F430349

General Info

Members Datasets Scaffolds Average Seq Length
385 239 330 292

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221596|2643991310
Length 335
Sequence GQDSGALCPSLHPLALPLCFLFSPFSAVPESARPAPLRPALSVTRRSALIGTAGLLAQPALVAPLHAKPLPPAPTVWPQALQVPGGVARLSLGPAATRPVAQLRQGEVDVPLRVVGDAIEWTAIVGIPLAAAPGDAFISVLPEGGGSPRLVHYSVAPKQYKEQHLKVSPRTVDLSPEDQARYERERDHQAQVMTTFTEQPAGVALASLRMRVPVPGRRSSSFGLRRVFNGQPRNPHSGMDIAAATGTPIVAPLPGRVIDVGDYFFNGGTVWLDHGQGLLTMYCHLSSMDVRVGDVLQAGDAFCKVGATGRVTGPHLHWGVMLNRTMVDPALFVPA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738541307 Variovorax sp. GV008 Isolate Unclassified
21 2738543012 Acidovorax sp. CF301 Isolate Unclassified
22 2738543013 Variovorax sp. BT01 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2842677519 Variovorax sp. R-72495 Isolate Unclassified
29 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
30 2842733646 Variovorax sp. R-72446 Isolate Unclassified
31 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
32 2885198086 Variovorax sp. 679 Isolate Unclassified
33 2885211737 Variovorax sp. 553 Isolate Unclassified
34 2899924645 Variovorax sp. 369 Isolate Unclassified
35 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
36 2904456579 Variovorax sp. 2002 Isolate Unclassified
37 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
38 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
39 2928037797 Variovorax sp. 1126 Isolate Unclassified
40 2928044640 Variovorax sp. 1128 Isolate Unclassified
41 2928051484 Variovorax sp. 1133 Isolate Unclassified
42 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
43 2928070936 Variovorax gossypii 1167 Isolate Unclassified
44 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
45 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
46 2929520902 Variovorax beijingensis 502 Isolate Unclassified
47 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
48 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
49 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
50 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
51 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
52 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
53 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
54 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
55 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
56 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
57 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
58 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
59 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
60 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
61 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
70 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
153 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
154 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
183 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
184 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
185 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
186 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
225 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
228 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
236 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
237 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
238 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.94
Metatranscriptomes 0.78
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 46.23
Nodule 0.78
Rhizoplane 2.34
Rhizosphere 35.58
Stem 0
Stem Tuber 0
Unclassified 15.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000175 3300002704 Bacteria 28065
2 JGI25156J39149_1000379 3300002705 Bacteria 28192
3 JGI25154J39366_1000312 3300002738 Bacteria 28149
4 JGI25157J39369_1000421 3300002741 Bacteria 28192
5 JGI25152J39213_1001695 3300002773 Bacteria 9063
6 JGI25152J39213_1002088 3300002773 Bacteria 7851
7 JGI25150J39212_1001167 3300002774 Bacteria 7863
8 JGI25159J45721_1001039 3300002987 Bacteria 11868
9 JGI25159J45721_1001754 3300002987 Bacteria 8727
10 JGI25159J45721_1009320 3300002987 Bacteria 2599
11 JGI25151J46595_10000980 3300003187 Bacteria 21645
12 JGI25151J46595_10001956 3300003187 Bacteria 13011
13 JGI25151J46595_10004800 3300003187 Bacteria 7080
14 JGI25151J46595_10019295 3300003187 Bacteria 2899
15 JGI25153J46596_10004948 3300003215 Bacteria 7080
16 rootH2_10073107 3300003320 Bacteria 1558
17 JGI25160J50197_1000126 3300003354 Bacteria 69342
18 JGI25160J50197_1002150 3300003354 Bacteria 9330
19 JGI25160J50197_1015601 3300003354 Bacteria 2487
20 JGI25161J50226_1000087 3300003374 Bacteria 75177
21 JGI25161J50226_1002492 3300003374 Bacteria 4689
22 JGI25161J50226_1003478 3300003374 Bacteria 3584
23 Ga0006562J51391_1118622 3300003578 Bacteria 4020
24 Ga0006562J51391_1118623 3300003578 Bacteria 2320
25 Ga0006562J51391_1191017 3300003578 Bacteria 1533
26 Ga0055535_1000383 3300003761 Bacteria 41879
27 Ga0055542_1000268 3300003762 Bacteria 58408
28 Ga0055526_1002989 3300003771 Bacteria 11065
29 Ga0055526_1003123 3300003771 Bacteria 10730
30 Ga0055526_1011805 3300003771 Bacteria 3882
31 Ga0055537_1000050 3300003773 Bacteria 86738
32 Ga0055537_1000084 3300003773 Bacteria 68680
33 Ga0055537_1001192 3300003773 Bacteria 11065
34 Ga0055524_1000082 3300003775 Bacteria 119749
35 Ga0055524_1001917 3300003775 Bacteria 11254
36 Ga0055524_1005717 3300003775 Bacteria 5511
37 Ga0055536_1001863 3300003781 Bacteria 12305
38 Ga0055536_1005484 3300003781 Bacteria 6188
39 Ga0055536_1045163 3300003781 Bacteria 1010
40 Ga0055534_1000035 3300003784 Bacteria 114162
41 Ga0055534_1001171 3300003784 Bacteria 11065
42 Ga0055534_1002446 3300003784 Bacteria 6417
43 Ga0055528_1002095 3300003790 Bacteria 11065
44 Ga0055528_1002233 3300003790 Bacteria 10558
45 Ga0055528_1009732 3300003790 Bacteria 3990
46 Ga0055530_10000482 3300003791 Bacteria 34748
47 Ga0055530_10003965 3300003791 Bacteria 7997
48 Ga0055530_10010712 3300003791 Bacteria 3356
49 Ga0055540_1000527 3300003792 Bacteria 28769
50 Ga0055540_1001890 3300003792 Bacteria 11740
51 Ga0055540_1004241 3300003792 Bacteria 6574
52 Ga0055540_1005320 3300003792 Bacteria 5465
53 Ga0055540_1006291 3300003792 Bacteria 4749
54 Ga0055531_10000461 3300003794 Bacteria 37626
55 Ga0055531_10002728 3300003794 Bacteria 11615
56 Ga0055531_10002917 3300003794 Bacteria 11131
57 Ga0055531_10005798 3300003794 Bacteria 7151
58 Ga0055543_1001073 3300004625 Bacteria 12023
59 Ga0055543_1002558 3300004625 Bacteria 5918
60 Ga0055543_1003768 3300004625 Bacteria 4331
61 Ga0065165_1004427 3300005262 Bacteria 8741
62 Ga0065165_1004538 3300005262 Bacteria 8488
63 Ga0065165_1005409 3300005262 Bacteria 7203
64 Ga0065165_1017431 3300005262 Bacteria 2647
65 Ga0065714_10006686 3300005288 Bacteria 4053
66 Ga0070674_100184029 3300005356 Bacteria 1602
67 Ga0070678_100122818 3300005456 Bacteria 2050
68 Ga0070679_100103408 3300005530 Bacteria 2834
69 Ga0068853_100066754 3300005539 Bacteria 3125
70 Ga0070665_100103873 3300005548 Bacteria 2844
71 Ga0068857_100264099 3300005577 Bacteria 1581
72 Ga0068851_10069786 3300005834 Bacteria 1816
73 Ga0075363_100035280 3300006048 Bacteria 2616
74 Ga0075364_10016053 3300006051 Bacteria 4652
75 Ga0075362_10007607 3300006177 Bacteria 4115
76 Ga0075362_10035072 3300006177 Bacteria 2189
77 Ga0075367_10070687 3300006178 Bacteria 2099
78 Ga0075366_10082603 3300006195 Bacteria 1919
79 Ga0075370_10001102 3300006353 Bacteria 11282
80 Ga0075370_10010342 3300006353 Bacteria 4875
81 Ga0075370_10018308 3300006353 Bacteria 3800
82 Ga0075430_100010755 3300006846 Bacteria 7754
83 Ga0075431_100413062 3300006847 Bacteria 1349
84 Ga0079104_1023356 3300006946 Bacteria 1646
85 Ga0105244_10000502 3300009036 Bacteria 35162
86 Ga0105240_10060961 3300009093 Bacteria 4702
87 Ga0105240_10825949 3300009093 Bacteria 1002
88 Ga0105243_10000443 3300009148 Bacteria 43196
89 Ga0105243_10021902 3300009148 Bacteria 4853
90 Ga0105243_10583477 3300009148 Bacteria 1073
91 Ga0105242_10320732 3300009176 Bacteria 1421
92 Ga0105237_10080281 3300009545 Bacteria 3252
93 Ga0105239_10578528 3300010375 Bacteria 1280
94 Ga0105246_10040610 3300011119 Bacteria 3141
95 Ga0105246_10193450 3300011119 Bacteria 1576
96 Ga0157347_1003533 3300012502 Bacteria 1407
97 Ga0157373_10034152 3300013100 Bacteria 3654
98 Ga0157371_10011923 3300013102 Bacteria 6668
99 Ga0157370_10019196 3300013104 Bacteria 6871
100 Ga0157375_10191718 3300013308 Bacteria 2198
101 Ga0182008_10004802 3300014497 Bacteria 7816
102 Ga0182006_1006328 3300015261 Bacteria 5515
103 Ga0182006_1026508 3300015261 Bacteria 2371
104 Ga0182007_10000238 3300015262 Bacteria 37140
105 Ga0163161_10000171 3300017792 Bacteria 59497
106 Ga0163161_10010419 3300017792 Bacteria 6437
107 Ga0163161_10059501 3300017792 Bacteria 2778
108 Ga0209435_100010 3300025206 Bacteria 475373
109 Ga0209436_102924 3300025208 Bacteria 4786
110 Ga0209436_105712 3300025208 Bacteria 2818
111 Ga0209672_101822 3300025228 Bacteria 6446
112 Ga0209147_101576 3300025229 Bacteria 7739
113 Ga0209258_100009 3300025242 Bacteria 996276
114 Ga0207425_1000266 3300025245 Bacteria 38532
115 Ga0207425_1004343 3300025245 Bacteria 4284
116 Ga0209646_1000001 3300025246 Bacteria 3092932
117 Ga0209026_1000001 3300025250 Bacteria 1228671
118 Ga0209148_1000007 3300025254 Bacteria 1592273
119 Ga0209759_1000001 3300025256 Bacteria 2799452
120 Ga0209129_1000013 3300025258 Bacteria 524874
121 Ga0209129_1004068 3300025258 Bacteria 5960
122 Ga0209129_1008594 3300025258 Bacteria 2821
123 Ga0209565_1000036 3300025263 Bacteria 293334
124 Ga0209565_1000115 3300025263 Bacteria 115272
125 Ga0209565_1000228 3300025263 Bacteria 61687
126 Ga0209565_1001264 3300025263 Bacteria 11749
127 Ga0209565_1006904 3300025263 Bacteria 3128
128 Ga0209673_1000043 3300025273 Bacteria 291503
129 Ga0209673_1000089 3300025273 Bacteria 202240
130 Ga0209673_1000309 3300025273 Bacteria 90058
131 Ga0209673_1001031 3300025273 Bacteria 32924
132 Ga0209673_1002035 3300025273 Bacteria 15362
133 Ga0209130_1000042 3300025284 Bacteria 257581
134 Ga0209130_1000151 3300025284 Bacteria 107021
135 Ga0209130_1000284 3300025284 Bacteria 62277
136 Ga0209130_1000429 3300025284 Bacteria 45047
137 Ga0209675_1000110 3300025291 Bacteria 115272
138 Ga0209675_1000574 3300025291 Bacteria 26493
139 Ga0209675_1001038 3300025291 Bacteria 17332
140 Ga0209675_1004075 3300025291 Bacteria 6655
141 Ga0209676_1000004 3300025292 Bacteria 1138360
142 Ga0209676_1000007 3300025292 Bacteria 1029371
143 Ga0209676_1000162 3300025292 Bacteria 159931
144 Ga0209676_1000206 3300025292 Bacteria 132202
145 Ga0209676_1003352 3300025292 Bacteria 9984
146 Ga0209676_1016616 3300025292 Bacteria 2646
147 Ga0209676_1021812 3300025292 Bacteria 2138
148 Ga0209025_1000133 3300025294 Bacteria 195885
149 Ga0209025_1000155 3300025294 Bacteria 169116
150 Ga0209025_1000393 3300025294 Bacteria 90571
151 Ga0209025_1007936 3300025294 Bacteria 7771
152 Ga0209025_1008293 3300025294 Bacteria 7501
153 Ga0209025_1018408 3300025294 Bacteria 3960
154 Ga0209025_1026901 3300025294 Bacteria 2870
155 Ga0209025_1054153 3300025294 Bacteria 1565
156 Ga0209564_1000222 3300025295 Bacteria 129405
157 Ga0209564_1000314 3300025295 Bacteria 95107
158 Ga0209564_1000922 3300025295 Bacteria 38243
159 Ga0209564_1002356 3300025295 Bacteria 15226
160 Ga0209564_1009386 3300025295 Bacteria 4666
161 Ga0209564_1028649 3300025295 Bacteria 1774
162 Ga0209758_1000134 3300025297 Bacteria 178294
163 Ga0209050_1000002 3300025298 Bacteria 1792849
164 Ga0209050_1000003 3300025298 Bacteria 1609245
165 Ga0209050_1000512 3300025298 Bacteria 65551
166 Ga0209050_1011483 3300025298 Bacteria 4191
167 Ga0209256_1000001 3300025299 Bacteria 2166974
168 Ga0209256_1000060 3300025299 Bacteria 262342
169 Ga0209256_1000251 3300025299 Bacteria 95107
170 Ga0207426_1000095 3300025302 Bacteria 274234
171 Ga0207426_1000097 3300025302 Bacteria 265930
172 Ga0207426_1000100 3300025302 Bacteria 262342
173 Ga0207426_1004249 3300025302 Bacteria 7108
174 Ga0209051_1000002 3300025303 Bacteria 1631846
175 Ga0209051_1000003 3300025303 Bacteria 1609245
176 Ga0209051_1000113 3300025303 Bacteria 152417
177 Ga0209051_1000311 3300025303 Bacteria 76050
178 Ga0209051_1001687 3300025303 Bacteria 17744
179 Ga0209051_1007330 3300025303 Bacteria 6049
180 Ga0209257_1000002 3300025304 Bacteria 1767052
181 Ga0209257_1000020 3300025304 Bacteria 773356
182 Ga0209257_1000432 3300025304 Bacteria 80643
183 Ga0209257_1001890 3300025304 Bacteria 22644
184 Ga0209257_1009203 3300025304 Bacteria 5364
185 Ga0209257_1009875 3300025304 Bacteria 4983
186 Ga0207655_1006798 3300025728 Bacteria 7519
187 Ga0207649_10384622 3300025920 Bacteria 1047
188 Ga0207681_10049397 3300025923 Bacteria 2843
189 Ga0207706_10004039 3300025933 Bacteria 13884
190 Ga0207686_10019122 3300025934 Bacteria 3890
191 Ga0207709_10000765 3300025935 Bacteria 25358
192 Ga0207709_10002346 3300025935 Bacteria 11946
193 Ga0207640_10127601 3300025981 Bacteria 1833
194 Ga0207676_10735024 3300026095 Bacteria 959
195 Ga0207674_10059538 3300026116 Bacteria 3864
196 Ga0207683_10149465 3300026121 Bacteria 2107
197 Ga0209282_1000241 3300027666 Bacteria 27542
198 Ga0268266_10005685 3300028379 Bacteria 11560
199 Ga0307515_10000040 3300028794 Bacteria 322704
200 Ga0307515_10004991 3300028794 Bacteria 27066
201 Ga0314311_1083831 3300030733 Bacteria 7093
202 Ga0316178_1027974 3300030735 Bacteria 5338
203 Ga0316183_1101416 3300030742 Bacteria 7008
204 Ga0265330_10000082 3300031235 Bacteria 79732
205 Ga0265332_10000014 3300031238 Bacteria 249035
206 Ga0265332_10000090 3300031238 Bacteria 79736
207 Ga0265325_10001699 3300031241 Bacteria 15293
208 Ga0265340_10014390 3300031247 Bacteria 4133
209 Ga0307513_10000011 3300031456 Bacteria 354929
210 Ga0307513_10000017 3300031456 Bacteria 282386
211 Ga0307513_10007527 3300031456 Bacteria 14093
212 Ga0307408_100000235 3300031548 Bacteria 58041
213 Ga0307408_100013101 3300031548 Bacteria 5504
214 Ga0307408_100067388 3300031548 Bacteria 2632
215 Ga0307408_100162020 3300031548 Bacteria 1777
216 Ga0307408_100385341 3300031548 Bacteria 1199
217 Ga0307514_10000858 3300031649 Bacteria 48560
218 Ga0307514_10013473 3300031649 Bacteria 6781
219 Ga0265314_10000247 3300031711 Bacteria 79736
220 Ga0307405_10008000 3300031731 Bacteria 5332
221 Ga0307405_10025501 3300031731 Bacteria 3396
222 Ga0307405_10075680 3300031731 Bacteria 2181
223 Ga0307413_10017261 3300031824 Bacteria 3755
224 Ga0307406_10000148 3300031901 Bacteria 42013
225 Ga0307407_10364546 3300031903 Bacteria 1027
226 Ga0307412_10004793 3300031911 Bacteria 7545
227 Ga0307412_10018757 3300031911 Bacteria 4172
228 Ga0307412_10030480 3300031911 Bacteria 3396
229 Ga0307412_10050636 3300031911 Bacteria 2741
230 Ga0307412_10096106 3300031911 Bacteria 2084
231 Ga0307416_100309959 3300032002 Bacteria 1574
232 Ga0307416_100346991 3300032002 Bacteria 1500
233 Ga0307416_100428327 3300032002 Bacteria 1369
234 Ga0307411_10018112 3300032005 Bacteria 4032
235 Ga0307411_10178934 3300032005 Bacteria 1607
236 Ga0439436_0001072 3300041404 Bacteria 7718
237 Ga0439436_0003231 3300041404 Bacteria 4945
238 Ga0439461_0013168 3300041410 Bacteria 1557
239 Ga0439466_0042336 3300041411 Bacteria 1516
240 Ga0439431_0039708 3300041997 Bacteria 1194
241 Ga0439433_0006092 3300041999 Bacteria 2592
242 Ga0439433_0016819 3300041999 Bacteria 1621
243 Ga0439442_003312 3300042002 Bacteria 3186
244 Ga0439442_021360 3300042002 Bacteria 1342
245 Ga0439445_0013525 3300042004 Bacteria 1976
246 Ga0439432_006104 3300042006 Bacteria 4314
247 Ga0439432_027604 3300042006 Bacteria 1852
248 Ga0439449_0017922 3300042007 Bacteria 2657
249 Ga0439449_0115027 3300042007 Bacteria 997
250 Ga0439452_003559 3300042010 Bacteria 5428
251 Ga0439452_033877 3300042010 Bacteria 1237
252 Ga0439457_026542 3300042014 Bacteria 1282
253 Ga0439462_0041985 3300042015 Bacteria 1221
254 Ga0450919_002368 3300042121 Bacteria 2443
255 Ga0450923_000889 3300042125 Bacteria 3671
256 Ga0450890_008253 3300042127 Bacteria 1332
257 Ga0450897_000847 3300042128 Bacteria 1875
258 Ga0450894_005697 3300042131 Bacteria 1612
259 Ga0450896_001870 3300042133 Bacteria 2665
260 Ga0450906_006607 3300042145 Bacteria 2330
261 Ga0450906_008637 3300042145 Bacteria 1965
262 Ga0439446_0002469 3300042156 Bacteria 4444
263 Ga0439446_0084727 3300042156 Bacteria 985
264 Ga0450909_022561 3300042185 Bacteria 942
265 Ga0439434_0004373 3300042435 Bacteria 4131
266 Ga0439459_0018245 3300042438 Bacteria 1317
267 Ga0450918_003428 3300042531 Bacteria 2944
268 Ga0450918_030495 3300042531 Bacteria 952
269 Ga0495639_0006174 3300046475 Bacteria 5143
270 Ga0495620_0017225 3300046515 Bacteria 3608
271 Ga0495631_0000213 3300046518 Bacteria 39910
272 Ga0495643_0041374 3300046522 Bacteria 2512
273 Ga0495597_0000324 3300046542 Bacteria 43211
274 Ga0495633_0001048 3300046558 Bacteria 22612
275 Ga0495656_0040970 3300046615 Bacteria 1933
276 Ga0495625_0000057 3300046660 Bacteria 181623
277 Ga0495671_0003634 3300046692 Bacteria 9398
278 Ga0496101_0008811 3300048904 Bacteria 6600
279 Ga0496101_0009254 3300048904 Bacteria 6469
280 Ga0496104_0008103 3300048907 Bacteria 9323
281 Ga0496105_0002065 3300048908 Bacteria 14517
282 Ga0496108_0133505 3300048911 Bacteria 2134
283 Ga0496110_0089874 3300048913 Bacteria 2746
284 Ga0496116_0180730 3300048919 Bacteria 1130
285 Ga0496121_0103394 3300048924 Bacteria 2191
286 Ga0496122_0035931 3300048925 Bacteria 4019
287 Ga0496122_0057103 3300048925 Bacteria 2903
288 Ga0496123_0012408 3300048926 Bacteria 7269
289 Ga0501225_0017526 3300049705 Bacteria 1988
290 Ga0501262_001398 3300049759 Bacteria 2708
291 nmdc:mga03683_20398_c1 3300050489 Bacteria 2542
292 nmdc:mga03683_5188_c1 3300050489 Bacteria 4382
293 nmdc:mga03683_82761_c1 3300050489 Bacteria 1388
294 nmdc:mga03n38_21366_c1 3300050490 Bacteria 2604
295 nmdc:mga00v17_376683_c1 3300050491 Bacteria 923
296 nmdc:mga00v17_43765_c1 3300050491 Bacteria 2698
297 nmdc:mga0yw44_224485_c1 3300050492 Bacteria 1246
298 nmdc:mga07m45_111940_c1 3300050496 Bacteria 1573
299 nmdc:mga07m45_20201_c1 3300050496 Bacteria 3618
300 nmdc:mga07m45_21037_c1 3300050496 Bacteria 3549
301 nmdc:mga07m45_2422_c1 3300050496 Bacteria 8753
302 nmdc:mga07m45_82949_c1 3300050496 Bacteria 1831
303 nmdc:mga0qj67_42526_c1 3300050509 Bacteria 3577
304 nmdc:mga06r32_196444_c1 3300050510 Bacteria 2005
305 Ga0500643_032494 3300053087 Bacteria 1584
306 Ga0500651_0012502 3300053093 Bacteria 5148
307 Ga0500641_0124664 3300053096 Bacteria 1111
308 Ga0500660_106457 3300053100 Bacteria 1208
309 Ga0500593_000169 3300053117 Bacteria 26386
310 Ga0500593_000204 3300053117 Bacteria 24136
311 Ga0500594_0000627 3300053118 Bacteria 7571
312 Ga0500626_007197 3300053128 Bacteria 4500
313 Ga0500628_085220 3300053129 Bacteria 815
314 Ga0500655_000310 3300053133 Bacteria 11029
315 Ga0500658_0002480 3300053134 Bacteria 7134
316 Ga0500568_0026128 3300053139 Bacteria 2453
317 Ga0500604_0024576 3300053151 Bacteria 1726
318 Ga0500616_0112688 3300053153 Bacteria 1311
319 Ga0500622_0000928 3300053156 Bacteria 24917
320 Ga0500622_0017055 3300053156 Bacteria 3871
321 Ga0500624_012473 3300053157 Bacteria 1257
322 Ga0500627_0000483 3300053158 Bacteria 10790
323 Ga0500634_0005136 3300053161 Bacteria 6172
324 Ga0500634_0026544 3300053161 Bacteria 3155
325 Ga0500634_0038335 3300053161 Bacteria 2606
326 Ga0500638_035970 3300053162 Bacteria 2401
327 Ga0500645_000095 3300053730 Bacteria 69280
328 Ga0500645_001296 3300053730 Bacteria 12992
329 Ga0500645_010651 3300053730 Bacteria 3029
330 Ga0500645_027889 3300053730 Bacteria 1711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053129 Ga0500628_085220 Ga0500628_085220_13_735 240
2 3300011119 Ga0105246_10193450 Ga0105246_101934502 248
3 3300048925 Ga0496122_0035931 Ga0496122_0035931_432_1355 253
4 3300048926 Ga0496123_0012408 Ga0496123_0012408_5369_6292 253
5 3300026095 Ga0207676_10735024 Ga0207676_107350242 254
6 3300025920 Ga0207649_10384622 Ga0207649_103846222 256
7 3300053134 Ga0500658_0002480 Ga0500658_0002480_2974_3912 257
8 3300053161 Ga0500634_0038335 Ga0500634_0038335_1217_2068 258
9 3300046515 Ga0495620_0017225 Ga0495620_0017225_2211_3062 259
10 3300046692 Ga0495671_0003634 Ga0495671_0003634_1286_2137 259
11 3300050491 nmdc:mga00v17_376683_c1 nmdc:mga00v17_376683_c1_21_878 259
12 3300053117 Ga0500593_000204 Ga0500593_000204_13698_14549 259
13 3300046518 Ga0495631_0000213 Ga0495631_0000213_13668_14567 261
14 3300048924 Ga0496121_0103394 Ga0496121_0103394_110_1009 261
15 3300053118 Ga0500594_0000627 Ga0500594_0000627_2682_3581 261
16 3300053153 Ga0500616_0112688 Ga0500616_0112688_364_1263 261
17 3300053158 Ga0500627_0000483 Ga0500627_0000483_6954_7805 261
18 3300003761 Ga0055535_1000383 Ga0055535_100038332 262
19 3300003762 Ga0055542_1000268 Ga0055542_100026812 262
20 3300005456 Ga0070678_100122818 Ga0070678_1001228182 262
21 3300014497 Ga0182008_10004802 Ga0182008_100048029 262
22 3300015261 Ga0182006_1026508 Ga0182006_10265082 262
23 3300017792 Ga0163161_10010419 Ga0163161_100104197 262
24 3300026121 Ga0207683_10149465 Ga0207683_101494652 262
25 3300025294 Ga0209025_1007936 Ga0209025_10079366 263
26 iso_pu_bacteria 2643221654 2644302400 263
27 iso_pu_bacteria 2939631187 2939631418 263
28 3300006846 Ga0075430_100010755 Ga0075430_1000107552 264
29 3300006847 Ga0075431_100413062 Ga0075431_1004130622 264
30 3300046558 Ga0495633_0001048 Ga0495633_0001048_16585_17502 264
31 3300050509 nmdc:mga0qj67_42526_c1 nmdc:mga0qj67_42526_c1_601_1413 264
32 3300050510 nmdc:mga06r32_196444_c1 nmdc:mga06r32_196444_c1_191_1003 264
33 3300031548 Ga0307408_100000235 Ga0307408_10000023550 266
34 3300031901 Ga0307406_10000148 Ga0307406_1000014831 266
35 3300049759 Ga0501262_001398 Ga0501262_001398_929_1816 267
36 3300053087 Ga0500643_032494 Ga0500643_032494_289_1188 267
37 3300053161 Ga0500634_0005136 Ga0500634_0005136_3705_4604 267
38 3300025295 Ga0209564_1002356 Ga0209564_10023564 268
39 3300050492 nmdc:mga0yw44_224485_c1 nmdc:mga0yw44_224485_c1_381_1208 268
40 3300005539 Ga0068853_100066754 Ga0068853_1000667546 269
41 3300025294 Ga0209025_1008293 Ga0209025_10082938 269
42 3300025295 Ga0209564_1009386 Ga0209564_10093863 269
43 3300025298 Ga0209050_1011483 Ga0209050_10114832 269
44 3300032002 Ga0307416_100309959 Ga0307416_1003099592 269
45 3300048919 Ga0496116_0180730 Ga0496116_0180730_54_938 270
46 3300053139 Ga0500568_0026128 Ga0500568_0026128_1307_2137 270
47 3300053156 Ga0500622_0000928 Ga0500622_0000928_21891_22721 270
48 3300053156 Ga0500622_0017055 Ga0500622_0017055_1882_2712 270
49 3300005530 Ga0070679_100103408 Ga0070679_1001034082 271
50 3300053128 Ga0500626_007197 Ga0500626_007197_2037_2936 271
51 3300003784 Ga0055534_1002446 Ga0055534_10024462 272
52 3300031548 Ga0307408_100067388 Ga0307408_1000673883 272
53 3300042007 Ga0439449_0115027 Ga0439449_0115027_19_858 272
54 3300025206 Ga0209435_100010 Ga0209435_100010432 273
55 3300025246 Ga0209646_1000001 Ga0209646_10000011710 273
56 3300025250 Ga0209026_1000001 Ga0209026_1000001364 273
57 3300025256 Ga0209759_1000001 Ga0209759_10000011341 273
58 3300048904 Ga0496101_0008811 Ga0496101_0008811_2119_3027 273
59 iso_pu_bacteria 2643221609 2644056977 273
60 iso_pu_bacteria 2643221611 2644076220 273
61 3300003781 Ga0055536_1001863 Ga0055536_10018634 274
62 3300003792 Ga0055540_1001890 Ga0055540_100189010 274
63 3300025292 Ga0209676_1000162 Ga0209676_100016230 274
64 3300025303 Ga0209051_1001687 Ga0209051_100168717 274
65 3300025304 Ga0209257_1009875 Ga0209257_10098753 274
66 3300025923 Ga0207681_10049397 Ga0207681_100493972 274
67 3300003354 JGI25160J50197_1000126 JGI25160J50197_100012665 275
68 3300003374 JGI25161J50226_1000087 JGI25161J50226_10000879 275
69 3300025208 Ga0209436_102924 Ga0209436_1029242 275
70 3300025245 Ga0207425_1004343 Ga0207425_10043433 275
71 3300025263 Ga0209565_1001264 Ga0209565_10012644 275
72 3300025284 Ga0209130_1000042 Ga0209130_1000042175 275
73 3300025291 Ga0209675_1004075 Ga0209675_10040752 275
74 3300025302 Ga0207426_1000097 Ga0207426_1000097181 275
75 3300031731 Ga0307405_10075680 Ga0307405_100756802 275
76 3300031911 Ga0307412_10018757 Ga0307412_100187574 275
77 3300032002 Ga0307416_100428327 Ga0307416_1004283272 275
78 3300041404 Ga0439436_0003231 Ga0439436_0003231_2790_3629 275
79 3300041410 Ga0439461_0013168 Ga0439461_0013168_558_1397 275
80 3300041999 Ga0439433_0006092 Ga0439433_0006092_446_1285 275
81 3300042002 Ga0439442_021360 Ga0439442_021360_465_1304 275
82 3300042006 Ga0439432_006104 Ga0439432_006104_753_1598 275
83 3300042007 Ga0439449_0017922 Ga0439449_0017922_1753_2598 275
84 3300042010 Ga0439452_033877 Ga0439452_033877_271_1116 275
85 3300042127 Ga0450890_008253 Ga0450890_008253_149_994 275
86 3300042128 Ga0450897_000847 Ga0450897_000847_505_1344 275
87 3300042131 Ga0450894_005697 Ga0450894_005697_621_1466 275
88 3300042145 Ga0450906_008637 Ga0450906_008637_998_1849 275
89 3300042156 Ga0439446_0084727 Ga0439446_0084727_128_967 275
90 3300042185 Ga0450909_022561 Ga0450909_022561_27_878 275
91 3300042531 Ga0450918_030495 Ga0450918_030495_93_938 275
92 iso_pu_bacteria 2738543013 2739252363 275
93 3300003771 Ga0055526_1011805 Ga0055526_10118054 276
94 3300003773 Ga0055537_1000084 Ga0055537_100008438 276
95 3300003775 Ga0055524_1000082 Ga0055524_100008267 276
96 3300003790 Ga0055528_1009732 Ga0055528_10097322 276
97 3300013104 Ga0157370_10019196 Ga0157370_100191964 276
98 3300025263 Ga0209565_1000036 Ga0209565_100003669 276
99 3300025273 Ga0209673_1000043 Ga0209673_100004323 276
100 3300025291 Ga0209675_1000574 Ga0209675_100057422 276
101 3300025295 Ga0209564_1000922 Ga0209564_100092235 276
102 3300025299 Ga0209256_1000001 Ga0209256_10000011196 276
103 3300042438 Ga0439459_0018245 Ga0439459_0018245_20_868 277
104 3300053133 Ga0500655_000310 Ga0500655_000310_2012_2950 277
105 3300053162 Ga0500638_035970 Ga0500638_035970_396_1334 277
106 iso_pu_bacteria 2885192300 2885194701 277
107 iso_pu_bacteria 2919462493 2919466381 277
108 iso_pu_bacteria 2954767861 2954771425 277
109 3300005548 Ga0070665_100103873 Ga0070665_1001038734 278
110 3300013308 Ga0157375_10191718 Ga0157375_101917182 278
111 3300028379 Ga0268266_10005685 Ga0268266_100056857 278
112 3300046475 Ga0495639_0006174 Ga0495639_0006174_2802_3659 278
113 3300046615 Ga0495656_0040970 Ga0495656_0040970_160_1029 278
114 3300048904 Ga0496101_0009254 Ga0496101_0009254_535_1404 278
115 3300048907 Ga0496104_0008103 Ga0496104_0008103_951_1820 278
116 3300048908 Ga0496105_0002065 Ga0496105_0002065_2854_3723 278
117 3300048911 Ga0496108_0133505 Ga0496108_0133505_950_1819 278
118 3300048913 Ga0496110_0089874 Ga0496110_0089874_591_1460 278
119 3300050496 nmdc:mga07m45_111940_c1 nmdc:mga07m45_111940_c1_113_961 278
120 3300053151 Ga0500604_0024576 Ga0500604_0024576_97_1020 278
121 3300053157 Ga0500624_012473 Ga0500624_012473_171_1025 278
122 3300053161 Ga0500634_0026544 Ga0500634_0026544_1338_2192 278
123 3300003578 Ga0006562J51391_1191017 Ga0006562J51391_11910172 279
124 3300025228 Ga0209672_101822 Ga0209672_1018224 279
125 3300025229 Ga0209147_101576 Ga0209147_1015768 279
126 3300025242 Ga0209258_100009 Ga0209258_100009177 279
127 3300025254 Ga0209148_1000007 Ga0209148_1000007177 279
128 3300025292 Ga0209676_1021812 Ga0209676_10218124 279
129 3300025304 Ga0209257_1009203 Ga0209257_10092037 279
130 3300031548 Ga0307408_100162020 Ga0307408_1001620203 279
131 3300053093 Ga0500651_0012502 Ga0500651_0012502_588_1454 279
132 iso_pu_bacteria 2842733646 2842735750 279
133 iso_pu_bacteria 2932422444 2932423326 279
134 3300046542 Ga0495597_0000324 Ga0495597_0000324_15590_16444 280
135 3300003187 JGI25151J46595_10001956 JGI25151J46595_1000195611 281
136 3300005356 Ga0070674_100184029 Ga0070674_1001840292 281
137 3300017792 Ga0163161_10000171 Ga0163161_1000017155 281
138 3300025294 Ga0209025_1000133 Ga0209025_100013323 281
139 3300028794 Ga0307515_10000040 Ga0307515_10000040240 281
140 3300041404 Ga0439436_0001072 Ga0439436_0001072_86_952 281
141 3300041411 Ga0439466_0042336 Ga0439466_0042336_106_972 281
142 3300041997 Ga0439431_0039708 Ga0439431_0039708_259_1125 281
143 3300041999 Ga0439433_0016819 Ga0439433_0016819_640_1506 281
144 3300042004 Ga0439445_0013525 Ga0439445_0013525_100_966 281
145 3300042006 Ga0439432_027604 Ga0439432_027604_948_1814 281
146 3300042010 Ga0439452_003559 Ga0439452_003559_119_985 281
147 3300042014 Ga0439457_026542 Ga0439457_026542_164_1030 281
148 3300042015 Ga0439462_0041985 Ga0439462_0041985_301_1167 281
149 3300042156 Ga0439446_0002469 Ga0439446_0002469_85_951 281
150 3300050489 nmdc:mga03683_82761_c1 nmdc:mga03683_82761_c1_154_1041 281
151 iso_pu_bacteria 2842718218 2842720174 281
152 iso_pu_bacteria 2904541872 2904548722 281
153 iso_pu_bacteria 2929160207 2929164613 281
154 3300003791 Ga0055530_10000482 Ga0055530_1000048211 282
155 3300003792 Ga0055540_1000527 Ga0055540_10005273 282
156 3300003794 Ga0055531_10000461 Ga0055531_1000046120 282
157 3300005262 Ga0065165_1017431 Ga0065165_10174313 282
158 3300009148 Ga0105243_10583477 Ga0105243_105834772 282
159 3300025284 Ga0209130_1000151 Ga0209130_100015160 282
160 3300025292 Ga0209676_1000007 Ga0209676_1000007315 282
161 3300025298 Ga0209050_1000003 Ga0209050_10000031193 282
162 3300025302 Ga0207426_1004249 Ga0207426_10042496 282
163 3300025303 Ga0209051_1000003 Ga0209051_10000031193 282
164 3300025304 Ga0209257_1000020 Ga0209257_1000020315 282
165 3300046522 Ga0495643_0041374 Ga0495643_0041374_901_1776 282
166 iso_pu_bacteria 2816332133 2816475984 282
167 3300005262 Ga0065165_1005409 Ga0065165_10054099 283
168 3300031649 Ga0307514_10013473 Ga0307514_100134734 283
169 3300031911 Ga0307412_10004793 Ga0307412_100047936 283
170 3300006178 Ga0075367_10070687 Ga0075367_100706872 284
171 3300017792 Ga0163161_10059501 Ga0163161_100595012 284
172 3300025934 Ga0207686_10019122 Ga0207686_100191222 284
173 3300031235 Ga0265330_10000082 Ga0265330_1000008224 284
174 3300031238 Ga0265332_10000090 Ga0265332_1000009053 284
175 3300031241 Ga0265325_10001699 Ga0265325_1000169911 284
176 3300031247 Ga0265340_10014390 Ga0265340_100143904 284
177 3300031456 Ga0307513_10000017 Ga0307513_10000017183 284
178 3300031711 Ga0265314_10000247 Ga0265314_1000024753 284
179 3300031824 Ga0307413_10017261 Ga0307413_100172614 284
180 3300032005 Ga0307411_10018112 Ga0307411_100181123 284
181 iso_pu_bacteria 2643221658 2644324933 284
182 iso_pu_bacteria 2643221683 2644467490 284
183 iso_pu_bacteria 2928084124 2928087300 284
184 iso_pu_bacteria 2974320154 2974322843 284
185 iso_pu_bacteria 2599185214 2599622762 285
186 iso_pu_bacteria 2599185226 2599671241 285
187 iso_pu_bacteria 2599185227 2599679722 285
188 iso_pu_bacteria 2599185229 2599691738 285
189 iso_pu_bacteria 2928070936 2928074557 285
190 3300053730 Ga0500645_000095 Ga0500645_000095_50440_51315 286
191 iso_pu_bacteria 2513020051 2513229402 286
192 iso_pu_bacteria 2643221672 2644396804 286
193 iso_pu_bacteria 2818991446 2819599902 286
194 iso_pu_bacteria 2831265667 2831267218 286
195 iso_pu_bacteria 2838054893 2838056314 286
196 iso_pu_bacteria 2899924645 2899926642 286
197 iso_pu_bacteria 2904449895 2904452337 286
198 iso_pu_bacteria 2904456579 2904458515 286
199 iso_pu_bacteria 2928037797 2928044272 286
200 iso_pu_bacteria 2928044640 2928048404 286
201 iso_pu_bacteria 2928051484 2928052373 286
202 iso_pu_bacteria 2928064002 2928064960 286
203 iso_pu_bacteria 2929520902 2929522260 286
204 3300003187 JGI25151J46595_10019295 JGI25151J46595_100192951 287
205 3300009148 Ga0105243_10000443 Ga0105243_1000044322 287
206 3300025294 Ga0209025_1054153 Ga0209025_10541533 287
207 3300025935 Ga0207709_10000765 Ga0207709_1000076523 287
208 iso_pu_bacteria 2738541277 2738718653 287
209 iso_pu_bacteria 2738543019 2739280671 287
210 iso_pu_bacteria 2885198086 2885204745 287
211 iso_pu_bacteria 2885211737 2885218568 287
212 iso_pu_bacteria 2945945610 2945946655 287
213 3300012502 Ga0157347_1003533 Ga0157347_10035332 288
214 3300031456 Ga0307513_10000011 Ga0307513_10000011111 288
215 iso_pu_bacteria 2547132374 2548498164 288
216 iso_pu_bacteria 2643221717 2644648691 288
217 iso_pu_bacteria 2738541307 2738884782 288
218 3300046660 Ga0495625_0000057 Ga0495625_0000057_49912_50820 289
219 iso_pu_bacteria 2511231002 2511247251 289
220 iso_pu_bacteria 2643221570 2643867447 289
221 iso_pu_bacteria 2643221628 2644160337 289
222 iso_pu_bacteria 2643221652 2644295116 289
223 iso_pu_bacteria 2842677519 2842680489 289
224 iso_pu_bacteria 2945909444 2945910777 289
225 iso_pu_bacteria 2945984333 2945987044 289
226 iso_pu_bacteria 2990710928 2990713305 289
227 3300002773 JGI25152J39213_1001695 JGI25152J39213_100169511 290
228 3300002773 JGI25152J39213_1002088 JGI25152J39213_10020886 290
229 3300002774 JGI25150J39212_1001167 JGI25150J39212_10011674 290
230 3300002987 JGI25159J45721_1001754 JGI25159J45721_10017549 290
231 3300002987 JGI25159J45721_1009320 JGI25159J45721_10093204 290
232 3300003187 JGI25151J46595_10000980 JGI25151J46595_1000098011 290
233 3300003187 JGI25151J46595_10004800 JGI25151J46595_100048006 290
234 3300003215 JGI25153J46596_10004948 JGI25153J46596_100049486 290
235 3300003320 rootH2_10073107 rootH2_100731073 290
236 3300003354 JGI25160J50197_1002150 JGI25160J50197_10021504 290
237 3300003354 JGI25160J50197_1015601 JGI25160J50197_10156014 290
238 3300003374 JGI25161J50226_1002492 JGI25161J50226_10024924 290
239 3300003374 JGI25161J50226_1003478 JGI25161J50226_10034782 290
240 3300003578 Ga0006562J51391_1118622 Ga0006562J51391_11186223 290
241 3300003578 Ga0006562J51391_1118623 Ga0006562J51391_11186231 290
242 3300003771 Ga0055526_1002989 Ga0055526_10029896 290
243 3300003771 Ga0055526_1003123 Ga0055526_10031239 290
244 3300003773 Ga0055537_1000050 Ga0055537_100005048 290
245 3300003773 Ga0055537_1001192 Ga0055537_10011926 290
246 3300003775 Ga0055524_1001917 Ga0055524_10019179 290
247 3300003775 Ga0055524_1005717 Ga0055524_10057173 290
248 3300003781 Ga0055536_1005484 Ga0055536_10054846 290
249 3300003781 Ga0055536_1045163 Ga0055536_10451631 290
250 3300003784 Ga0055534_1000035 Ga0055534_100003576 290
251 3300003784 Ga0055534_1001171 Ga0055534_10011716 290
252 3300003790 Ga0055528_1002095 Ga0055528_10020956 290
253 3300003790 Ga0055528_1002233 Ga0055528_10022334 290
254 3300003791 Ga0055530_10003965 Ga0055530_100039654 290
255 3300003791 Ga0055530_10010712 Ga0055530_100107124 290
256 3300003792 Ga0055540_1004241 Ga0055540_10042414 290
257 3300003792 Ga0055540_1005320 Ga0055540_10053204 290
258 3300003792 Ga0055540_1006291 Ga0055540_10062913 290
259 3300003794 Ga0055531_10002728 Ga0055531_1000272810 290
260 3300003794 Ga0055531_10002917 Ga0055531_100029176 290
261 3300003794 Ga0055531_10005798 Ga0055531_100057987 290
262 3300004625 Ga0055543_1002558 Ga0055543_10025584 290
263 3300004625 Ga0055543_1003768 Ga0055543_10037684 290
264 3300005262 Ga0065165_1004427 Ga0065165_10044274 290
265 3300005577 Ga0068857_100264099 Ga0068857_1002640992 290
266 3300005834 Ga0068851_10069786 Ga0068851_100697862 290
267 3300006048 Ga0075363_100035280 Ga0075363_1000352802 290
268 3300006051 Ga0075364_10016053 Ga0075364_100160534 290
269 3300006177 Ga0075362_10007607 Ga0075362_100076075 290
270 3300006177 Ga0075362_10035072 Ga0075362_100350723 290
271 3300006195 Ga0075366_10082603 Ga0075366_100826032 290
272 3300006353 Ga0075370_10001102 Ga0075370_100011029 290
273 3300006353 Ga0075370_10010342 Ga0075370_100103424 290
274 3300006353 Ga0075370_10018308 Ga0075370_100183083 290
275 3300009036 Ga0105244_10000502 Ga0105244_1000050220 290
276 3300009093 Ga0105240_10060961 Ga0105240_100609614 290
277 3300009093 Ga0105240_10825949 Ga0105240_108259491 290
278 3300009148 Ga0105243_10021902 Ga0105243_100219025 290
279 3300009176 Ga0105242_10320732 Ga0105242_103207321 290
280 3300009545 Ga0105237_10080281 Ga0105237_100802814 290
281 3300010375 Ga0105239_10578528 Ga0105239_105785282 290
282 3300011119 Ga0105246_10040610 Ga0105246_100406104 290
283 3300013100 Ga0157373_10034152 Ga0157373_100341524 290
284 3300013102 Ga0157371_10011923 Ga0157371_100119236 290
285 3300015261 Ga0182006_1006328 Ga0182006_10063282 290
286 3300015262 Ga0182007_10000238 Ga0182007_1000023842 290
287 3300025208 Ga0209436_105712 Ga0209436_1057123 290
288 3300025245 Ga0207425_1000266 Ga0207425_100026630 290
289 3300025258 Ga0209129_1000013 Ga0209129_1000013462 290
290 3300025258 Ga0209129_1004068 Ga0209129_10040686 290
291 3300025258 Ga0209129_1008594 Ga0209129_10085942 290
292 3300025263 Ga0209565_1000115 Ga0209565_100011578 290
293 3300025263 Ga0209565_1000228 Ga0209565_100022858 290
294 3300025263 Ga0209565_1006904 Ga0209565_10069042 290
295 3300025273 Ga0209673_1000089 Ga0209673_10000898 290
296 3300025273 Ga0209673_1000309 Ga0209673_100030989 290
297 3300025273 Ga0209673_1001031 Ga0209673_10010319 290
298 3300025273 Ga0209673_1002035 Ga0209673_10020357 290
299 3300025284 Ga0209130_1000284 Ga0209130_10002849 290
300 3300025284 Ga0209130_1000429 Ga0209130_100042948 290
301 3300025291 Ga0209675_1000110 Ga0209675_100011078 290
302 3300025291 Ga0209675_1001038 Ga0209675_10010386 290
303 3300025292 Ga0209676_1000004 Ga0209676_1000004331 290
304 3300025292 Ga0209676_1000206 Ga0209676_100020640 290
305 3300025292 Ga0209676_1003352 Ga0209676_10033529 290
306 3300025294 Ga0209025_1000155 Ga0209025_100015524 290
307 3300025294 Ga0209025_1000393 Ga0209025_100039312 290
308 3300025294 Ga0209025_1018408 Ga0209025_10184086 290
309 3300025294 Ga0209025_1026901 Ga0209025_10269014 290
310 3300025295 Ga0209564_1000222 Ga0209564_1000222130 290
311 3300025295 Ga0209564_1000314 Ga0209564_100031486 290
312 3300025295 Ga0209564_1028649 Ga0209564_10286493 290
313 3300025297 Ga0209758_1000134 Ga0209758_1000134172 290
314 3300025298 Ga0209050_1000002 Ga0209050_1000002841 290
315 3300025298 Ga0209050_1000512 Ga0209050_100051229 290
316 3300025299 Ga0209256_1000060 Ga0209256_1000060239 290
317 3300025299 Ga0209256_1000251 Ga0209256_100025186 290
318 3300025302 Ga0207426_1000095 Ga0207426_1000095181 290
319 3300025302 Ga0207426_1000100 Ga0207426_1000100239 290
320 3300025303 Ga0209051_1000002 Ga0209051_1000002609 290
321 3300025303 Ga0209051_1000113 Ga0209051_100011371 290
322 3300025303 Ga0209051_1000311 Ga0209051_100031112 290
323 3300025303 Ga0209051_1007330 Ga0209051_10073306 290
324 3300025304 Ga0209257_1000002 Ga0209257_1000002750 290
325 3300025304 Ga0209257_1000432 Ga0209257_100043284 290
326 3300025304 Ga0209257_1001890 Ga0209257_10018909 290
327 3300025728 Ga0207655_1006798 Ga0207655_10067986 290
328 3300025933 Ga0207706_10004039 Ga0207706_100040398 290
329 3300025935 Ga0207709_10002346 Ga0207709_100023468 290
330 3300025981 Ga0207640_10127601 Ga0207640_101276012 290
331 3300026116 Ga0207674_10059538 Ga0207674_100595382 290
332 3300027666 Ga0209282_1000241 Ga0209282_100024124 290
333 3300031548 Ga0307408_100013101 Ga0307408_1000131013 290
334 3300031731 Ga0307405_10008000 Ga0307405_100080003 290
335 3300042145 Ga0450906_006607 Ga0450906_006607_265_1158 290
336 3300048925 Ga0496122_0057103 Ga0496122_0057103_348_1259 290
337 3300050489 nmdc:mga03683_20398_c1 nmdc:mga03683_20398_c1_1264_2157 290
338 3300050489 nmdc:mga03683_5188_c1 nmdc:mga03683_5188_c1_2491_3456 290
339 3300050490 nmdc:mga03n38_21366_c1 nmdc:mga03n38_21366_c1_591_1484 290
340 3300050491 nmdc:mga00v17_43765_c1 nmdc:mga00v17_43765_c1_138_1031 290
341 3300050496 nmdc:mga07m45_20201_c1 nmdc:mga07m45_20201_c1_16_948 290
342 3300050496 nmdc:mga07m45_21037_c1 nmdc:mga07m45_21037_c1_1209_2108 290
343 3300050496 nmdc:mga07m45_2422_c1 nmdc:mga07m45_2422_c1_5096_6001 290
344 3300050496 nmdc:mga07m45_82949_c1 nmdc:mga07m45_82949_c1_412_1317 290
345 3300053117 Ga0500593_000169 Ga0500593_000169_211_1089 290
346 3300053730 Ga0500645_027889 Ga0500645_027889_555_1451 290
347 3300031731 Ga0307405_10025501 Ga0307405_100255013 291
348 3300031903 Ga0307407_10364546 Ga0307407_103645461 291
349 3300031911 Ga0307412_10030480 Ga0307412_100304802 291
350 3300032002 Ga0307416_100346991 Ga0307416_1003469912 291
351 3300032005 Ga0307411_10178934 Ga0307411_101789342 291
352 3300042002 Ga0439442_003312 Ga0439442_003312_1477_2376 291
353 3300042121 Ga0450919_002368 Ga0450919_002368_1449_2348 291
354 3300042125 Ga0450923_000889 Ga0450923_000889_2178_3077 291
355 3300042133 Ga0450896_001870 Ga0450896_001870_712_1611 291
356 3300042435 Ga0439434_0004373 Ga0439434_0004373_1064_1963 291
357 3300042531 Ga0450918_003428 Ga0450918_003428_1083_1982 291
358 iso_pu_bacteria 2945972063 2945976378 291
359 3300005288 Ga0065714_10006686 Ga0065714_100066862 292
360 3300025292 Ga0209676_1016616 Ga0209676_10166163 292
361 3300030733 Ga0314311_1083831 Ga0314311_10838316 292
362 3300030735 Ga0316178_1027974 Ga0316178_10279742 292
363 3300030742 Ga0316183_1101416 Ga0316183_11014163 292
364 3300031548 Ga0307408_100385341 Ga0307408_1003853411 292
365 3300031911 Ga0307412_10050636 Ga0307412_100506363 292
366 3300031911 Ga0307412_10096106 Ga0307412_100961061 292
367 3300049705 Ga0501225_0017526 Ga0501225_0017526_199_1113 292
368 3300053730 Ga0500645_010651 Ga0500645_010651_1130_2014 292
369 3300002987 JGI25159J45721_1001039 JGI25159J45721_10010395 293
370 3300004625 Ga0055543_1001073 Ga0055543_10010739 293
371 3300005262 Ga0065165_1004538 Ga0065165_10045383 293
372 3300028794 Ga0307515_10004991 Ga0307515_1000499121 293
373 3300031456 Ga0307513_10007527 Ga0307513_1000752710 293
374 3300031649 Ga0307514_10000858 Ga0307514_1000085820 293
375 3300053096 Ga0500641_0124664 Ga0500641_0124664_185_1078 293
376 3300053730 Ga0500645_001296 Ga0500645_001296_6152_7063 293
377 3300006946 Ga0079104_1023356 Ga0079104_10233563 294
378 3300053100 Ga0500660_106457 Ga0500660_106457_288_1175 294
379 3300031238 Ga0265332_10000014 Ga0265332_10000014203 295
380 iso_pu_bacteria 2643221596 2643991310 295
381 iso_pu_bacteria 2738543012 2739244017 295
382 3300002704 JGI25155J39150_1000175 JGI25155J39150_10001751 298
383 3300002705 JGI25156J39149_1000379 JGI25156J39149_10003791 298
384 3300002738 JGI25154J39366_1000312 JGI25154J39366_100031230 298
385 3300002741 JGI25157J39369_1000421 JGI25157J39369_10004211 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01551

Peptidase_M23

Peptidase family M23

234

329

0.97

PF18421

Peptidase_M23_N

Peptidase family M23 N-terminal domain

81

158

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuf-assembly1.cif.gz_B-2 structure of the spoiiq-spoiiiah pore forming complex. 0.9308 211 268
7qrl-assembly2.cif.gz_B lytm domain of dipm, a coordinator of a complex net of autolysins in caulobacter crescentus 0.8382 173 276
8tzl-assembly1.cif.gz_E cryo-em structure of vibrio cholerae ftse/ftsx/envc complex, full-length 0.7832 144 275
8c0j-assembly1.cif.gz_B structure of amib enzymatic domain bound to the envc lytm domain 0.7689 165 275
5nmy-assembly1.cif.gz_A nmr solution structure of lysostaphin 0.7609 181 279
ID Description Score Start End Superfamily
3tufB00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9308 211 268 2.70.70.10
2hsiB01 Mainly Beta;Sandwich;Immunoglobulin-like;Peptidoglycan hydrolase domains 0.8708 55 126 2.60.40.1590
3uz0D00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8501 198 279 2.70.70.10
4rnzA03 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8275 174 275 2.70.70.10
2hsiA02 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8174 145 296 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A212J2R3-F1-model_v4 Peptidase, M23/M37 family 0.8829 174 270 GO:0004222
AF-A0A7X9DUG0-F1-model_v4 M23 family metallopeptidase 0.882 173 275
AF-A0A6N7B149-F1-model_v4 Peptidase M23 0.8499 176 279 GO:0004222
AF-A0A531MHV7-F1-model_v4 Peptidase M23 domain-containing protein 0.8484 179 270 GO:0004222
AF-A0A7V5V765-F1-model_v4 Peptidase M23 domain-containing protein 0.8471 173 280 GO:0004222

Feature Viewer

pLDDT pTM Quality
66.5 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map