083593
590 Ga0495635_0005290
591 Ga0495635_0013055
592 Ga0495635_0291366
593 Ga0495661_0073006
594 Ga0495588_0006190
595 Ga0495588_0018163
596 Ga0495588_0020914
597 Ga0495588_0122903
598 Ga0495657_0002749
599 Ga0495657_0013325
600 Ga0495657_0049006
601 Ga0495623_0090340
602 Ga0495623_0170222
603 Ga0495646_0000209
604 Ga0495646_0005170
605 Ga0495658_0008051
606 Ga0495613_0001493
607 Ga0495613_0002386
608 Ga0495613_0002939
609 Ga0495613_0013127
610 Ga0495613_0017134
611 Ga0495670_0012888
612 Ga0495670_0121420
613 Ga0495671_0004656
614 Ga0495671_0049595
615 Ga0495671_0126912
616 Ga0495649_0120222
617 Ga0495589_0017311
618 Ga0495589_0032176
619 Ga0495600_0012419
620 Ga0495600_0037674
621 Ga0495600_0053938
622 Ga0495660_0030811
623 Ga0495581_0003700
624 Ga0495581_0003850
625 Ga0495581_0141827
626 Ga0495604_0006801
627 Ga0495604_0009015
628 Ga0495604_0170191
629 Ga0495636_0002681
630 Ga0495636_0006582
631 Ga0495672_0021587
632 Ga0495676_0015259
633 Ga0495676_0016034
634 Ga0495676_0075458
635 Ga0495683_0113395
636 Ga0495687_001186
637 Ga0495687_001678
638 Ga0495687_016151
639 Ga0495687_029296
640 Ga0495687_030491
641 Ga0495687_124781
642 Ga0495675_0096981
643 Ga0495685_003040
644 Ga0495685_012587
645 Ga0495685_027937
646 Ga0495681_0002340
647 Ga0495681_0015822
648 Ga0495681_0080365
649 Ga0495684_0185409
650 Ga0495684_0214654
651 Ga0495686_0024560
652 Ga0495686_0055554
653 Ga0495686_0071508
654 Ga0495593_0000662
655 Ga0495593_0002309
656 Ga0495614_0005297
657 Ga0495614_0034686
658 Ga0496109_0027914
659 Ga0496126_0422724
660 Ga0495678_055149
661 Ga0495678_092138
662 Ga0501031_0090539
663 Ga0501032_0015503
664 Ga0501033_0034979
665 Ga0501034_0065239
666 Ga0501036_0133490
667 Ga0501037_0049540
668 Ga0501038_0065360
669 Ga0501042_0208706
670 Ga0501043_0010933
671 Ga0501043_0028537
672 Ga0501046_0006238
673 Ga0501047_0050250
674 Ga0501047_0097729
675 Ga0501048_0011121
676 Ga0501048_0092328
677 Ga0501070_0060840
678 Ga0501070_0392115
679 Ga0501074_0205434
680 Ga0501035_0022206
681 Ga0501044_0012264
682 Ga0501044_0036859
683 Ga0501044_0294518
684 Ga0501045_0141956
685 nmdc:mga03n38_12418_c1
686 nmdc:mga03n38_61791_c1
687 nmdc:mga0yw44_354354_c1
688 nmdc:mga06z11_1567_c1
689 nmdc:mga06z11_4243_c1
690 nmdc:mga04h51_23719_c1
691 nmdc:mga07m45_153433_c1
692 nmdc:mga07m45_95177_c1
693 nmdc:mga05p37_619215_c1
694 nmdc:mga0qj67_109690_c1
695 nmdc:mga06r32_4464_c1
696 Ga0500610_0049874
697 Ga0495655_0038968
698 Ga0495619_0066685
699 Ga0500578_0023355
700 Ga0500644_0010140
701 Ga0500566_0058459
702 Ga0500640_002872
703 Ga0500641_0007103
704 Ga0500654_045469
705 Ga0500660_054004
706 Ga0500556_0031650
707 Ga0500560_004406
708 Ga0500560_019147
709 Ga0500569_034120
710 Ga0500569_098637
711 Ga0500572_016325
712 Ga0500594_0063137
713 Ga0500614_008553
714 Ga0500628_027037
715 Ga0500652_052997
716 Ga0500561_0000533
717 Ga0500573_0021607
718 Ga0500579_047418
719 Ga0500600_0025440
720 Ga0500600_0096581
721 Ga0500616_0001294
722 Ga0500616_0008545
723 Ga0500624_012776
724 Ga0500633_0087145
725 Ga0500634_0010335
726 Ga0500587_001908
727 Ga0530510_0058763
728 2585303962
729 2585311919
730 2616699071
731 2623500962
732 2623589744
733 2644263742
734 2644438059
735 2676490941
736 2784591837
737 2785339394
738 2785372857
739 2786675119
740 2808845202
741 2808914815
742 2809235457
743 2816506921
744 2837272711
745 2862283170
746 2862386699
747 2862515154
748 2863408210
749 2863410128
750 2867319940
751 2867429088
752 2877677837
753 2895436299
754 2899370934
755 2912716107
756 2919470990
757 2954009064
758 2954382626
759 2954680256
760 2954683895
761 2954708542
762 2954713119
763 2954723079
764 2954738751
765 2954741986
766 2954757608
767 2954760963
768 2990067576
769 3006324427
770 3006501723
771 8008564151
772 8048411296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

89

262

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.9059 60 242
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.8997 60 241
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8345 59 250
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.8204 37 250
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7923 56 246
ID Description Score Start End Superfamily
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9637 53 246 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9572 53 241 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9469 53 242 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.944 53 241 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9402 53 246 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1G6MLI1-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component 0.9895 11 256 GO:0005886
GO:0010438
GO:0055085
AF-A0A1G9KWS6-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component 0.9826 1 255 GO:0005886
GO:0055085
AF-A0A543KRU3-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system permease component 0.9802 5 258 GO:0005886
GO:0055085
AF-A0A838ABS3-F1-model_v4 ABC transporter permease subunit 0.9779 7 255 GO:0005886
GO:0055085
AF-A0A7W0IBQ1-F1-model_v4 ABC transporter permease subunit 0.9768 1 255 GO:0005886
GO:0010438
GO:0055085

Map