metagRoot

F430467

General Info

Members	Datasets	Scaffolds	Average Seq Length
386	230	386	223

Family's Representative Sequence

Representative Sequence	3300006178\|Ga0075367_10042576\|Ga0075367_100425763
Length	253
Sequence	MTASRPGENASVIGILGGTFDPIHCGHVAVALAARDALGLDAVTLVPTRVPPHRSRQPYASIYHRFAMTALAALSEEGLQVSDLELDAPGPSYTSMLLERLHGEGYDASHIVFIIGADAFAEIATWHNYPAILNRCHFAVISRPGQQADELRARLPGLADRFITIAPETRAPNAERLPGAAATSVALTSQAPAIFLIGAATPDVSSTEIRERRRAGLPIDGLVPEAVEQYIRRHTLYAGAIPTAGHLHEHKAQ

Samples

	Sample ID	Description	Type	Environment
1	2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
2	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
21	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
22	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
23	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
24	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
25	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
33	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
34	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
37	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
47	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
48	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
51	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
54	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
55	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
56	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
57	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
58	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
59	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
60	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
61	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
62	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
63	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
64	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
65	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
68	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
69	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
70	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
76	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
77	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
78	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
80	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
82	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
83	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
86	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
87	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
88	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
89	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
90	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
91	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
92	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
93	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
94	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
95	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
96	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
97	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
137	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
141	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
142	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
143	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
144	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
145	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
146	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
147	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
148	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
149	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
150	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
151	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
152	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
153	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
154	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
155	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
156	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
157	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
158	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
159	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
160	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
161	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
162	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
163	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
164	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
165	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
166	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
167	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
168	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
169	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
170	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
171	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
172	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
173	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
174	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
175	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
176	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
177	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
178	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
179	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
180	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
181	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
182	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
183	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
184	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
185	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
186	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
187	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
188	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
189	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
190	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
191	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
192	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
193	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
194	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
195	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
196	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
197	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
198	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
200	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
201	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
202	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
203	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
204	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
205	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
206	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
207	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
208	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
209	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
210	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
211	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
212	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
213	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
214	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
215	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
216	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
217	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
218	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
219	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
220	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
221	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
222	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
223	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
224	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
225	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
226	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
227	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
228	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
229	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
230	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.55
Nodule	0
Rhizoplane	2.33
Rhizosphere	88.08
Stem	0
Stem Tuber	0
Unclassified	1.04

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS1b_contig_6650149	2162886011	Bacteria	1958
2	Ga0065714_10100088	3300005288	Unclassified	1661
3	Ga0065712_10067842	3300005290	Bacteria	26512
4	Ga0065715_10000734	3300005293	Bacteria	10406
5	Ga0065715_10104254	3300005293	Bacteria	2976
6	Ga0065715_10240325	3300005293	Bacteria	1201
7	Ga0070676_10005709	3300005328	Bacteria	6633
8	Ga0070676_10117551	3300005328	Bacteria	1664
9	Ga0070676_10210272	3300005328	Unclassified	1280
10	Ga0070676_10287981	3300005328	Bacteria	1109
11	Ga0070683_100117535	3300005329	Bacteria	2510
12	Ga0070690_100000152	3300005330	Bacteria	35420
13	Ga0070670_100004688	3300005331	Bacteria	11470
14	Ga0070670_100005218	3300005331	Bacteria	10938
15	Ga0070670_100279594	3300005331	Bacteria	1457
16	Ga0070677_10193194	3300005333	Bacteria	977
17	Ga0070677_10307265	3300005333	Bacteria	808
18	Ga0068869_100000340	3300005334	Bacteria	24971
19	Ga0070680_100220749	3300005336	Bacteria	1600
20	Ga0070682_100223332	3300005337	Bacteria	1342
21	Ga0068868_100302689	3300005338	Bacteria	1358
22	Ga0070689_100045241	3300005340	Bacteria	3389
23	Ga0070689_100167128	3300005340	Bacteria	1781
24	Ga0070691_10012786	3300005341	Bacteria	3847
25	Ga0070661_100054947	3300005344	Bacteria	2916
26	Ga0070661_100069257	3300005344	Bacteria	2594
27	Ga0070669_100118577	3300005353	Bacteria	2016
28	Ga0070675_100001614	3300005354	Bacteria	16612
29	Ga0070675_100001797	3300005354	Bacteria	15842
30	Ga0070675_100002731	3300005354	Bacteria	13262
31	Ga0070675_100099009	3300005354	Bacteria	2453
32	Ga0070675_100280641	3300005354	Bacteria	1464
33	Ga0070675_100358298	3300005354	Bacteria	1295
34	Ga0070671_100018164	3300005355	Bacteria	5710
35	Ga0070671_100372740	3300005355	Bacteria	1219
36	Ga0070674_100014707	3300005356	Bacteria	4869
37	Ga0070674_100162075	3300005356	Bacteria	1697
38	Ga0070688_100023544	3300005365	Bacteria	3623
39	Ga0070688_100073600	3300005365	Bacteria	2192
40	Ga0070688_100208437	3300005365	Unclassified	1371
41	Ga0070688_100350783	3300005365	Bacteria	1080
42	Ga0070667_100041505	3300005367	Bacteria	3860
43	Ga0070667_100184719	3300005367	Bacteria	1845
44	Ga0070709_10021251	3300005434	Bacteria	3778
45	Ga0070713_100011211	3300005436	Bacteria	6518
46	Ga0070701_10001608	3300005438	Bacteria	8421
47	Ga0070701_10281338	3300005438	Bacteria	1016
48	Ga0070711_100027358	3300005439	Bacteria	3744
49	Ga0070705_100018744	3300005440	Bacteria	3632
50	Ga0070705_100116511	3300005440	Bacteria	1717
51	Ga0070700_100000688	3300005441	Bacteria	16677
52	Ga0070700_100291700	3300005441	Bacteria	1187
53	Ga0070678_100019927	3300005456	Bacteria	4389
54	Ga0070678_100020434	3300005456	Bacteria	4345
55	Ga0070678_100068441	3300005456	Bacteria	2647
56	Ga0070678_100089899	3300005456	Bacteria	2352
57	Ga0070681_10645557	3300005458	Unclassified	973
58	Ga0068867_100003385	3300005459	Bacteria	11217
59	Ga0068867_100196869	3300005459	Bacteria	1611
60	Ga0070685_10033827	3300005466	Bacteria	2875
61	Ga0070685_10175350	3300005466	Bacteria	1376
62	Ga0070707_100032115	3300005468	Bacteria	5002
63	Ga0070707_100213927	3300005468	Bacteria	1878
64	Ga0070698_100129379	3300005471	Bacteria	2481
65	Ga0070699_100012071	3300005518	Bacteria	7454
66	Ga0070684_100221572	3300005535	Unclassified	1726
67	Ga0070697_100109297	3300005536	Bacteria	2302
68	Ga0068853_100350667	3300005539	Bacteria	1373
69	Ga0070672_100009158	3300005543	Bacteria	6812
70	Ga0070672_100415668	3300005543	Bacteria	1154
71	Ga0070686_100000130	3300005544	Bacteria	53140
72	Ga0070686_100030830	3300005544	Bacteria	3274
73	Ga0070695_100000640	3300005545	Bacteria	18572
74	Ga0070695_100010154	3300005545	Bacteria	5615
75	Ga0070696_100007520	3300005546	Bacteria	7287
76	Ga0070696_100177080	3300005546	Bacteria	1580
77	Ga0070693_100023111	3300005547	Bacteria	3318
78	Ga0070693_100095175	3300005547	Bacteria	1803
79	Ga0070665_100283095	3300005548	Bacteria	1660
80	Ga0070665_100418744	3300005548	Bacteria	1348
81	Ga0070704_100001989	3300005549	Bacteria	11311
82	Ga0070704_100024736	3300005549	Bacteria	3944
83	Ga0070664_100030086	3300005564	Bacteria	4529
84	Ga0070664_100712770	3300005564	Bacteria	935
85	Ga0068854_100203715	3300005578	Bacteria	1557
86	Ga0070702_100011688	3300005615	Bacteria	4374
87	Ga0068859_100026206	3300005617	Bacteria	5847
88	Ga0068859_100089398	3300005617	Bacteria	3130
89	Ga0068859_100121752	3300005617	Bacteria	2676
90	Ga0068859_100232108	3300005617	Bacteria	1933
91	Ga0068864_100048857	3300005618	Bacteria	3638
92	Ga0068864_100051110	3300005618	Bacteria	3559
93	Ga0068866_10002563	3300005718	Bacteria	7493
94	Ga0068866_10350510	3300005718	Bacteria	938
95	Ga0068861_100008492	3300005719	Bacteria	7072
96	Ga0068861_100075202	3300005719	Bacteria	2629
97	Ga0068861_100309351	3300005719	Bacteria	1372
98	Ga0068851_10184114	3300005834	Bacteria	1158
99	Ga0068870_10001491	3300005840	Bacteria	9479
100	Ga0068870_10042220	3300005840	Bacteria	2374
101	Ga0068863_100088909	3300005841	Bacteria	2928
102	Ga0068858_100001727	3300005842	Bacteria	22336
103	Ga0068860_100046475	3300005843	Bacteria	4139
104	Ga0068860_100122819	3300005843	Bacteria	2488
105	Ga0068862_100012938	3300005844	Bacteria	6903
106	Ga0068862_100870622	3300005844	Unclassified	884
107	Ga0070717_10615659	3300006028	Bacteria	985
108	Ga0075368_10004923	3300006042	Bacteria	4555
109	Ga0075368_10035491	3300006042	Bacteria	1946
110	Ga0075368_10111414	3300006042	Bacteria	1129
111	Ga0075363_100117695	3300006048	Bacteria	1481
112	Ga0075364_10029358	3300006051	Bacteria	3526
113	Ga0075362_10175201	3300006177	Bacteria	1038
114	Ga0075367_10018729	3300006178	Bacteria	3826
115	Ga0075367_10042576	3300006178	Bacteria	2657
116	Ga0075367_10101637	3300006178	Bacteria	1758
117	Ga0075366_10011845	3300006195	Bacteria	4934
118	Ga0075366_10030579	3300006195	Bacteria	3166
119	Ga0075366_10048380	3300006195	Bacteria	2521
120	Ga0075366_10067733	3300006195	Bacteria	2124
121	Ga0075366_10143410	3300006195	Bacteria	1445
122	Ga0097621_100001158	3300006237	Bacteria	18328
123	Ga0097621_100002632	3300006237	Bacteria	12292
124	Ga0097621_100040849	3300006237	Bacteria	3731
125	Ga0075370_10012536	3300006353	Bacteria	4484
126	Ga0068871_100000309	3300006358	Bacteria	33960
127	Ga0068871_100011583	3300006358	Bacteria	6472
128	Ga0068871_100031991	3300006358	Bacteria	4151
129	Ga0068871_100037487	3300006358	Bacteria	3867
130	Ga0068871_100484757	3300006358	Bacteria	1113
131	Ga0075428_100001205	3300006844	Bacteria	27639
132	Ga0075428_100021842	3300006844	Bacteria	7087
133	Ga0075428_100076448	3300006844	Bacteria	3655
134	Ga0075433_10008001	3300006852	Bacteria	8415
135	Ga0075434_100007229	3300006871	Bacteria	10276
136	Ga0075434_100142396	3300006871	Bacteria	2418
137	Ga0075434_100223900	3300006871	Bacteria	1901
138	Ga0068865_100000168	3300006881	Bacteria	36273
139	Ga0068865_100119722	3300006881	Bacteria	1955
140	Ga0068865_100206838	3300006881	Bacteria	1527
141	Ga0075436_100008656	3300006914	Bacteria	6956
142	Ga0097620_100026207	3300006931	Bacteria	5847
143	Ga0097620_100089401	3300006931	Bacteria	3130
144	Ga0097620_100121754	3300006931	Bacteria	2676
145	Ga0097620_100232114	3300006931	Bacteria	1933
146	Ga0075435_100001374	3300007076	Bacteria	15713
147	Ga0075435_100293356	3300007076	Bacteria	1390
148	Ga0105250_10077207	3300009092	Bacteria	1348
149	Ga0105240_10084887	3300009093	Bacteria	3881
150	Ga0111539_10754954	3300009094	Bacteria	1132
151	Ga0105245_10001255	3300009098	Bacteria	22946
152	Ga0114129_10007386	3300009147	Bacteria	15642
153	Ga0114129_10020431	3300009147	Bacteria	9417
154	Ga0114129_10063350	3300009147	Bacteria	5163
155	Ga0114129_10877511	3300009147	Bacteria	1138
156	Ga0105243_10001271	3300009148	Bacteria	22642
157	Ga0105241_10465541	3300009174	Bacteria	1121
158	Ga0105242_10000493	3300009176	Bacteria	31216
159	Ga0105242_10124466	3300009176	Bacteria	2217
160	Ga0105242_10245520	3300009176	Bacteria	1611
161	Ga0105248_10057835	3300009177	Bacteria	4353
162	Ga0105248_10062678	3300009177	Bacteria	4175
163	Ga0105248_10066465	3300009177	Bacteria	4049
164	Ga0105248_10277379	3300009177	Bacteria	1887
165	Ga0105248_10567364	3300009177	Unclassified	1280
166	Ga0105238_10032995	3300009551	Bacteria	5268
167	Ga0105238_10352875	3300009551	Unclassified	1460
168	Ga0105249_10017241	3300009553	Bacteria	6410
169	Ga0105249_10040833	3300009553	Bacteria	4216
170	Ga0105249_10303794	3300009553	Bacteria	1601
171	Ga0105249_10671674	3300009553	Bacteria	1095
172	Ga0105239_10067158	3300010375	Bacteria	3939
173	Ga0105239_10728669	3300010375	Bacteria	1134
174	Ga0157369_10402068	3300013105	Unclassified	1421
175	Ga0157374_10295906	3300013296	Bacteria	1601
176	Ga0157378_10001019	3300013297	Bacteria	25575
177	Ga0157378_10027875	3300013297	Bacteria	4981
178	Ga0157378_10036164	3300013297	Bacteria	4370
179	Ga0157375_10366069	3300013308	Bacteria	1608
180	Ga0157375_10400561	3300013308	Unclassified	1539
181	Ga0157375_10780398	3300013308	Bacteria	1105
182	Ga0163163_10233850	3300014325	Bacteria	1887
183	Ga0163163_10560432	3300014325	Bacteria	1205
184	Ga0157380_10001806	3300014326	Bacteria	14123
185	Ga0157380_10133551	3300014326	Bacteria	2121
186	Ga0157380_10189646	3300014326	Bacteria	1814
187	Ga0157380_10454970	3300014326	Bacteria	1230
188	Ga0157377_10070849	3300014745	Unclassified	2015
189	Ga0157377_10203127	3300014745	Bacteria	1259
190	Ga0157377_10244629	3300014745	Bacteria	1160
191	Ga0157376_10210290	3300014969	Bacteria	1796
192	Ga0213876_10073006	3300021384	Bacteria	1812
193	Ga0207656_10208275	3300025321	Bacteria	947
194	Ga0207682_10018692	3300025893	Bacteria	2710
195	Ga0207682_10116220	3300025893	Bacteria	1182
196	Ga0207682_10116672	3300025893	Bacteria	1180
197	Ga0207682_10253827	3300025893	Bacteria	819
198	Ga0207642_10001699	3300025899	Bacteria	6810
199	Ga0207642_10091141	3300025899	Bacteria	1506
200	Ga0207642_10227320	3300025899	Bacteria	1046
201	Ga0207643_10001611	3300025908	Bacteria	12741
202	Ga0207643_10040152	3300025908	Bacteria	2634
203	Ga0207663_10200864	3300025916	Bacteria	1438
204	Ga0207657_10141624	3300025919	Bacteria	1964
205	Ga0207649_10049667	3300025920	Bacteria	2592
206	Ga0207646_10016412	3300025922	Bacteria	6948
207	Ga0207681_10046165	3300025923	Bacteria	2929
208	Ga0207681_10051748	3300025923	Bacteria	2783
209	Ga0207681_10060345	3300025923	Bacteria	2603
210	Ga0207681_10212888	3300025923	Bacteria	1491
211	Ga0207694_10016148	3300025924	Bacteria	5635
212	Ga0207650_10003560	3300025925	Bacteria	10690
213	Ga0207650_10231515	3300025925	Bacteria	1490
214	Ga0207659_10000072	3300025926	Bacteria	64525
215	Ga0207659_10001033	3300025926	Bacteria	16485
216	Ga0207659_10031039	3300025926	Bacteria	3655
217	Ga0207659_10039636	3300025926	Bacteria	3288
218	Ga0207659_10623768	3300025926	Bacteria	920
219	Ga0207687_10001323	3300025927	Bacteria	16961
220	Ga0207700_10003434	3300025928	Bacteria	9209
221	Ga0207644_10330492	3300025931	Bacteria	1234
222	Ga0207690_10185792	3300025932	Bacteria	1568
223	Ga0207706_10236167	3300025933	Bacteria	1598
224	Ga0207686_10000584	3300025934	Bacteria	22814
225	Ga0207670_10027199	3300025936	Bacteria	3614
226	Ga0207670_10070467	3300025936	Bacteria	2415
227	Ga0207669_10020297	3300025937	Bacteria	3481
228	Ga0207669_10216044	3300025937	Bacteria	1403
229	Ga0207704_10000766	3300025938	Bacteria	14145
230	Ga0207704_10024382	3300025938	Bacteria	3280
231	Ga0207691_10044378	3300025940	Bacteria	4093
232	Ga0207691_10077968	3300025940	Bacteria	2983
233	Ga0207691_10240962	3300025940	Bacteria	1563
234	Ga0207711_10078992	3300025941	Bacteria	2871
235	Ga0207711_10082106	3300025941	Bacteria	2817
236	Ga0207711_10149109	3300025941	Bacteria	2109
237	Ga0207711_10194796	3300025941	Bacteria	1848
238	Ga0207689_10001277	3300025942	Bacteria	24269
239	Ga0207689_10295437	3300025942	Bacteria	1342
240	Ga0207679_10005395	3300025945	Bacteria	8009
241	Ga0207679_10035557	3300025945	Bacteria	3526
242	Ga0207679_10651865	3300025945	Bacteria	952
243	Ga0207651_10211300	3300025960	Bacteria	1562
244	Ga0207712_10075559	3300025961	Bacteria	2436
245	Ga0207668_10019475	3300025972	Bacteria	4292
246	Ga0207668_10195776	3300025972	Unclassified	1606
247	Ga0207658_10017687	3300025986	Bacteria	4916
248	Ga0207677_10024237	3300026023	Bacteria	3766
249	Ga0207677_10110511	3300026023	Bacteria	2046
250	Ga0207677_10470601	3300026023	Bacteria	1081
251	Ga0207703_10001499	3300026035	Bacteria	21315
252	Ga0207678_10004847	3300026067	Bacteria	12088
253	Ga0207708_10000102	3300026075	Bacteria	64743
254	Ga0207708_10230400	3300026075	Bacteria	1487
255	Ga0207702_10169741	3300026078	Bacteria	1999
256	Ga0207641_10103584	3300026088	Bacteria	2511
257	Ga0207641_10398600	3300026088	Bacteria	1321
258	Ga0207648_10000148	3300026089	Bacteria	70334
259	Ga0207676_10021440	3300026095	Bacteria	4740
260	Ga0207676_10045271	3300026095	Bacteria	3399
261	Ga0207675_100000801	3300026118	Bacteria	31240
262	Ga0207675_100036985	3300026118	Bacteria	4554
263	Ga0207675_100108623	3300026118	Bacteria	2616
264	Ga0207683_10011614	3300026121	Bacteria	7519
265	Ga0207683_10036835	3300026121	Bacteria	4260
266	Ga0207683_10081884	3300026121	Bacteria	2866
267	Ga0207683_10098129	3300026121	Bacteria	2614
268	Ga0207683_10153151	3300026121	Bacteria	2081
269	Ga0209813_10008291	3300027866	Bacteria	2619
270	Ga0209813_10121355	3300027866	Bacteria	910
271	Ga0268266_10293104	3300028379	Bacteria	1516
272	Ga0268266_10367888	3300028379	Bacteria	1354
273	Ga0268265_10007429	3300028380	Bacteria	7399
274	Ga0268264_10109758	3300028381	Bacteria	2414
275	Ga0265332_10072831	3300031238	Bacteria	1462
276	Ga0265328_10150308	3300031239	Bacteria	876
277	Ga0265320_10129599	3300031240	Bacteria	1146
278	Ga0307408_100016627	3300031548	Bacteria	4914
279	Ga0265314_10012919	3300031711	Bacteria	6782
280	Ga0307405_10526423	3300031731	Bacteria	952
281	Ga0307416_100156129	3300032002	Bacteria	2101
282	Ga0307411_10367219	3300032005	Bacteria	1179
283	Ga0373923_0006645	3300035111	Bacteria	4014
284	Ga0373932_0014900	3300035112	Bacteria	1963
285	Ga0373936_0059622	3300035113	Bacteria	1556
286	Ga0373945_0073428	3300035116	Unclassified	1299
287	Ga0373953_0167880	3300035117	Bacteria	944
288	Ga0373960_0190001	3300035121	Bacteria	721
289	Ga0373943_0017695	3300035170	Bacteria	3263
290	Ga0373955_0017623	3300035172	Bacteria	3538
291	Ga0373924_0018571	3300035410	Unclassified	2681
292	Ga0373924_0048422	3300035410	Bacteria	1756
293	Ga0373931_0337832	3300035691	Bacteria	940
294	Ga0373935_0034941	3300035692	Bacteria	3135
295	Ga0373935_0378877	3300035692	Bacteria	1013
296	Ga0373933_0067194	3300035724	Bacteria	2174
297	Ga0373933_0434690	3300035724	Bacteria	858
298	Ga0373947_0490453	3300035725	Bacteria	834
299	Ga0373937_0123726	3300036401	Bacteria	2412
300	Ga0373937_0567231	3300036401	Bacteria	1078
301	Ga0373925_0008010	3300037068	Bacteria	7695
302	Ga0436365_1522203	3300039437	Bacteria	991
303	Ga0436365_1535204	3300039437	Bacteria	4672
304	Ga0451802_1664961	3300041460	Bacteria	775
305	Ga0451853_0086769	3300041512	Bacteria	1086
306	Ga0450908_001434	3300042184	Bacteria	4630
307	Ga0439459_0066763	3300042438	Bacteria	824
308	Ga0450918_029213	3300042531	Bacteria	971
309	Ga0451577_0050094	3300042876	Bacteria	3728
310	Ga0451577_0251749	3300042876	Bacteria	1599
311	Ga0451576_0024551	3300045051	Bacteria	6510
312	Ga0466967_0393679	3300045976	Bacteria	1347
313	Ga0495638_0094774	3300046460	Unclassified	1794
314	Ga0495580_0128683	3300046472	Bacteria	1757
315	Ga0495628_0058443	3300046516	Unclassified	3030
316	Ga0495652_0119063	3300046529	Bacteria	2109
317	Ga0495586_0096514	3300046535	Bacteria	1637
318	Ga0495645_0193222	3300046543	Unclassified	1385
319	Ga0495667_0076111	3300046559	Bacteria	2183
320	Ga0495656_0411964	3300046615	Bacteria	708
321	Ga0495657_0287631	3300046675	Bacteria	982
322	Ga0495647_0113351	3300046681	Bacteria	1134
323	Ga0495658_0068934	3300046683	Bacteria	2049
324	Ga0495669_0005589	3300046684	Bacteria	5244
325	Ga0495669_0024017	3300046684	Bacteria	2656
326	Ga0495613_0018648	3300046689	Bacteria	5175
327	Ga0495670_0176782	3300046691	Unclassified	1126
328	Ga0495670_0283862	3300046691	Unclassified	886
329	Ga0495604_0339649	3300047317	Bacteria	1000
330	Ga0495674_0108582	3300047319	Bacteria	2354
331	Ga0495684_0000091	3300047471	Bacteria	63223
332	Ga0496101_0369136	3300048904	Bacteria	1128
333	Ga0496104_0006115	3300048907	Bacteria	10567
334	Ga0496106_0119479	3300048909	Bacteria	2059
335	Ga0496108_0084682	3300048911	Bacteria	2691
336	Ga0496109_0019736	3300048912	Bacteria	5947
337	Ga0496110_0020811	3300048913	Bacteria	5541
338	Ga0496112_0016438	3300048915	Bacteria	6932
339	Ga0496112_0331371	3300048915	Bacteria	1466
340	Ga0501036_0184509	3300049572	Bacteria	1756
341	Ga0501039_0375248	3300049575	Unclassified	1117
342	Ga0501042_0378216	3300049578	Unclassified	1025
343	Ga0501067_0620488	3300049583	Unclassified	607
344	Ga0501068_0041235	3300049584	Bacteria	2773
345	Ga0501070_0042938	3300049586	Bacteria	3764
346	Ga0501071_0103037	3300049587	Unclassified	2105
347	Ga0501072_0044033	3300049588	Bacteria	3509
348	Ga0501073_0002736	3300049589	Bacteria	13216
349	Ga0501079_0351491	3300049741	Unclassified	1155
350	Ga0501081_0040606	3300049743	Bacteria	3186
351	Ga0501083_0058971	3300049744	Bacteria	2568
352	Ga0501083_0145209	3300049744	Bacteria	1553
353	nmdc:mga00v17_21633_c1	3300050491	Bacteria	3699
354	nmdc:mga00v17_22309_c1	3300050491	Bacteria	3652
355	nmdc:mga00v17_82195_c1	3300050491	Bacteria	2013
356	nmdc:mga0yw44_175566_c1	3300050492	Bacteria	1408
357	nmdc:mga0k408_20377_c1	3300050493	Bacteria	1993
358	nmdc:mga0k408_53200_c1	3300050493	Bacteria	2346
359	nmdc:mga06z11_139129_c1	3300050494	Bacteria	1371
360	nmdc:mga04h51_31033_c1	3300050495	Bacteria	1686
361	nmdc:mga04h51_33478_c1	3300050495	Bacteria	1636
362	nmdc:mga05p37_1171_c1	3300050507	Bacteria	30211
363	nmdc:mga05p37_434042_c1	3300050507	Bacteria	1525
364	nmdc:mga05p37_9354_c1	3300050507	Bacteria	11598
365	nmdc:mga09592_282323_c1	3300050508	Unclassified	1440
366	nmdc:mga06r32_89512_c1	3300050510	Unclassified	3005
367	nmdc:mga08y16_775499_c1	3300050511	Bacteria	953
368	nmdc:mga0n895_279610_c1	3300050512	Bacteria	1693
369	nmdc:mga0n895_309040_c1	3300050512	Bacteria	1602
370	nmdc:mga0rr50_22715_c1	3300050513	Bacteria	4311
371	nmdc:mga0rr50_83129_c1	3300050513	Bacteria	2475
372	nmdc:mga08x19_368600_c1	3300050514	Bacteria	1005
373	nmdc:mga08x19_94807_c1	3300050514	Bacteria	1974
374	nmdc:mga0a205_334572_c1	3300050515	Bacteria	1384
375	nmdc:mga0a205_88962_c1	3300050515	Bacteria	2985
376	nmdc:mga0a205_9054_c1	3300050515	Bacteria	9080
377	Ga0495601_0001700	3300053077	Bacteria	12158
378	Ga0500641_0000556	3300053096	Bacteria	13482
379	Ga0500650_0095145	3300053098	Bacteria	1395
380	Ga0500555_000162	3300053103	Bacteria	31223
381	Ga0500568_0003131	3300053139	Bacteria	9435
382	Ga0500616_0000556	3300053153	Bacteria	46113
383	Ga0500645_002456	3300053730	Bacteria	8230
384	Ga0500599_002007	3300053736	Bacteria	2407
385	Ga0590071_005602	3300059421	Bacteria	3019
386	Ga0590077_000693	3300059426	Bacteria	8935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041512	Ga0451853_0086769	Ga0451853_0086769_13_543	169
2	3300049583	Ga0501067_0620488	Ga0501067_0620488_23_586	172
3	3300035121	Ga0373960_0190001	Ga0373960_0190001_58_666	190
4	3300035691	Ga0373931_0337832	Ga0373931_0337832_44_652	190
5	3300046691	Ga0495670_0283862	Ga0495670_0283862_236_844	190
6	3300053098	Ga0500650_0095145	Ga0500650_0095145_266_937	191
7	3300053153	Ga0500616_0000556	Ga0500616_0000556_18310_19011	191
8	3300005356	Ga0070674_100162075	Ga0070674_1001620752	192
9	3300025937	Ga0207669_10216044	Ga0207669_102160442	192
10	3300049572	Ga0501036_0184509	Ga0501036_0184509_283_915	193
11	3300005365	Ga0070688_100350783	Ga0070688_1003507832	194
12	3300049575	Ga0501039_0375248	Ga0501039_0375248_111_746	194
13	3300049578	Ga0501042_0378216	Ga0501042_0378216_316_951	194
14	3300049587	Ga0501071_0103037	Ga0501071_0103037_1006_1641	194
15	3300049741	Ga0501079_0351491	Ga0501079_0351491_116_751	194
16	3300049743	Ga0501081_0040606	Ga0501081_0040606_1121_1756	194
17	3300014325	Ga0163163_10560432	Ga0163163_105604321	195
18	3300025893	Ga0207682_10018692	Ga0207682_100186923	195
19	3300025933	Ga0207706_10236167	Ga0207706_102361672	195
20	3300026067	Ga0207678_10004847	Ga0207678_100048475	195
21	3300028379	Ga0268266_10293104	Ga0268266_102931042	195
22	3300005356	Ga0070674_100014707	Ga0070674_1000147072	199
23	3300025893	Ga0207682_10116672	Ga0207682_101166721	199
24	3300025937	Ga0207669_10020297	Ga0207669_100202972	199
25	3300005328	Ga0070676_10117551	Ga0070676_101175512	200
26	3300005330	Ga0070690_100000152	Ga0070690_10000015217	200
27	3300005334	Ga0068869_100000340	Ga0068869_1000003402	200
28	3300005337	Ga0070682_100223332	Ga0070682_1002233322	200
29	3300005340	Ga0070689_100045241	Ga0070689_1000452412	200
30	3300005341	Ga0070691_10012786	Ga0070691_100127863	200
31	3300005365	Ga0070688_100208437	Ga0070688_1002084372	200
32	3300005438	Ga0070701_10001608	Ga0070701_100016082	200
33	3300005440	Ga0070705_100018744	Ga0070705_1000187444	200
34	3300005441	Ga0070700_100000688	Ga0070700_1000006886	200
35	3300005456	Ga0070678_100020434	Ga0070678_1000204343	200
36	3300005459	Ga0068867_100003385	Ga0068867_1000033858	200
37	3300005466	Ga0070685_10033827	Ga0070685_100338272	200
38	3300005544	Ga0070686_100000130	Ga0070686_10000013016	200
39	3300005545	Ga0070695_100010154	Ga0070695_1000101546	200
40	3300005546	Ga0070696_100007520	Ga0070696_1000075204	200
41	3300005547	Ga0070693_100023111	Ga0070693_1000231113	200
42	3300005549	Ga0070704_100024736	Ga0070704_1000247362	200
43	3300005615	Ga0070702_100011688	Ga0070702_1000116885	200
44	3300005617	Ga0068859_100026206	Ga0068859_1000262062	200
45	3300005718	Ga0068866_10002563	Ga0068866_100025635	200
46	3300005719	Ga0068861_100008492	Ga0068861_1000084927	200
47	3300005840	Ga0068870_10001491	Ga0068870_100014916	200
48	3300005842	Ga0068858_100001727	Ga0068858_10000172711	200
49	3300005843	Ga0068860_100046475	Ga0068860_1000464753	200
50	3300005844	Ga0068862_100012938	Ga0068862_1000129387	200
51	3300006237	Ga0097621_100001158	Ga0097621_1000011588	200
52	3300006358	Ga0068871_100011583	Ga0068871_1000115833	200
53	3300006881	Ga0068865_100000168	Ga0068865_10000016827	200
54	3300006931	Ga0097620_100026207	Ga0097620_1000262076	200
55	3300025899	Ga0207642_10001699	Ga0207642_100016996	200
56	3300025908	Ga0207643_10001611	Ga0207643_100016118	200
57	3300025927	Ga0207687_10001323	Ga0207687_1000132310	200
58	3300025934	Ga0207686_10000584	Ga0207686_100005845	200
59	3300025936	Ga0207670_10027199	Ga0207670_100271995	200
60	3300025938	Ga0207704_10000766	Ga0207704_100007663	200
61	3300025941	Ga0207711_10078992	Ga0207711_100789924	200
62	3300025942	Ga0207689_10001277	Ga0207689_100012775	200
63	3300025961	Ga0207712_10075559	Ga0207712_100755592	200
64	3300026023	Ga0207677_10024237	Ga0207677_100242375	200
65	3300026035	Ga0207703_10001499	Ga0207703_100014992	200
66	3300026075	Ga0207708_10000102	Ga0207708_1000010212	200
67	3300026089	Ga0207648_10000148	Ga0207648_1000014810	200
68	3300026118	Ga0207675_100000801	Ga0207675_10000080115	200
69	3300026121	Ga0207683_10036835	Ga0207683_100368353	200
70	3300028380	Ga0268265_10007429	Ga0268265_100074292	200
71	3300028381	Ga0268264_10109758	Ga0268264_101097584	200
72	3300042876	Ga0451577_0050094	Ga0451577_0050094_2364_2978	201
73	3300045051	Ga0451576_0024551	Ga0451576_0024551_5216_5830	201
74	3300035116	Ga0373945_0073428	Ga0373945_0073428_482_1180	202
75	3300035117	Ga0373953_0167880	Ga0373953_0167880_83_781	202
76	3300036401	Ga0373937_0123726	Ga0373937_0123726_641_1339	202
77	3300042438	Ga0439459_0066763	Ga0439459_0066763_52_741	202
78	3300046516	Ga0495628_0058443	Ga0495628_0058443_2226_2924	202
79	3300005539	Ga0068853_100350667	Ga0068853_1003506672	203
80	3300025972	Ga0207668_10019475	Ga0207668_100194754	203
81	3300046543	Ga0495645_0193222	Ga0495645_0193222_109_807	203
82	3300005333	Ga0070677_10193194	Ga0070677_101931941	204
83	3300006177	Ga0075362_10175201	Ga0075362_101752012	204
84	3300025893	Ga0207682_10116220	Ga0207682_101162202	204
85	3300035111	Ga0373923_0006645	Ga0373923_0006645_60_764	204
86	3300035113	Ga0373936_0059622	Ga0373936_0059622_433_1137	204
87	3300035170	Ga0373943_0017695	Ga0373943_0017695_1812_2516	204
88	3300035172	Ga0373955_0017623	Ga0373955_0017623_1537_2241	204
89	3300035410	Ga0373924_0018571	Ga0373924_0018571_1867_2571	204
90	3300035692	Ga0373935_0034941	Ga0373935_0034941_2311_3015	204
91	3300035724	Ga0373933_0067194	Ga0373933_0067194_1215_1919	204
92	3300035725	Ga0373947_0490453	Ga0373947_0490453_38_742	204
93	3300037068	Ga0373925_0008010	Ga0373925_0008010_1213_1917	204
94	3300046675	Ga0495657_0287631	Ga0495657_0287631_188_892	204
95	3300047317	Ga0495604_0339649	Ga0495604_0339649_108_812	204
96	3300005331	Ga0070670_100279594	Ga0070670_1002795942	205
97	3300005344	Ga0070661_100054947	Ga0070661_1000549474	205
98	3300005354	Ga0070675_100099009	Ga0070675_1000990092	205
99	3300005355	Ga0070671_100018164	Ga0070671_1000181645	205
100	3300005367	Ga0070667_100041505	Ga0070667_1000415055	205
101	3300005438	Ga0070701_10281338	Ga0070701_102813382	205
102	3300005456	Ga0070678_100068441	Ga0070678_1000684412	205
103	3300005543	Ga0070672_100415668	Ga0070672_1004156682	205
104	3300005564	Ga0070664_100030086	Ga0070664_1000300865	205
105	3300005618	Ga0068864_100051110	Ga0068864_1000511105	205
106	3300005718	Ga0068866_10350510	Ga0068866_103505102	205
107	3300005719	Ga0068861_100309351	Ga0068861_1003093512	205
108	3300006844	Ga0075428_100021842	Ga0075428_1000218429	205
109	3300009177	Ga0105248_10277379	Ga0105248_102773793	205
110	3300013308	Ga0157375_10780398	Ga0157375_107803982	205
111	3300025925	Ga0207650_10231515	Ga0207650_102315152	205
112	3300025926	Ga0207659_10623768	Ga0207659_106237681	205
113	3300025941	Ga0207711_10194796	Ga0207711_101947962	205
114	3300025945	Ga0207679_10005395	Ga0207679_100053955	205
115	3300026023	Ga0207677_10470601	Ga0207677_104706012	205
116	3300026088	Ga0207641_10103584	Ga0207641_101035842	205
117	3300026095	Ga0207676_10021440	Ga0207676_100214404	205
118	3300026121	Ga0207683_10098129	Ga0207683_100981293	205
119	3300049744	Ga0501083_0058971	Ga0501083_0058971_578_1258	205
120	3300005578	Ga0068854_100203715	Ga0068854_1002037153	206
121	3300007076	Ga0075435_100001374	Ga0075435_1000013747	206
122	3300005459	Ga0068867_100196869	Ga0068867_1001968691	207
123	3300005617	Ga0068859_100232108	Ga0068859_1002321082	207
124	3300005843	Ga0068860_100122819	Ga0068860_1001228192	207
125	3300006048	Ga0075363_100117695	Ga0075363_1001176952	207
126	3300006178	Ga0075367_10101637	Ga0075367_101016372	207
127	3300006195	Ga0075366_10011845	Ga0075366_100118454	207
128	3300006881	Ga0068865_100119722	Ga0068865_1001197222	207
129	3300006931	Ga0097620_100232114	Ga0097620_1002321141	207
130	3300009176	Ga0105242_10245520	Ga0105242_102455202	207
131	3300025938	Ga0207704_10024382	Ga0207704_100243825	207
132	3300025942	Ga0207689_10295437	Ga0207689_102954371	207
133	3300026118	Ga0207675_100036985	Ga0207675_1000369853	207
134	3300027866	Ga0209813_10008291	Ga0209813_100082914	207
135	3300050491	nmdc:mga00v17_22309_c1	nmdc:mga00v17_22309_c1_1030_1680	207
136	3300050491	nmdc:mga00v17_82195_c1	nmdc:mga00v17_82195_c1_713_1363	207
137	3300050492	nmdc:mga0yw44_175566_c1	nmdc:mga0yw44_175566_c1_66_716	207
138	3300050495	nmdc:mga04h51_31033_c1	nmdc:mga04h51_31033_c1_685_1335	207
139	3300005468	Ga0070707_100032115	Ga0070707_1000321155	208
140	3300005545	Ga0070695_100000640	Ga0070695_1000006408	208
141	3300005546	Ga0070696_100177080	Ga0070696_1001770802	208
142	3300005549	Ga0070704_100001989	Ga0070704_1000019897	208
143	3300009092	Ga0105250_10077207	Ga0105250_100772072	208
144	3300009098	Ga0105245_10001255	Ga0105245_1000125513	208
145	3300009147	Ga0114129_10007386	Ga0114129_100073869	208
146	3300009147	Ga0114129_10063350	Ga0114129_100633507	208
147	3300009147	Ga0114129_10877511	Ga0114129_108775111	208
148	3300009148	Ga0105243_10001271	Ga0105243_100012714	208
149	3300009176	Ga0105242_10000493	Ga0105242_1000049312	208
150	3300009177	Ga0105248_10057835	Ga0105248_100578354	208
151	3300009551	Ga0105238_10352875	Ga0105238_103528752	208
152	3300009553	Ga0105249_10040833	Ga0105249_100408333	208
153	3300010375	Ga0105239_10728669	Ga0105239_107286692	208
154	3300013297	Ga0157378_10001019	Ga0157378_1000101911	208
155	3300013297	Ga0157378_10027875	Ga0157378_100278755	208
156	3300014326	Ga0157380_10001806	Ga0157380_100018063	208
157	3300025922	Ga0207646_10016412	Ga0207646_100164127	208
158	3300042876	Ga0451577_0251749	Ga0451577_0251749_287_955	208
159	3300046615	Ga0495656_0411964	Ga0495656_0411964_64_690	208
160	3300049584	Ga0501068_0041235	Ga0501068_0041235_533_1207	208
161	3300049586	Ga0501070_0042938	Ga0501070_0042938_2079_2753	208
162	3300049588	Ga0501072_0044033	Ga0501072_0044033_287_961	208
163	3300049589	Ga0501073_0002736	Ga0501073_0002736_10496_11170	208
164	3300049744	Ga0501083_0145209	Ga0501083_0145209_801_1475	208
165	3300050507	nmdc:mga05p37_434042_c1	nmdc:mga05p37_434042_c1_15_641	208
166	3300050507	nmdc:mga05p37_9354_c1	nmdc:mga05p37_9354_c1_10643_11269	208
167	3300050512	nmdc:mga0n895_279610_c1	nmdc:mga0n895_279610_c1_434_1096	208
168	3300050513	nmdc:mga0rr50_22715_c1	nmdc:mga0rr50_22715_c1_291_953	208
169	3300050515	nmdc:mga0a205_334572_c1	nmdc:mga0a205_334572_c1_470_1096	208
170	3300050515	nmdc:mga0a205_88962_c1	nmdc:mga0a205_88962_c1_286_912	208
171	3300031548	Ga0307408_100016627	Ga0307408_1000166276	209
172	3300031731	Ga0307405_10526423	Ga0307405_105264232	209
173	3300032002	Ga0307416_100156129	Ga0307416_1001561293	209
174	3300009177	Ga0105248_10066465	Ga0105248_100664655	211
175	3300014969	Ga0157376_10210290	Ga0157376_102102902	211
176	3300025899	Ga0207642_10227320	Ga0207642_102273202	211
177	3300025941	Ga0207711_10149109	Ga0207711_101491092	211
178	3300005293	Ga0065715_10240325	Ga0065715_102403252	212
179	3300005333	Ga0070677_10307265	Ga0070677_103072651	212
180	3300005340	Ga0070689_100167128	Ga0070689_1001671283	212
181	3300005354	Ga0070675_100358298	Ga0070675_1003582983	212
182	3300005355	Ga0070671_100372740	Ga0070671_1003727402	212
183	3300005456	Ga0070678_100089899	Ga0070678_1000898994	212
184	3300005548	Ga0070665_100418744	Ga0070665_1004187442	212
185	3300005617	Ga0068859_100121752	Ga0068859_1001217522	212
186	3300006042	Ga0075368_10004923	Ga0075368_100049235	212
187	3300006195	Ga0075366_10048380	Ga0075366_100483802	212
188	3300006195	Ga0075366_10067733	Ga0075366_100677332	212
189	3300006353	Ga0075370_10012536	Ga0075370_100125362	212
190	3300006358	Ga0068871_100484757	Ga0068871_1004847571	212
191	3300006931	Ga0097620_100121754	Ga0097620_1001217544	212
192	3300009553	Ga0105249_10671674	Ga0105249_106716741	212
193	3300013308	Ga0157375_10366069	Ga0157375_103660692	212
194	3300014745	Ga0157377_10244629	Ga0157377_102446292	212
195	3300025893	Ga0207682_10253827	Ga0207682_102538271	212
196	3300025931	Ga0207644_10330492	Ga0207644_103304922	212
197	3300025936	Ga0207670_10070467	Ga0207670_100704673	212
198	3300025940	Ga0207691_10077968	Ga0207691_100779682	212
199	3300025945	Ga0207679_10035557	Ga0207679_100355575	212
200	3300025960	Ga0207651_10211300	Ga0207651_102113002	212
201	3300025972	Ga0207668_10195776	Ga0207668_101957763	212
202	3300026088	Ga0207641_10398600	Ga0207641_103986002	212
203	3300026121	Ga0207683_10081884	Ga0207683_100818845	212
204	3300028379	Ga0268266_10367888	Ga0268266_103678882	212
205	3300032005	Ga0307411_10367219	Ga0307411_103672192	212
206	3300041460	Ga0451802_1664961	Ga0451802_1664961_91_750	212
207	3300050493	nmdc:mga0k408_53200_c1	nmdc:mga0k408_53200_c1_1385_2044	212
208	3300053096	Ga0500641_0000556	Ga0500641_0000556_7317_8075	212
209	3300059421	Ga0590071_005602	Ga0590071_005602_831_1475	212
210	3300059426	Ga0590077_000693	Ga0590077_000693_7948_8592	212
211	3300009094	Ga0111539_10754954	Ga0111539_107549541	213
212	3300014745	Ga0157377_10203127	Ga0157377_102031272	213
213	3300042184	Ga0450908_001434	Ga0450908_001434_1413_2075	213
214	3300042531	Ga0450918_029213	Ga0450918_029213_236_898	213
215	3300035410	Ga0373924_0048422	Ga0373924_0048422_65_784	214
216	3300035692	Ga0373935_0378877	Ga0373935_0378877_126_845	214
217	3300046681	Ga0495647_0113351	Ga0495647_0113351_66_785	214
218	3300046691	Ga0495670_0176782	Ga0495670_0176782_154_840	214
219	3300005293	Ga0065715_10104254	Ga0065715_101042542	215
220	3300005328	Ga0070676_10005709	Ga0070676_100057094	215
221	3300005331	Ga0070670_100005218	Ga0070670_1000052184	215
222	3300005354	Ga0070675_100001614	Ga0070675_10000161416	215
223	3300006844	Ga0075428_100001205	Ga0075428_1000012054	215
224	3300006844	Ga0075428_100076448	Ga0075428_1000764485	215
225	3300009177	Ga0105248_10567364	Ga0105248_105673642	215
226	3300009553	Ga0105249_10303794	Ga0105249_103037942	215
227	3300014326	Ga0157380_10189646	Ga0157380_101896462	215
228	3300014326	Ga0157380_10454970	Ga0157380_104549702	215
229	3300025923	Ga0207681_10060345	Ga0207681_100603453	215
230	3300025923	Ga0207681_10212888	Ga0207681_102128882	215
231	3300025926	Ga0207659_10001033	Ga0207659_100010331	215
232	3300025940	Ga0207691_10240962	Ga0207691_102409622	215
233	3300046683	Ga0495658_0068934	Ga0495658_0068934_1239_1913	215
234	3300050508	nmdc:mga09592_282323_c1	nmdc:mga09592_282323_c1_416_1090	215
235	3300050510	nmdc:mga06r32_89512_c1	nmdc:mga06r32_89512_c1_2047_2721	215
236	3300005354	Ga0070675_100002731	Ga0070675_1000027319	216
237	3300005547	Ga0070693_100095175	Ga0070693_1000951753	216
238	3300005844	Ga0068862_100870622	Ga0068862_1008706222	216
239	3300014745	Ga0157377_10070849	Ga0157377_100708493	216
240	3300025919	Ga0207657_10141624	Ga0207657_101416242	216
241	3300025926	Ga0207659_10000072	Ga0207659_1000007238	216
242	3300025932	Ga0207690_10185792	Ga0207690_101857922	216
243	3300045976	Ga0466967_0393679	Ga0466967_0393679_466_1140	216
244	3300005354	Ga0070675_100001797	Ga0070675_1000017979	217
245	3300005365	Ga0070688_100073600	Ga0070688_1000736003	217
246	3300005834	Ga0068851_10184114	Ga0068851_101841142	217
247	3300005840	Ga0068870_10042220	Ga0068870_100422202	217
248	3300009551	Ga0105238_10032995	Ga0105238_100329956	217
249	3300014326	Ga0157380_10133551	Ga0157380_101335512	217
250	3300025321	Ga0207656_10208275	Ga0207656_102082751	217
251	3300025908	Ga0207643_10040152	Ga0207643_100401523	217
252	3300025923	Ga0207681_10051748	Ga0207681_100517483	217
253	3300025924	Ga0207694_10016148	Ga0207694_100161486	217
254	3300025926	Ga0207659_10031039	Ga0207659_100310396	217
255	3300050511	nmdc:mga08y16_775499_c1	nmdc:mga08y16_775499_c1_203_892	217
256	3300025926	Ga0207659_10039636	Ga0207659_100396362	219
257	3300053103	Ga0500555_000162	Ga0500555_000162_2565_3266	220
258	3300053730	Ga0500645_002456	Ga0500645_002456_7164_7865	220
259	3300053736	Ga0500599_002007	Ga0500599_002007_842_1543	220
260	3300005344	Ga0070661_100069257	Ga0070661_1000692572	221
261	3300005354	Ga0070675_100280641	Ga0070675_1002806413	221
262	3300005535	Ga0070684_100221572	Ga0070684_1002215723	221
263	3300005564	Ga0070664_100712770	Ga0070664_1007127701	221
264	3300006042	Ga0075368_10035491	Ga0075368_100354912	221
265	3300006042	Ga0075368_10111414	Ga0075368_101114141	221
266	3300006051	Ga0075364_10029358	Ga0075364_100293585	221
267	3300006178	Ga0075367_10018729	Ga0075367_100187295	221
268	3300006178	Ga0075367_10042576	Ga0075367_100425763	221
269	3300006195	Ga0075366_10030579	Ga0075366_100305792	221
270	3300006195	Ga0075366_10143410	Ga0075366_101434102	221
271	3300009093	Ga0105240_10084887	Ga0105240_100848876	221
272	3300009174	Ga0105241_10465541	Ga0105241_104655412	221
273	3300013105	Ga0157369_10402068	Ga0157369_104020682	221
274	3300025920	Ga0207649_10049667	Ga0207649_100496673	221
275	3300025945	Ga0207679_10651865	Ga0207679_106518651	221
276	3300026078	Ga0207702_10169741	Ga0207702_101697412	221
277	3300026121	Ga0207683_10153151	Ga0207683_101531512	221
278	3300027866	Ga0209813_10121355	Ga0209813_101213552	221
279	3300046460	Ga0495638_0094774	Ga0495638_0094774_569_1312	221
280	3300046529	Ga0495652_0119063	Ga0495652_0119063_803_1501	221
281	3300046535	Ga0495586_0096514	Ga0495586_0096514_626_1324	221
282	3300046559	Ga0495667_0076111	Ga0495667_0076111_916_1614	221
283	3300046689	Ga0495613_0018648	Ga0495613_0018648_1498_2196	221
284	3300047319	Ga0495674_0108582	Ga0495674_0108582_1382_2080	221
285	3300047471	Ga0495684_0000091	Ga0495684_0000091_48328_49026	221
286	3300050491	nmdc:mga00v17_21633_c1	nmdc:mga00v17_21633_c1_1279_2022	221
287	3300050493	nmdc:mga0k408_20377_c1	nmdc:mga0k408_20377_c1_831_1574	221
288	3300050494	nmdc:mga06z11_139129_c1	nmdc:mga06z11_139129_c1_427_1170	221
289	3300050495	nmdc:mga04h51_33478_c1	nmdc:mga04h51_33478_c1_245_991	221
290	3300053077	Ga0495601_0001700	Ga0495601_0001700_2857_3555	221
291	3300053139	Ga0500568_0003131	Ga0500568_0003131_2378_3124	221
292	3300005434	Ga0070709_10021251	Ga0070709_100212515	222
293	3300005436	Ga0070713_100011211	Ga0070713_1000112115	222
294	3300005439	Ga0070711_100027358	Ga0070711_1000273585	222
295	3300006028	Ga0070717_10615659	Ga0070717_106156592	222
296	3300025916	Ga0207663_10200864	Ga0207663_102008642	222
297	3300025928	Ga0207700_10003434	Ga0207700_100034347	222
298	3300006914	Ga0075436_100008656	Ga0075436_1000086562	223
299	3300046684	Ga0495669_0005589	Ga0495669_0005589_1383_2087	223
300	3300050514	nmdc:mga08x19_368600_c1	nmdc:mga08x19_368600_c1_204_911	223
301	3300006237	Ga0097621_100002632	Ga0097621_1000026325	224
302	3300006237	Ga0097621_100040849	Ga0097621_1000408492	224
303	3300006358	Ga0068871_100000309	Ga0068871_10000030915	224
304	3300035112	Ga0373932_0014900	Ga0373932_0014900_945_1655	224
305	3300035724	Ga0373933_0434690	Ga0373933_0434690_130_840	224
306	3300036401	Ga0373937_0567231	Ga0373937_0567231_11_721	224
307	3300046472	Ga0495580_0128683	Ga0495580_0128683_633_1343	224
308	3300048915	Ga0496112_0331371	Ga0496112_0331371_433_1143	224
309	3300005328	Ga0070676_10287981	Ga0070676_102879812	225
310	3300005329	Ga0070683_100117535	Ga0070683_1001175354	225
311	3300005336	Ga0070680_100220749	Ga0070680_1002207493	225
312	3300005458	Ga0070681_10645557	Ga0070681_106455572	225
313	3300005471	Ga0070698_100129379	Ga0070698_1001293793	225
314	3300005536	Ga0070697_100109297	Ga0070697_1001092972	225
315	3300006358	Ga0068871_100037487	Ga0068871_1000374875	225
316	3300013297	Ga0157378_10036164	Ga0157378_100361642	225
317	3300021384	Ga0213876_10073006	Ga0213876_100730063	225
318	3300031238	Ga0265332_10072831	Ga0265332_100728312	225
319	3300031239	Ga0265328_10150308	Ga0265328_101503081	225
320	3300031240	Ga0265320_10129599	Ga0265320_101295992	225
321	3300031711	Ga0265314_10012919	Ga0265314_100129196	225
322	3300039437	Ga0436365_1522203	Ga0436365_1522203_106_819	225
323	3300039437	Ga0436365_1535204	Ga0436365_1535204_1335_2048	225
324	3300046684	Ga0495669_0024017	Ga0495669_0024017_1780_2493	225
325	3300050513	nmdc:mga0rr50_83129_c1	nmdc:mga0rr50_83129_c1_841_1590	225
326	3300005468	Ga0070707_100213927	Ga0070707_1002139272	226
327	3300005548	Ga0070665_100283095	Ga0070665_1002830952	226
328	3300006852	Ga0075433_10008001	Ga0075433_100080018	226
329	3300006871	Ga0075434_100007229	Ga0075434_10000722910	226
330	3300006871	Ga0075434_100142396	Ga0075434_1001423964	226
331	3300006871	Ga0075434_100223900	Ga0075434_1002239002	226
332	3300009147	Ga0114129_10020431	Ga0114129_100204315	226
333	3300010375	Ga0105239_10067158	Ga0105239_100671584	226
334	3300048907	Ga0496104_0006115	Ga0496104_0006115_6090_6809	226
335	3300050507	nmdc:mga05p37_1171_c1	nmdc:mga05p37_1171_c1_15724_16443	226
336	3300050512	nmdc:mga0n895_309040_c1	nmdc:mga0n895_309040_c1_586_1305	226
337	3300050514	nmdc:mga08x19_94807_c1	nmdc:mga08x19_94807_c1_196_915	226
338	3300050515	nmdc:mga0a205_9054_c1	nmdc:mga0a205_9054_c1_3833_4552	226
339	3300005440	Ga0070705_100116511	Ga0070705_1001165112	227
340	2162886011	MRS1b_contig_6650149	MRS1b_0894.00002070	228
341	3300005288	Ga0065714_10100088	Ga0065714_101000882	228
342	3300005290	Ga0065712_10067842	Ga0065712_1006784222	228
343	3300005293	Ga0065715_10000734	Ga0065715_100007347	228
344	3300005328	Ga0070676_10210272	Ga0070676_102102722	228
345	3300005331	Ga0070670_100004688	Ga0070670_10000468811	228
346	3300005338	Ga0068868_100302689	Ga0068868_1003026892	228
347	3300005353	Ga0070669_100118577	Ga0070669_1001185772	228
348	3300005365	Ga0070688_100023544	Ga0070688_1000235443	228
349	3300005367	Ga0070667_100184719	Ga0070667_1001847192	228
350	3300005441	Ga0070700_100291700	Ga0070700_1002917002	228
351	3300005456	Ga0070678_100019927	Ga0070678_1000199272	228
352	3300005466	Ga0070685_10175350	Ga0070685_101753503	228
353	3300005518	Ga0070699_100012071	Ga0070699_1000120718	228
354	3300005543	Ga0070672_100009158	Ga0070672_1000091586	228
355	3300005544	Ga0070686_100030830	Ga0070686_1000308304	228
356	3300005617	Ga0068859_100089398	Ga0068859_1000893984	228
357	3300005618	Ga0068864_100048857	Ga0068864_1000488572	228
358	3300005719	Ga0068861_100075202	Ga0068861_1000752023	228
359	3300005841	Ga0068863_100088909	Ga0068863_1000889094	228
360	3300006358	Ga0068871_100031991	Ga0068871_1000319914	228
361	3300006881	Ga0068865_100206838	Ga0068865_1002068383	228
362	3300006931	Ga0097620_100089401	Ga0097620_1000894014	228
363	3300007076	Ga0075435_100293356	Ga0075435_1002933563	228
364	3300009176	Ga0105242_10124466	Ga0105242_101244662	228
365	3300009177	Ga0105248_10062678	Ga0105248_100626785	228
366	3300009553	Ga0105249_10017241	Ga0105249_100172414	228
367	3300013296	Ga0157374_10295906	Ga0157374_102959063	228
368	3300013308	Ga0157375_10400561	Ga0157375_104005612	228
369	3300014325	Ga0163163_10233850	Ga0163163_102338503	228
370	3300025899	Ga0207642_10091141	Ga0207642_100911412	228
371	3300025923	Ga0207681_10046165	Ga0207681_100461652	228
372	3300025925	Ga0207650_10003560	Ga0207650_100035604	228
373	3300025940	Ga0207691_10044378	Ga0207691_100443782	228
374	3300025941	Ga0207711_10082106	Ga0207711_100821063	228
375	3300025986	Ga0207658_10017687	Ga0207658_100176875	228
376	3300026023	Ga0207677_10110511	Ga0207677_101105113	228
377	3300026075	Ga0207708_10230400	Ga0207708_102304003	228
378	3300026095	Ga0207676_10045271	Ga0207676_100452712	228
379	3300026118	Ga0207675_100108623	Ga0207675_1001086233	228
380	3300026121	Ga0207683_10011614	Ga0207683_100116145	228
381	3300048904	Ga0496101_0369136	Ga0496101_0369136_31_759	228
382	3300048909	Ga0496106_0119479	Ga0496106_0119479_872_1600	228
383	3300048911	Ga0496108_0084682	Ga0496108_0084682_1773_2501	228
384	3300048912	Ga0496109_0019736	Ga0496109_0019736_2112_2840	228
385	3300048913	Ga0496110_0020811	Ga0496110_0020811_2787_3515	228
386	3300048915	Ga0496112_0016438	Ga0496112_0016438_1187_1915	228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

15

212

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1kaq-assembly3.cif.gz_E	structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase	0.9206	6	205
1kaq-assembly3.cif.gz_E	structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase	0.9106	6	205
1kaq-assembly3.cif.gz_F	structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase	0.9102	6	201
5das-assembly3.cif.gz_C	structure of mycobacterium tuberculosis nadd in complex with nadp, p21212, form 2	0.9098	5	206
4ymi-assembly1.cif.gz_A	crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abcessus in complex with nadp	0.9062	4	207

ID	Description	Score	Start	End	Superfamily
5virA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.891	4	206	3.40.50.620
2h2aB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.8904	4	207	3.40.50.620
5virA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.8864	4	206	3.40.50.620
2h2aB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.8859	4	207	3.40.50.620
4wsoB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.8797	4	207	3.40.50.620

ID	Description	Score	Start	End	GO Terms
AF-A0A1Q7K7Q7-F1-model_v4	Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase)	0.9732	1	208	GO:0004515 GO:0005524 GO:0009435
AF-A0A1F2S517-F1-model_v4	Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase)	0.9648	4	208	GO:0004515 GO:0005524 GO:0009435
AF-A0A1Q7MRE8-F1-model_v4	nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)	0.9624	35	208	GO:0004515 GO:0009435
AF-G9YHR2-F1-model_v4	Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase)	0.9571	5	133	GO:0004515 GO:0005524 GO:0009435
AF-A0A2E4W6X0-F1-model_v4	Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase)	0.9568	1	208	GO:0004515 GO:0005524 GO:0009435

Feature Viewer

pLDDT	pTM	Quality
83.79	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F430467

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01467

CTP_transf_like

Cytidylyltransferase-like

15

212

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map