F430329

General Info

Members Datasets Scaffolds Average Seq Length
385 249 768 306

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0000309|Ga0501044_0000309_44162_45217
Length 351
Sequence LGNRDPASFIFGYGHLVGDTVALRQERRFFMKNNVIADSGQQDDTKKELDNSSHPGKSGSDELVPSRYALRVGEIDVLVVSDGVLPIPAETIASNVDATVRTAWLDDMFLPPDMLDWPLNVVVVRSGGRTILVDAGLGADPELHLPQAGRLALRLEAAGIDLASVTDVVLTHMHMDHIGGLLVDGMRDRLRPDLRVHLAAAEADFWTSPDFSRTSMPPGFPDALRSAAKRFLDEYRSELRLFKAECDVAPGVVVRRTGGHTPGHSVVRLASGADRLTFAGDAVFQVGFERPDWHNGFEHYPEEAARVRVGLLRELAATREPLVATHLSFPSVCHVAVAGDVFRCVPAVWDY

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
204 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
210 2516143018 Ensifer sp. BR816 Isolate Nodule
211 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
212 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
213 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
214 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
215 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
216 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
217 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
218 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
219 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
220 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
221 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
222 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
223 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
224 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
225 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
226 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
227 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
228 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
229 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
230 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
231 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
232 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
233 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
234 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
235 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
236 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
237 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
238 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
239 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
240 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
241 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
242 2919404418 Luteibacter sp. 3190 Isolate Unclassified
243 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
244 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
245 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
246 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
247 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
248 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
249 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.35
Metatranscriptomes 0
Isolates 10.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.51
Nodule 4.68
Rhizoplane 14.29
Rhizosphere 54.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0000309 3300049823 Bacteria 61503
2 JGI24746J21847_1001072 3300001977 Bacteria 4289
3 JGI24745J21846_1004689 3300002073 Bacteria 1471
4 JGI24744J21845_10000720 3300002077 Bacteria 6096
5 JGI25153J46596_10004043 3300003215 Bacteria 7997
6 rootL2_10070373 3300003322 Bacteria 1774
7 rootH1_10116564 3300003323 Bacteria 3120
8 Ga0055540_1000003 3300003792 Bacteria 428375
9 Ga0070690_100020659 3300005330 Bacteria 4013
10 Ga0070682_100210480 3300005337 Bacteria 1377
11 Ga0070660_100277709 3300005339 Bacteria 1370
12 Ga0070689_100207118 3300005340 Bacteria 1604
13 Ga0070691_10045830 3300005341 Bacteria 2075
14 Ga0070692_10079985 3300005345 Bacteria 1758
15 Ga0070668_100000999 3300005347 Bacteria 19811
16 Ga0070668_100078219 3300005347 Bacteria 2587
17 Ga0070675_100257169 3300005354 Bacteria 1529
18 Ga0070671_100007487 3300005355 Bacteria 8726
19 Ga0070671_100057103 3300005355 Bacteria 3247
20 Ga0070671_100134233 3300005355 Bacteria 2086
21 Ga0070673_100078348 3300005364 Bacteria 2673
22 Ga0070667_100000878 3300005367 Bacteria 27777
23 Ga0070667_100003390 3300005367 Bacteria 13580
24 Ga0070667_100012804 3300005367 Bacteria 6932
25 Ga0070667_100138114 3300005367 Bacteria 2132
26 Ga0070701_10000220 3300005438 Bacteria 17945
27 Ga0070705_100373982 3300005440 Bacteria 1046
28 Ga0070694_100241479 3300005444 Bacteria 1363
29 Ga0070708_100033417 3300005445 Bacteria 4468
30 Ga0070663_100031450 3300005455 Bacteria 3647
31 Ga0070662_100143077 3300005457 Bacteria 1855
32 Ga0070706_100023344 3300005467 Bacteria 5696
33 Ga0070706_100489328 3300005467 Bacteria 1145
34 Ga0070707_100167224 3300005468 Bacteria 2143
35 Ga0068853_100115135 3300005539 Bacteria 2392
36 Ga0070686_100152521 3300005544 Bacteria 1619
37 Ga0070695_100001322 3300005545 Bacteria 13722
38 Ga0070693_100008857 3300005547 Bacteria 4988
39 Ga0070665_100014931 3300005548 Bacteria 7797
40 Ga0070665_100090072 3300005548 Bacteria 3073
41 Ga0068855_100462321 3300005563 Bacteria 1383
42 Ga0068859_100000077 3300005617 Bacteria 91522
43 Ga0068859_100146721 3300005617 Bacteria 2434
44 Ga0068864_100260281 3300005618 Bacteria 1614
45 Ga0068863_100005688 3300005841 Bacteria 12241
46 Ga0068863_100469219 3300005841 Bacteria 1237
47 Ga0068860_100000025 3300005843 Bacteria 271553
48 Ga0068862_100000003 3300005844 Bacteria 369793
49 Ga0081455_10026955 3300005937 Bacteria 5273
50 Ga0081455_10034796 3300005937 Bacteria 4510
51 Ga0081539_10000960 3300005985 Bacteria 54037
52 Ga0075365_10027750 3300006038 Bacteria 3605
53 Ga0075365_10040712 3300006038 Bacteria 3031
54 Ga0075363_100001958 3300006048 Bacteria 8175
55 Ga0075363_100019540 3300006048 Bacteria 3388
56 Ga0075363_100023076 3300006048 Bacteria 3150
57 Ga0075363_100028090 3300006048 Bacteria 2890
58 Ga0075364_10002532 3300006051 Bacteria 10243
59 Ga0075364_10003787 3300006051 Bacteria 8650
60 Ga0075364_10099194 3300006051 Bacteria 1938
61 Ga0075364_10150799 3300006051 Bacteria 1567
62 Ga0070715_10020600 3300006163 Bacteria 2545
63 Ga0070716_100003977 3300006173 Bacteria 7017
64 Ga0075362_10016456 3300006177 Bacteria 3028
65 Ga0075367_10002452 3300006178 Bacteria 8485
66 Ga0075367_10008242 3300006178 Bacteria 5389
67 Ga0075369_10000119 3300006186 Bacteria 21759
68 Ga0075369_10016371 3300006186 Bacteria 2991
69 Ga0075366_10252618 3300006195 Bacteria 1075
70 Ga0075370_10010840 3300006353 Bacteria 4777
71 Ga0075370_10057644 3300006353 Bacteria 2208
72 Ga0075428_100055272 3300006844 Bacteria 4349
73 Ga0075430_100000056 3300006846 Bacteria 59280
74 Ga0075431_100068112 3300006847 Bacteria 3673
75 Ga0075436_100036817 3300006914 Bacteria 3378
76 Ga0097620_100000077 3300006931 Bacteria 91522
77 Ga0097620_100146715 3300006931 Bacteria 2434
78 Ga0105244_10074394 3300009036 Bacteria 1690
79 Ga0111539_10259159 3300009094 Bacteria 2025
80 Ga0105245_10416383 3300009098 Bacteria 1346
81 Ga0105247_10113636 3300009101 Bacteria 1746
82 Ga0105243_10116606 3300009148 Bacteria 2243
83 Ga0105248_10014367 3300009177 Bacteria 8713
84 Ga0105238_10042848 3300009551 Bacteria 4582
85 Ga0105249_10000010 3300009553 Bacteria 306939
86 Ga0105249_10061819 3300009553 Bacteria 3437
87 Ga0157371_10173162 3300013102 Bacteria 1543
88 Ga0157372_10006755 3300013307 Bacteria 12197
89 Ga0163163_10022121 3300014325 Bacteria 6014
90 Ga0163163_10131236 3300014325 Bacteria 2546
91 Ga0163163_10211826 3300014325 Bacteria 1987
92 Ga0157377_10084715 3300014745 Bacteria 1860
93 Ga0157379_10024426 3300014968 Bacteria 5366
94 Ga0157379_10176776 3300014968 Bacteria 1928
95 Ga0163161_10332097 3300017792 Bacteria 1204
96 Ga0209025_1001411 3300025294 Bacteria 31835
97 Ga0209758_1000861 3300025297 Bacteria 42010
98 Ga0209758_1008131 3300025297 Bacteria 6895
99 Ga0209051_1000011 3300025303 Bacteria 610828
100 Ga0207642_10006132 3300025899 Bacteria 3978
101 Ga0207710_10000028 3300025900 Bacteria 304525
102 Ga0207647_10090460 3300025904 Bacteria 1826
103 Ga0207685_10027777 3300025905 Bacteria 1985
104 Ga0207645_10028868 3300025907 Bacteria 3578
105 Ga0207645_10090860 3300025907 Bacteria 1963
106 Ga0207643_10223235 3300025908 Bacteria 1154
107 Ga0207671_10026897 3300025914 Bacteria 4303
108 Ga0207671_10083710 3300025914 Bacteria 2395
109 Ga0207671_10259255 3300025914 Bacteria 1368
110 Ga0207657_10060878 3300025919 Bacteria 3239
111 Ga0207657_10151179 3300025919 Bacteria 1891
112 Ga0207649_10191328 3300025920 Bacteria 1439
113 Ga0207681_10000859 3300025923 Bacteria 19976
114 Ga0207694_10210181 3300025924 Bacteria 1585
115 Ga0207650_10005945 3300025925 Bacteria 8330
116 Ga0207687_10002074 3300025927 Bacteria 13710
117 Ga0207644_10098627 3300025931 Bacteria 2190
118 Ga0207644_10128314 3300025931 Bacteria 1938
119 Ga0207644_10237035 3300025931 Bacteria 1451
120 Ga0207644_10275732 3300025931 Bacteria 1349
121 Ga0207690_10298442 3300025932 Bacteria 1260
122 Ga0207686_10016412 3300025934 Bacteria 4157
123 Ga0207670_10171406 3300025936 Bacteria 1628
124 Ga0207670_10223852 3300025936 Bacteria 1441
125 Ga0207669_10110223 3300025937 Bacteria 1842
126 Ga0207691_10135914 3300025940 Bacteria 2168
127 Ga0207711_10001861 3300025941 Bacteria 19226
128 Ga0207689_10140690 3300025942 Bacteria 1988
129 Ga0207661_10266083 3300025944 Bacteria 1529
130 Ga0207679_10273385 3300025945 Bacteria 1446
131 Ga0207712_10000016 3300025961 Bacteria 343014
132 Ga0207668_10007316 3300025972 Bacteria 6560
133 Ga0207668_10091883 3300025972 Bacteria 2232
134 Ga0207658_10000937 3300025986 Bacteria 24071
135 Ga0207658_10007550 3300025986 Bacteria 7406
136 Ga0207658_10100129 3300025986 Bacteria 2268
137 Ga0207703_10251641 3300026035 Bacteria 1593
138 Ga0207703_10284381 3300026035 Bacteria 1503
139 Ga0207678_10018415 3300026067 Bacteria 6132
140 Ga0207678_10110199 3300026067 Bacteria 2348
141 Ga0207708_10014677 3300026075 Bacteria 5863
142 Ga0207702_10141583 3300026078 Bacteria 2177
143 Ga0207641_10000862 3300026088 Bacteria 31969
144 Ga0207641_10038453 3300026088 Bacteria 4000
145 Ga0207641_10339467 3300026088 Bacteria 1429
146 Ga0207676_10246018 3300026095 Bacteria 1607
147 Ga0207698_10041697 3300026142 Bacteria 3423
148 Ga0209179_1010192 3300027512 Bacteria 1632
149 Ga0268266_10007966 3300028379 Bacteria 9474
150 Ga0268266_10038857 3300028379 Bacteria 4052
151 Ga0268266_10128562 3300028379 Bacteria 2264
152 Ga0268265_10000010 3300028380 Bacteria 370129
153 Ga0268264_10000053 3300028381 Bacteria 320368
154 Ga0268264_10004769 3300028381 Bacteria 11508
155 Ga0265327_10001171 3300031251 Bacteria 35592
156 Ga0265327_10001432 3300031251 Bacteria 30164
157 Ga0307410_10001303 3300031852 Bacteria 11135
158 Ga0307409_100008155 3300031995 Bacteria 6331
159 Ga0307409_100045799 3300031995 Bacteria 3306
160 Ga0307416_100003185 3300032002 Bacteria 9614
161 Ga0307415_100009342 3300032126 Bacteria 5490
162 Ga0373930_0020855 3300034816 Bacteria 1281
163 Ga0373932_0094498 3300035112 Bacteria 964
164 Ga0373936_0067687 3300035113 Bacteria 1468
165 Ga0373955_0192045 3300035172 Bacteria 1214
166 Ga0373942_0058205 3300035207 Bacteria 1101
167 Ga0373931_0008708 3300035691 Bacteria 4827
168 Ga0373931_0254799 3300035691 Bacteria 1068
169 Ga0373925_0265327 3300037068 Bacteria 1380
170 Ga0436363_1547689 3300039450 Bacteria 999
171 Ga0439465_0010222 3300041413 Bacteria 2949
172 Ga0451843_0246997 3300041509 Bacteria 3547
173 Ga0439445_0005999 3300042004 Bacteria 2783
174 Ga0439448_0007263 3300042005 Bacteria 3206
175 Ga0439448_0047492 3300042005 Bacteria 1400
176 Ga0466972_0045692 3300044658 Bacteria 2122
177 Ga0466972_0076487 3300044658 Bacteria 1594
178 Ga0466972_0106673 3300044658 Bacteria 1324
179 Ga0466972_0147488 3300044658 Bacteria 1106
180 Ga0466965_0011323 3300044683 Bacteria 4177
181 Ga0466965_0017331 3300044683 Bacteria 3442
182 Ga0466965_0159361 3300044683 Bacteria 1183
183 Ga0466963_0086239 3300044694 Bacteria 2133
184 Ga0466964_0044780 3300044706 Bacteria 1799
185 Ga0466968_0009572 3300044735 Bacteria 3729
186 Ga0466968_0031521 3300044735 Bacteria 2200
187 Ga0466968_0063166 3300044735 Bacteria 1600
188 Ga0466957_0024666 3300044842 Bacteria 3560
189 Ga0466960_0000557 3300044901 Bacteria 12860
190 Ga0466960_0006946 3300044901 Bacteria 4568
191 Ga0466959_0125653 3300045049 Bacteria 1821
192 Ga0466958_0093655 3300045836 Bacteria 1861
193 Ga0466967_0031619 3300045976 Bacteria 4458
194 Ga0466967_0068161 3300045976 Bacteria 3176
195 Ga0466967_0358782 3300045976 Bacteria 1412
196 Ga0495638_0006224 3300046460 Bacteria 8712
197 Ga0495638_0167615 3300046460 Bacteria 1262
198 Ga0495583_0089395 3300046506 Bacteria 1328
199 Ga0495633_0037630 3300046558 Bacteria 2314
200 Ga0495656_0067023 3300046615 Bacteria 1583
201 Ga0495668_0040228 3300046616 Bacteria 2608
202 Ga0495658_0013642 3300046683 Bacteria 4139
203 Ga0495658_0114367 3300046683 Bacteria 1626
204 Ga0495671_0180933 3300046692 Bacteria 1024
205 Ga0495672_0037265 3300047320 Bacteria 2977
206 Ga0495672_0091862 3300047320 Bacteria 1665
207 Ga0496100_0000041 3300048903 Bacteria 92857
208 Ga0496100_0039339 3300048903 Bacteria 3003
209 Ga0496100_0040345 3300048903 Bacteria 2969
210 Ga0496100_0052158 3300048903 Bacteria 2658
211 Ga0496100_0071925 3300048903 Bacteria 2310
212 Ga0496100_0255190 3300048903 Bacteria 1298
213 Ga0496101_0000281 3300048904 Bacteria 35945
214 Ga0496101_0016316 3300048904 Bacteria 5014
215 Ga0496101_0226764 3300048904 Bacteria 1451
216 Ga0496101_0274591 3300048904 Bacteria 1316
217 Ga0496102_0000370 3300048905 Bacteria 53972
218 Ga0496102_0003783 3300048905 Bacteria 12795
219 Ga0496102_0054084 3300048905 Bacteria 3660
220 Ga0496102_0105006 3300048905 Bacteria 2628
221 Ga0496102_0315148 3300048905 Bacteria 1474
222 Ga0496103_0023299 3300048906 Bacteria 3733
223 Ga0496103_0059727 3300048906 Bacteria 2369
224 Ga0496104_0008384 3300048907 Bacteria 9186
225 Ga0496104_0009845 3300048907 Bacteria 8528
226 Ga0496104_0124931 3300048907 Bacteria 2470
227 Ga0496104_0231566 3300048907 Bacteria 1759
228 Ga0496105_0025827 3300048908 Bacteria 4785
229 Ga0496105_0026175 3300048908 Bacteria 4755
230 Ga0496106_0008375 3300048909 Bacteria 7653
231 Ga0496106_0036521 3300048909 Bacteria 3676
232 Ga0496106_0118733 3300048909 Bacteria 2065
233 Ga0496106_0149750 3300048909 Bacteria 1840
234 Ga0496107_0001942 3300048910 Bacteria 13129
235 Ga0496107_0008417 3300048910 Bacteria 7137
236 Ga0496107_0016580 3300048910 Bacteria 5175
237 Ga0496107_0063639 3300048910 Bacteria 2673
238 Ga0496108_0001022 3300048911 Bacteria 21780
239 Ga0496108_0004059 3300048911 Bacteria 11743
240 Ga0496108_0052230 3300048911 Bacteria 3424
241 Ga0496108_0124545 3300048911 Bacteria 2212
242 Ga0496109_0000098 3300048912 Bacteria 90126
243 Ga0496109_0028203 3300048912 Bacteria 5020
244 Ga0496109_0120321 3300048912 Bacteria 2446
245 Ga0496109_0298300 3300048912 Bacteria 1519
246 Ga0496110_0000051 3300048913 Bacteria 58778
247 Ga0496110_0023212 3300048913 Bacteria 5274
248 Ga0496110_0153720 3300048913 Bacteria 2084
249 Ga0496111_0022062 3300048914 Bacteria 4454
250 Ga0496112_0006460 3300048915 Bacteria 10292
251 Ga0496112_0007465 3300048915 Bacteria 9707
252 Ga0496112_0080441 3300048915 Bacteria 3222
253 Ga0496112_0127583 3300048915 Bacteria 2514
254 Ga0496113_0023989 3300048916 Bacteria 4331
255 Ga0496113_0048553 3300048916 Bacteria 3158
256 Ga0496114_0000070 3300048917 Bacteria 73843
257 Ga0496114_0001050 3300048917 Bacteria 20757
258 Ga0496114_0021756 3300048917 Bacteria 5219
259 Ga0496115_0024603 3300048918 Bacteria 4683
260 Ga0496115_0034270 3300048918 Bacteria 4012
261 Ga0496115_0369030 3300048918 Bacteria 1168
262 Ga0496116_0004658 3300048919 Bacteria 12981
263 Ga0496116_0034122 3300048919 Bacteria 3596
264 Ga0496117_0000233 3300048920 Bacteria 105282
265 Ga0496117_0000793 3300048920 Bacteria 49582
266 Ga0496117_0005695 3300048920 Bacteria 12981
267 Ga0496118_0000817 3300048921 Bacteria 49582
268 Ga0496118_0006388 3300048921 Bacteria 12981
269 Ga0496118_0057815 3300048921 Bacteria 2903
270 Ga0496119_0007282 3300048922 Bacteria 10008
271 Ga0496119_0100616 3300048922 Bacteria 1623
272 Ga0496120_0027002 3300048923 Bacteria 3538
273 Ga0496120_0097428 3300048923 Bacteria 1560
274 Ga0496121_0000016 3300048924 Bacteria 562911
275 Ga0496121_0005063 3300048924 Bacteria 17202
276 Ga0496121_0219971 3300048924 Bacteria 1338
277 Ga0496122_0000470 3300048925 Bacteria 84015
278 Ga0496122_0016653 3300048925 Bacteria 6932
279 Ga0496123_0028313 3300048926 Bacteria 4151
280 Ga0496124_0000015 3300048927 Bacteria 460700
281 Ga0496124_0115764 3300048927 Bacteria 2150
282 Ga0496125_0000021 3300048928 Bacteria 460688
283 Ga0496125_0007343 3300048928 Bacteria 11737
284 Ga0496126_0000015 3300048929 Bacteria 663212
285 Ga0496126_0001940 3300048929 Bacteria 29487
286 Ga0496126_0009040 3300048929 Bacteria 10654
287 Ga0496126_0011590 3300048929 Bacteria 9100
288 Ga0501031_0215036 3300049568 Bacteria 1252
289 Ga0501032_0085325 3300049569 Bacteria 2099
290 Ga0501032_0178589 3300049569 Bacteria 1390
291 Ga0501036_0163160 3300049572 Bacteria 1878
292 Ga0501037_0000160 3300049573 Bacteria 62968
293 Ga0501039_0013506 3300049575 Bacteria 6245
294 Ga0501043_0057136 3300049579 Bacteria 3064
295 Ga0501043_0477739 3300049579 Bacteria 933
296 Ga0501046_0117246 3300049580 Bacteria 2028
297 Ga0501047_0189347 3300049581 Bacteria 1921
298 Ga0501073_0053582 3300049589 Bacteria 2824
299 Ga0501073_0109934 3300049589 Bacteria 1912
300 Ga0501075_0146361 3300049591 Bacteria 1800
301 Ga0501076_0113761 3300049592 Bacteria 2189
302 Ga0501077_0249241 3300049593 Bacteria 1129
303 Ga0501080_0011536 3300049742 Bacteria 8091
304 Ga0501083_0171651 3300049744 Bacteria 1417
305 Ga0501035_0017723 3300049822 Bacteria 6568
306 Ga0501035_0028731 3300049822 Bacteria 5074
307 Ga0501035_0240014 3300049822 Bacteria 1542
308 Ga0501044_0327144 3300049823 Bacteria 1456
309 Ga0501044_0503163 3300049823 Bacteria 1112
310 Ga0501045_0013736 3300049824 Bacteria 5725
311 nmdc:mga03683_186266_c1 3300050489 Bacteria 948
312 nmdc:mga03683_3011_c1 3300050489 Bacteria 5338
313 nmdc:mga03n38_123981_c1 3300050490 Bacteria 1273
314 nmdc:mga03n38_124355_c1 3300050490 Bacteria 1271
315 nmdc:mga03n38_28600_c1 3300050490 Bacteria 2325
316 nmdc:mga00v17_2842_c1 3300050491 Bacteria 8889
317 nmdc:mga00v17_344594_c1 3300050491 Bacteria 969
318 nmdc:mga00v17_39773_c1 3300050491 Bacteria 2817
319 nmdc:mga0yw44_36753_c1 3300050492 Bacteria 2888
320 nmdc:mga0k408_180176_c1 3300050493 Bacteria 1260
321 nmdc:mga06z11_108285_c1 3300050494 Bacteria 1535
322 nmdc:mga06z11_5728_c1 3300050494 Bacteria 5005
323 nmdc:mga07m45_28662_c1 3300050496 Bacteria 3073
324 nmdc:mga07m45_3839_c1 3300050496 Bacteria 7279
325 nmdc:mga07m45_5550_c2 3300050496 Bacteria 2510
326 nmdc:mga0qj67_14_c1 3300050509 Bacteria 124768
327 nmdc:mga08y16_51314_c1 3300050511 Bacteria 4316
328 nmdc:mga08x19_1876_c1 3300050514 Bacteria 12871
329 nmdc:mga0sz30_138655_c1 3300050516 Bacteria 1073
330 nmdc:mga0sz30_1493_c1 3300050516 Bacteria 8338
331 nmdc:mga0sz30_16388_c1 3300050516 Bacteria 2942
332 nmdc:mga0sz30_94181_c1 3300050516 Bacteria 1305
333 Ga0500610_0088443 3300053079 Bacteria 1610
334 Ga0500641_0019491 3300053096 Bacteria 2566
335 Ga0500577_0000122 3300053142 Bacteria 18843
336 Ga0500604_0007267 3300053151 Bacteria 2936
337 Ga0500620_060506 3300053155 Bacteria 1288
338 Ga0500627_0011840 3300053158 Bacteria 3241
339 Ga0500627_0068207 3300053158 Bacteria 1572
340 Ga0500645_000058 3300053730 Bacteria 91533
341 Ga0501084_0048519 3300054114 Bacteria 3554
342 Ga0501082_0026557 3300060353 Bacteria 4991
343 Ga0530510_0021573 3300061734 Bacteria 4583
344 2513713359 2513237103 Bacteria 7647401
345 2516206931 2516143018 Bacteria 6951533
346 2585200247 2582581294 Bacteria 6626667
347 2617350720 2617270735 Bacteria 9163226
348 2738665177 2738541264 Bacteria 5935393
349 2738707188 2738541274 Bacteria 6909446
350 2739144311 2738541356 Bacteria 5935017
351 2739333378 2738543028 Bacteria 6917070
352 2824608364 2824600985 Bacteria 8488197
353 2824616741 2824609381 Bacteria 8672835
354 2824675967 2824671348 Bacteria 8369588
355 2824692072 2824687955 Bacteria 8360029
356 2824780440 2824773399 Bacteria 8360218
357 2838075765 2838074704 Bacteria 6785777
358 2838127841 2838122688 Bacteria 8803140
359 2838692471 2838686498 Bacteria 7807632
360 2841956155 2841949485 Bacteria 8680857
361 2841976564 2841974524 Bacteria 8931498
362 2841987938 2841983080 Bacteria 8395090
363 2842042974 2842038055 Bacteria 8002051
364 2842051015 2842045827 Bacteria 8006841
365 2842136260 2842134933 Bacteria 5847019
366 2842276940 2842271015 Bacteria 7807131
367 2849081476 2849076700 Bacteria 7039503
368 2852657160 2852653556 Bacteria 4050083
369 2874169488 2874168670 Bacteria 8062617
370 2881162039 2881161766 Bacteria 7127907
371 2881670782 2881665667 Bacteria 8175609
372 2885383740 2885383462 Bacteria 9473874
373 2888422151 2888419890 Bacteria 7857137
374 2902804435 2902799365 Bacteria 5419524
375 2903449012 2903448605 Bacteria 7357801
376 2906645829 2906643746 Bacteria 8722424
377 2919405555 2919404418 Bacteria 4232372
378 2929202150 2929199973 Bacteria 7260745
379 2960608371 2960603979 Bacteria 6898737
380 2968088478 2968083720 Bacteria 7351627
381 3003933180 3003930520 Bacteria 5667563
382 643823543 643692032 Bacteria 6891900
383 8006927326 8006926726 Bacteria 6749210
384 8055913676 8055909800 Bacteria 7278581
385 Ga0501044_0000309
386 JGI24746J21847_1001072
387 JGI24745J21846_1004689
388 JGI24744J21845_10000720
389 JGI25153J46596_10004043
390 rootL2_10070373
391 rootH1_10116564
392 Ga0055540_1000003
393 Ga0070690_100020659
394 Ga0070682_100210480
395 Ga0070660_100277709
396 Ga0070689_100207118
397 Ga0070691_10045830
398 Ga0070692_10079985
399 Ga0070668_100000999
400 Ga0070668_100078219
401 Ga0070675_100257169
402 Ga0070671_100007487
403 Ga0070671_100057103
404 Ga0070671_100134233
405 Ga0070673_100078348
406 Ga0070667_100000878
407 Ga0070667_100003390
408 Ga0070667_100012804
409 Ga0070667_100138114
410 Ga0070701_10000220
411 Ga0070705_100373982
412 Ga0070694_100241479
413 Ga0070708_100033417
414 Ga0070663_100031450
415 Ga0070662_100143077
416 Ga0070706_100023344
417 Ga0070706_100489328
418 Ga0070707_100167224
419 Ga0068853_100115135
420 Ga0070686_100152521
421 Ga0070695_100001322
422 Ga0070693_100008857
423 Ga0070665_100014931
424 Ga0070665_100090072
425 Ga0068855_100462321
426 Ga0068859_100000077
427 Ga0068859_100146721
428 Ga0068864_100260281
429 Ga0068863_100005688
430 Ga0068863_100469219
431 Ga0068860_100000025
432 Ga0068862_100000003
433 Ga0081455_10026955
434 Ga0081455_10034796
435 Ga0081539_10000960
436 Ga0075365_10027750
437 Ga0075365_10040712
438 Ga0075363_100001958
439 Ga0075363_100019540
440 Ga0075363_100023076
441 Ga0075363_100028090
442 Ga0075364_10002532
443 Ga0075364_10003787
444 Ga0075364_10099194
445 Ga0075364_10150799
446 Ga0070715_10020600
447 Ga0070716_100003977
448 Ga0075362_10016456
449 Ga0075367_10002452
450 Ga0075367_10008242
451 Ga0075369_10000119
452 Ga0075369_10016371
453 Ga0075366_10252618
454 Ga0075370_10010840
455 Ga0075370_10057644
456 Ga0075428_100055272
457 Ga0075430_100000056
458 Ga0075431_100068112
459 Ga0075436_100036817
460 Ga0097620_100000077
461 Ga0097620_100146715
462 Ga0105244_10074394
463 Ga0111539_10259159
464 Ga0105245_10416383
465 Ga0105247_10113636
466 Ga0105243_10116606
467 Ga0105248_10014367
468 Ga0105238_10042848
469 Ga0105249_10000010
470 Ga0105249_10061819
471 Ga0157371_10173162
472 Ga0157372_10006755
473 Ga0163163_10022121
474 Ga0163163_10131236
475 Ga0163163_10211826
476 Ga0157377_10084715
477 Ga0157379_10024426
478 Ga0157379_10176776
479 Ga0163161_10332097
480 Ga0209025_1001411
481 Ga0209758_1000861
482 Ga0209758_1008131
483 Ga0209051_1000011
484 Ga0207642_10006132
485 Ga0207710_10000028
486 Ga0207647_10090460
487 Ga0207685_10027777
488 Ga0207645_10028868
489 Ga0207645_10090860
490 Ga0207643_10223235
491 Ga0207671_10026897
492 Ga0207671_10083710
493 Ga0207671_10259255
494 Ga0207657_10060878
495 Ga0207657_10151179
496 Ga0207649_10191328
497 Ga0207681_10000859
498 Ga0207694_10210181
499 Ga0207650_10005945
500 Ga0207687_10002074
501 Ga0207644_10098627
502 Ga0207644_10128314
503 Ga0207644_10237035
504 Ga0207644_10275732
505 Ga0207690_10298442
506 Ga0207686_10016412
507 Ga0207670_10171406
508 Ga0207670_10223852
509 Ga0207669_10110223
510 Ga0207691_10135914
511 Ga0207711_10001861
512 Ga0207689_10140690
513 Ga0207661_10266083
514 Ga0207679_10273385
515 Ga0207712_10000016
516 Ga0207668_10007316
517 Ga0207668_10091883
518 Ga0207658_10000937
519 Ga0207658_10007550
520 Ga0207658_10100129
521 Ga0207703_10251641
522 Ga0207703_10284381
523 Ga0207678_10018415
524 Ga0207678_10110199
525 Ga0207708_10014677
526 Ga0207702_10141583
527 Ga0207641_10000862
528 Ga0207641_10038453
529 Ga0207641_10339467
530 Ga0207676_10246018
531 Ga0207698_10041697
532 Ga0209179_1010192
533 Ga0268266_10007966
534 Ga0268266_10038857
535 Ga0268266_10128562
536 Ga0268265_10000010
537 Ga0268264_10000053
538 Ga0268264_10004769
539 Ga0265327_10001171
540 Ga0265327_10001432
541 Ga0307410_10001303
542 Ga0307409_100008155
543 Ga0307409_100045799
544 Ga0307416_100003185
545 Ga0307415_100009342
546 Ga0373930_0020855
547 Ga0373932_0094498
548 Ga0373936_0067687
549 Ga0373955_0192045
550 Ga0373942_0058205
551 Ga0373931_0008708
552 Ga0373931_0254799
553 Ga0373925_0265327
554 Ga0436363_1547689
555 Ga0439465_0010222
556 Ga0451843_0246997
557 Ga0439445_0005999
558 Ga0439448_0007263
559 Ga0439448_0047492
560 Ga0466972_0045692
561 Ga0466972_0076487
562 Ga0466972_0106673
563 Ga0466972_0147488
564 Ga0466965_0011323
565 Ga0466965_0017331
566 Ga0466965_0159361
567 Ga0466963_0086239
568 Ga0466964_0044780
569 Ga0466968_0009572
570 Ga0466968_0031521
571 Ga0466968_0063166
572 Ga0466957_0024666
573 Ga0466960_0000557
574 Ga0466960_0006946
575 Ga0466959_0125653
576 Ga0466958_0093655
577 Ga0466967_0031619
578 Ga0466967_0068161
579 Ga0466967_0358782
580 Ga0495638_0006224
581 Ga0495638_0167615
582 Ga0495583_0089395
583 Ga0495633_0037630
584 Ga0495656_0067023
585 Ga0495668_0040228
586 Ga0495658_0013642
587 Ga0495658_0114367
588 Ga0495671_0180933
589 Ga0495672_0037265
590 Ga0495672_0091862
591 Ga0496100_0000041
592 Ga0496100_0039339
593 Ga0496100_0040345
594 Ga0496100_0052158
595 Ga0496100_0071925
596 Ga0496100_0255190
597 Ga0496101_0000281
598 Ga0496101_0016316
599 Ga0496101_0226764
600 Ga0496101_0274591
601 Ga0496102_0000370
602 Ga0496102_0003783
603 Ga0496102_0054084
604 Ga0496102_0105006
605 Ga0496102_0315148
606 Ga0496103_0023299
607 Ga0496103_0059727
608 Ga0496104_0008384
609 Ga0496104_0009845
610 Ga0496104_0124931
611 Ga0496104_0231566
612 Ga0496105_0025827
613 Ga0496105_0026175
614 Ga0496106_0008375
615 Ga0496106_0036521
616 Ga0496106_0118733
617 Ga0496106_0149750
618 Ga0496107_0001942
619 Ga0496107_0008417
620 Ga0496107_0016580
621 Ga0496107_0063639
622 Ga0496108_0001022
623 Ga0496108_0004059
624 Ga0496108_0052230
625 Ga0496108_0124545
626 Ga0496109_0000098
627 Ga0496109_0028203
628 Ga0496109_0120321
629 Ga0496109_0298300
630 Ga0496110_0000051
631 Ga0496110_0023212
632 Ga0496110_0153720
633 Ga0496111_0022062
634 Ga0496112_0006460
635 Ga0496112_0007465
636 Ga0496112_0080441
637 Ga0496112_0127583
638 Ga0496113_0023989
639 Ga0496113_0048553
640 Ga0496114_0000070
641 Ga0496114_0001050
642 Ga0496114_0021756
643 Ga0496115_0024603
644 Ga0496115_0034270
645 Ga0496115_0369030
646 Ga0496116_0004658
647 Ga0496116_0034122
648 Ga0496117_0000233
649 Ga0496117_0000793
650 Ga0496117_0005695
651 Ga0496118_0000817
652 Ga0496118_0006388
653 Ga0496118_0057815
654 Ga0496119_0007282
655 Ga0496119_0100616
656 Ga0496120_0027002
657 Ga0496120_0097428
658 Ga0496121_0000016
659 Ga0496121_0005063
660 Ga0496121_0219971
661 Ga0496122_0000470
662 Ga0496122_0016653
663 Ga0496123_0028313
664 Ga0496124_0000015
665 Ga0496124_0115764
666 Ga0496125_0000021
667 Ga0496125_0007343
668 Ga0496126_0000015
669 Ga0496126_0001940
670 Ga0496126_0009040
671 Ga0496126_0011590
672 Ga0501031_0215036
673 Ga0501032_0085325
674 Ga0501032_0178589
675 Ga0501036_0163160
676 Ga0501037_0000160
677 Ga0501039_0013506
678 Ga0501043_0057136
679 Ga0501043_0477739
680 Ga0501046_0117246
681 Ga0501047_0189347
682 Ga0501073_0053582
683 Ga0501073_0109934
684 Ga0501075_0146361
685 Ga0501076_0113761
686 Ga0501077_0249241
687 Ga0501080_0011536
688 Ga0501083_0171651
689 Ga0501035_0017723
690 Ga0501035_0028731
691 Ga0501035_0240014
692 Ga0501044_0327144
693 Ga0501044_0503163
694 Ga0501045_0013736
695 nmdc:mga03683_186266_c1
696 nmdc:mga03683_3011_c1
697 nmdc:mga03n38_123981_c1
698 nmdc:mga03n38_124355_c1
699 nmdc:mga03n38_28600_c1
700 nmdc:mga00v17_2842_c1
701 nmdc:mga00v17_344594_c1
702 nmdc:mga00v17_39773_c1
703 nmdc:mga0yw44_36753_c1
704 nmdc:mga0k408_180176_c1
705 nmdc:mga06z11_108285_c1
706 nmdc:mga06z11_5728_c1
707 nmdc:mga07m45_28662_c1
708 nmdc:mga07m45_3839_c1
709 nmdc:mga07m45_5550_c2
710 nmdc:mga0qj67_14_c1
711 nmdc:mga08y16_51314_c1
712 nmdc:mga08x19_1876_c1
713 nmdc:mga0sz30_138655_c1
714 nmdc:mga0sz30_1493_c1
715 nmdc:mga0sz30_16388_c1
716 nmdc:mga0sz30_94181_c1
717 Ga0500610_0088443
718 Ga0500641_0019491
719 Ga0500577_0000122
720 Ga0500604_0007267
721 Ga0500620_060506
722 Ga0500627_0011840
723 Ga0500627_0068207
724 Ga0500645_000058
725 Ga0501084_0048519
726 Ga0501082_0026557
727 Ga0530510_0021573
728 2513713359
729 2516206931
730 2585200247
731 2617350720
732 2738665177
733 2738707188
734 2739144311
735 2739333378
736 2824608364
737 2824616741
738 2824675967
739 2824692072
740 2824780440
741 2838075765
742 2838127841
743 2838692471
744 2841956155
745 2841976564
746 2841987938
747 2842042974
748 2842051015
749 2842136260
750 2842276940
751 2849081476
752 2852657160
753 2874169488
754 2881162039
755 2881670782
756 2885383740
757 2888422151
758 2902804435
759 2903449012
760 2906645829
761 2919405555
762 2929202150
763 2960608371
764 2968088478
765 3003933180
766 643823543
767 8006927326
768 8055913676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

115

326

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.9105 20 303
5hif-assembly1.cif.gz_B crystal structure of a reconstructed lactonase ancestor, anc1-mph, of the bacterial methyl parathion hydrolase, mph. 0.9103 19 303
4le6-assembly1.cif.gz_A-2 crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.9069 18 303
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.8979 20 303
1p9e-assembly1.cif.gz_A crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 0.8971 19 303
ID Description Score Start End Superfamily
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9106 18 303 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9106 19 303 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.887 18 303 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.879 18 303 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8714 18 303 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A446C9G8-F1-model_v4 Putative quorum-quenching lactonase YtnP (EC 3.1.1.-) 0.9853 46 303 GO:0016787
AF-A0A446C9G8-F1-model_v4 Putative quorum-quenching lactonase YtnP (EC 3.1.1.-) 0.9778 46 303 GO:0016787
AF-A0A7X6EN54-F1-model_v4 deleted 0.9746 143 257
AF-A0A4R3QI76-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9738 152 303
AF-A0A2S8MNA1-F1-model_v4 deleted 0.9706 100 237

Map