F430304

General Info

Members Datasets Scaffolds Average Seq Length
385 200 366 354

Family's Representative Sequence

Representative Sequence 3300047323|Ga0495683_0041531|Ga0495683_0041531_877_2136
Length 419
Sequence MRAIFVKLMSSFVGQFRALVLGGKPWVAPGEAALPVTAVQLLPERSRLFVRPFLKGIADTLCLIRRNRLAFFLVLKEFGMNASSVPDNVTDDRFNEVLALIQSAKQQAMQAVNTQLIELYWQVGAYISRKLEKAEWGDSVVSQLAEHLAMSQPGLRGFTRPNLFRMRQFYETYRGDEKVSPLVRQIPWTHNLVIFSQGKLPEEREFYLRMAVQEKWSKRELERQFKAALFERSVTQPAKTSAVLRHTHPAALEIFRDAYMVEFLDLPGGHAETDLHKGLLARLKEFLIELGRDFCFVGSQYPLQVGGRDFALDLLFFHRGLNCLVAIELKVGRFEPEYLGKLDFYLEALDRNERKPHENPAIGVLLCASKDDEVVEYALNRSLSPALIAEYQTRLPDKQLLQAKLHEFYALDFEQEKSG

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231018 Pseudomonas sp. GM60 Isolate Nodule
4 2511231019 Pseudomonas sp. GM67 Isolate Nodule
5 2511231020 Pseudomonas sp. GM74 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231022 Pseudomonas sp. GM79 Isolate Nodule
8 2511231023 Pseudomonas sp. GM80 Isolate Nodule
9 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
10 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
11 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
12 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
13 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
14 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
15 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
16 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
17 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
18 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
19 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
20 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
78 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
79 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
80 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
81 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
82 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
83 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
84 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
85 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
86 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
87 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
88 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
89 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
92 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
93 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
94 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
95 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
96 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
97 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
98 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
99 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 2.34
Rhizoplane 1.04
Rhizosphere 84.68
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25163J39215_1000234 3300002771 Bacteria 20543
2 JGI25164J39214_1000059 3300002772 Bacteria 111483
3 JGI25165J46597_1000027 3300003214 Bacteria 328873
4 Ga0055536_1000133 3300003781 Bacteria 63308
5 Ga0055536_1002461 3300003781 Bacteria 10397
6 Ga0055530_10000147 3300003791 Bacteria 63296
7 Ga0055540_1001392 3300003792 Bacteria 14430
8 Ga0065714_10000039 3300005288 Bacteria 15281
9 Ga0065714_10066390 3300005288 Bacteria 6959
10 Ga0070662_100056449 3300005457 Bacteria 2850
11 Ga0070665_100294356 3300005548 Bacteria 1626
12 Ga0075432_10008797 3300006058 Bacteria 3445
13 Ga0075428_100057300 3300006844 Bacteria 4265
14 Ga0105251_10027543 3300009011 Bacteria 2880
15 Ga0105251_10059995 3300009011 Bacteria 1792
16 Ga0105244_10000154 3300009036 Bacteria 72483
17 Ga0105244_10046678 3300009036 Bacteria 2224
18 Ga0105250_10001634 3300009092 Bacteria 11952
19 Ga0105250_10046458 3300009092 Bacteria 1741
20 Ga0105243_10047025 3300009148 Bacteria 3396
21 Ga0105249_10062970 3300009553 Plasmid 3406
22 Ga0105246_10043739 3300011119 Bacteria 3040
23 Ga0157371_10001092 3300013102 Bacteria 29401
24 Ga0157371_10179867 3300013102 Bacteria 1513
25 Ga0157370_10045224 3300013104 Bacteria 4225
26 Ga0157370_10049187 3300013104 Bacteria 4036
27 Ga0157370_10068925 3300013104 Bacteria 3342
28 Ga0157370_10081316 3300013104 Bacteria 3048
29 Ga0157375_10402001 3300013308 Bacteria 1536
30 Ga0182008_10022481 3300014497 Bacteria 3230
31 Ga0182008_10100330 3300014497 Bacteria 1430
32 Ga0182006_1001817 3300015261 Bacteria 12279
33 Ga0182006_1014720 3300015261 Bacteria 3367
34 Ga0182006_1055452 3300015261 Bacteria 1513
35 Ga0182006_1055664 3300015261 Bacteria 1509
36 Ga0182005_1006595 3300015265 Bacteria 3532
37 Ga0182005_1032775 3300015265 Bacteria 1414
38 Ga0163161_10041902 3300017792 Bacteria 3291
39 Ga0213876_10056164 3300021384 Bacteria 2078
40 Ga0209760_100025 3300025207 Bacteria 156628
41 Ga0207427_100003 3300025231 Bacteria 1035004
42 Ga0209437_100002 3300025233 Bacteria 1574801
43 Ga0209233_1000004 3300025261 Bacteria 1574798
44 Ga0209676_1000003 3300025292 Bacteria 1454178
45 Ga0209676_1000109 3300025292 Bacteria 217531
46 Ga0209676_1003968 3300025292 Bacteria 8553
47 Ga0209050_1000004 3300025298 Bacteria 1600040
48 Ga0209051_1000187 3300025303 Bacteria 109779
49 Ga0209051_1030233 3300025303 Bacteria 2105
50 Ga0207696_1000130 3300025711 Bacteria 133107
51 Ga0207655_1011956 3300025728 Bacteria 5117
52 Ga0207655_1013681 3300025728 Bacteria 4640
53 Ga0207655_1017267 3300025728 Bacteria 3900
54 Ga0207655_1062643 3300025728 Bacteria 1429
55 Ga0207713_1000834 3300025735 Bacteria 28382
56 Ga0207713_1017453 3300025735 Bacteria 3598
57 Ga0207713_1022813 3300025735 Bacteria 2961
58 Ga0207713_1034694 3300025735 Bacteria 2187
59 Ga0207713_1051499 3300025735 Bacteria 1637
60 Ga0207706_10061725 3300025933 Bacteria 3301
61 Ga0207709_10000797 3300025935 Bacteria 24535
62 Ga0207709_10026471 3300025935 Bacteria 3332
63 Ga0207651_10166130 3300025960 Bacteria 1735
64 Ga0207712_10080984 3300025961 Bacteria 2363
65 Ga0209281_1000070 3300027111 Bacteria 277098
66 Ga0207428_10058446 3300027907 Bacteria 3060
67 Ga0207428_10071118 3300027907 Bacteria 2733
68 Ga0207428_10165944 3300027907 Bacteria 1675
69 Ga0207428_10259044 3300027907 Bacteria 1296
70 Ga0268264_10004070 3300028381 Bacteria 12518
71 Ga0268256_1000743 3300030500 Bacteria 23953
72 Ga0265330_10022400 3300031235 Bacteria 2875
73 Ga0265329_10005879 3300031242 Bacteria 4918
74 Ga0265331_10001250 3300031250 Bacteria 19054
75 Ga0265327_10029901 3300031251 Bacteria 3090
76 Ga0265316_10163610 3300031344 Bacteria 1663
77 Ga0307408_100037682 3300031548 Bacteria 3406
78 Ga0307514_10000330 3300031649 Bacteria 113231
79 Ga0265314_10000154 3300031711 Bacteria 103219
80 Ga0307412_10284540 3300031911 Bacteria 1299
81 Ga0373949_0000084 3300035090 Bacteria 35229
82 Ga0436360_0528171 3300039438 Bacteria 2194
83 Ga0439438_002280 3300041405 Bacteria 8223
84 Ga0439447_000861 3300041407 Bacteria 11143
85 Ga0439447_004311 3300041407 Bacteria 4926
86 Ga0439447_004607 3300041407 Bacteria 4701
87 Ga0439466_0000524 3300041411 Bacteria 14461
88 Ga0439466_0009416 3300041411 Bacteria 3647
89 Ga0439466_0014425 3300041411 Bacteria 2876
90 Ga0439466_0018453 3300041411 Bacteria 2502
91 Ga0439466_0019413 3300041411 Bacteria 2432
92 Ga0439466_0027093 3300041411 Bacteria 1986
93 Ga0439432_004759 3300042006 Bacteria 4941
94 Ga0439451_007435 3300042009 Bacteria 2232
95 Ga0439451_014072 3300042009 Bacteria 1614
96 Ga0439452_005525 3300042010 Bacteria 4059
97 Ga0439452_015088 3300042010 Bacteria 2129
98 Ga0439456_001857 3300042013 Bacteria 4263
99 Ga0439456_004490 3300042013 Bacteria 2823
100 Ga0439456_015675 3300042013 Bacteria 1583
101 Ga0439463_000055 3300042016 Bacteria 23884
102 Ga0439463_002388 3300042016 Bacteria 4785
103 Ga0450911_002564 3300042115 Bacteria 3515
104 Ga0450919_000524 3300042121 Bacteria 4799
105 Ga0450922_002993 3300042124 Bacteria 1560
106 Ga0450890_000208 3300042127 Bacteria 8856
107 Ga0450902_008009 3300042137 Bacteria 1643
108 Ga0450903_000580 3300042138 Bacteria 7514
109 Ga0450904_002795 3300042139 Bacteria 1994
110 Ga0450906_001969 3300042145 Bacteria 4490
111 Ga0450907_000150 3300042146 Bacteria 26657
112 Ga0450907_001459 3300042146 Bacteria 5098
113 Ga0450910_012293 3300042147 Bacteria 1237
114 Ga0439446_0001494 3300042156 Bacteria 5346
115 Ga0439446_0013798 3300042156 Bacteria 2222
116 Ga0450908_001582 3300042184 Bacteria 4422
117 Ga0450909_000505 3300042185 Bacteria 5097
118 Ga0439434_0002528 3300042435 Bacteria 5322
119 Ga0439434_0012790 3300042435 Bacteria 2487
120 Ga0439464_0003019 3300042439 Bacteria 4211
121 Ga0439460_0000716 3300042461 Bacteria 7392
122 Ga0450918_001244 3300042531 Bacteria 5174
123 Ga0439440_0000881 3300042993 Bacteria 5242
124 Ga0439440_0001150 3300042993 Bacteria 4735
125 Ga0453684_0002892 3300044712 Bacteria 40269
126 Ga0453684_0372934 3300044712 Bacteria 1604
127 Ga0495617_001335 3300046452 Bacteria 10967
128 Ga0495617_008127 3300046452 Bacteria 3626
129 Ga0495617_016063 3300046452 Bacteria 2532
130 Ga0495617_045639 3300046452 Bacteria 1460
131 Ga0495627_048053 3300046453 Bacteria 1292
132 Ga0495592_0028089 3300046454 Bacteria 4261
133 Ga0495603_0012326 3300046455 Bacteria 5174
134 Ga0495590_0001512 3300046457 Bacteria 10001
135 Ga0495590_0001655 3300046457 Bacteria 9500
136 Ga0495591_006610 3300046458 Bacteria 5089
137 Ga0495591_009230 3300046458 Bacteria 3939
138 Ga0495591_010133 3300046458 Bacteria 3680
139 Ga0495629_0244290 3300046459 Bacteria 1236
140 Ga0495638_0016267 3300046460 Bacteria 4984
141 Ga0495638_0031235 3300046460 Bacteria 3424
142 Ga0495638_0133881 3300046460 Bacteria 1453
143 Ga0495638_0150684 3300046460 Bacteria 1349
144 Ga0495653_0018691 3300046463 Bacteria 5626
145 Ga0495650_0012505 3300046471 Bacteria 4561
146 Ga0495650_0015022 3300046471 Bacteria 3994
147 Ga0495650_0036376 3300046471 Bacteria 2155
148 Ga0495605_0000106 3300046474 Bacteria 105494
149 Ga0495605_0005887 3300046474 Bacteria 7084
150 Ga0495605_0007011 3300046474 Bacteria 6431
151 Ga0495584_0003630 3300046491 Bacteria 8417
152 Ga0495584_0005693 3300046491 Bacteria 6581
153 Ga0495584_0040085 3300046491 Bacteria 2365
154 Ga0495584_0042707 3300046491 Bacteria 2288
155 Ga0495584_0069814 3300046491 Bacteria 1765
156 Ga0495584_0083587 3300046491 Bacteria 1607
157 Ga0495584_0108570 3300046491 Bacteria 1403
158 Ga0495585_0011040 3300046492 Bacteria 5362
159 Ga0495585_0019218 3300046492 Bacteria 3942
160 Ga0495585_0042310 3300046492 Bacteria 2552
161 Ga0495585_0055111 3300046492 Bacteria 2197
162 Ga0495594_0100560 3300046499 Bacteria 1626
163 Ga0495607_0009149 3300046501 Bacteria 6733
164 Ga0495607_0017946 3300046501 Bacteria 4525
165 Ga0495607_0057487 3300046501 Bacteria 2228
166 Ga0495607_0057742 3300046501 Bacteria 2222
167 Ga0495583_0005820 3300046506 Bacteria 8229
168 Ga0495606_0000789 3300046507 Bacteria 48426
169 Ga0495606_0007147 3300046507 Bacteria 10086
170 Ga0495606_0015918 3300046507 Bacteria 5767
171 Ga0495606_0023327 3300046507 Bacteria 4486
172 Ga0495606_0085168 3300046507 Bacteria 1955
173 Ga0495610_0002150 3300046512 Bacteria 16757
174 Ga0495610_0004121 3300046512 Bacteria 10874
175 Ga0495610_0014172 3300046512 Bacteria 4699
176 Ga0495610_0014503 3300046512 Bacteria 4625
177 Ga0495610_0024202 3300046512 Bacteria 3282
178 Ga0495610_0032130 3300046512 Bacteria 2731
179 Ga0495616_0002466 3300046513 Bacteria 12266
180 Ga0495616_0012075 3300046513 Bacteria 4916
181 Ga0495616_0013006 3300046513 Bacteria 4706
182 Ga0495616_0017715 3300046513 Bacteria 3924
183 Ga0495620_0002668 3300046515 Bacteria 10306
184 Ga0495620_0007123 3300046515 Bacteria 6094
185 Ga0495620_0013351 3300046515 Bacteria 4207
186 Ga0495620_0048494 3300046515 Bacteria 1823
187 Ga0495620_0083159 3300046515 Bacteria 1293
188 Ga0495631_0009891 3300046518 Bacteria 4742
189 Ga0495631_0115974 3300046518 Bacteria 1151
190 Ga0495632_0008571 3300046519 Bacteria 6252
191 Ga0495632_0014089 3300046519 Bacteria 4536
192 Ga0495632_0031301 3300046519 Bacteria 2752
193 Ga0495637_0008385 3300046520 Bacteria 5081
194 Ga0495637_0012670 3300046520 Bacteria 4026
195 Ga0495637_0013471 3300046520 Bacteria 3878
196 Ga0495637_0023210 3300046520 Bacteria 2822
197 Ga0495637_0051340 3300046520 Bacteria 1726
198 Ga0495637_0058331 3300046520 Bacteria 1591
199 Ga0495643_0002478 3300046522 Bacteria 14544
200 Ga0495643_0116712 3300046522 Bacteria 1352
201 Ga0495644_0087821 3300046523 Bacteria 1172
202 Ga0495648_0005886 3300046524 Bacteria 10079
203 Ga0495648_0008998 3300046524 Bacteria 7796
204 Ga0495648_0018321 3300046524 Bacteria 4963
205 Ga0495648_0038793 3300046524 Bacteria 3040
206 Ga0495648_0064922 3300046524 Bacteria 2148
207 Ga0495666_0014777 3300046526 Bacteria 3885
208 Ga0495642_0000688 3300046528 Bacteria 16776
209 Ga0495654_0002193 3300046530 Bacteria 12663
210 Ga0495654_0005920 3300046530 Bacteria 7029
211 Ga0495654_0018829 3300046530 Bacteria 3613
212 Ga0495654_0036513 3300046530 Bacteria 2468
213 Ga0495609_0002027 3300046538 Bacteria 12787
214 Ga0495609_0035128 3300046538 Bacteria 2269
215 Ga0495597_0010765 3300046542 Bacteria 4456
216 Ga0495597_0025056 3300046542 Bacteria 2748
217 Ga0495597_0099801 3300046542 Bacteria 1225
218 Ga0495645_0027195 3300046543 Bacteria 4154
219 Ga0495622_0003365 3300046557 Bacteria 7546
220 Ga0495622_0013976 3300046557 Bacteria 3726
221 Ga0495622_0039108 3300046557 Bacteria 2208
222 Ga0495633_0016624 3300046558 Bacteria 3787
223 Ga0495633_0102167 3300046558 Bacteria 1331
224 Ga0495656_0022422 3300046615 Bacteria 2472
225 Ga0495668_0003494 3300046616 Bacteria 11721
226 Ga0495668_0007488 3300046616 Bacteria 6970
227 Ga0495634_0026389 3300046642 Bacteria 4055
228 Ga0495611_0009577 3300046648 Bacteria 4093
229 Ga0495625_0022464 3300046660 Bacteria 4837
230 Ga0495625_0101466 3300046660 Bacteria 1976
231 Ga0495625_0139209 3300046660 Bacteria 1638
232 Ga0495659_0052521 3300046664 Bacteria 1487
233 Ga0495661_0035169 3300046665 Bacteria 3146
234 Ga0495661_0046057 3300046665 Bacteria 2664
235 Ga0495661_0070377 3300046665 Bacteria 2047
236 Ga0495588_0025633 3300046674 Bacteria 2939
237 Ga0495588_0043929 3300046674 Bacteria 2287
238 Ga0495669_0007224 3300046684 Bacteria 4656
239 Ga0495669_0042999 3300046684 Bacteria 2010
240 Ga0495613_0118316 3300046689 Bacteria 1904
241 Ga0495624_0014970 3300046690 Bacteria 5252
242 Ga0495670_0000750 3300046691 Bacteria 15551
243 Ga0495670_0002706 3300046691 Bacteria 8754
244 Ga0495670_0009049 3300046691 Bacteria 4899
245 Ga0495670_0013055 3300046691 Bacteria 4084
246 Ga0495671_0012596 3300046692 Bacteria 4612
247 Ga0495671_0019807 3300046692 Bacteria 3552
248 Ga0495671_0043559 3300046692 Bacteria 2253
249 Ga0495671_0121137 3300046692 Bacteria 1276
250 Ga0495649_0000920 3300046694 Bacteria 23308
251 Ga0495649_0002550 3300046694 Bacteria 12763
252 Ga0495649_0003951 3300046694 Bacteria 9795
253 Ga0495649_0014452 3300046694 Bacteria 4523
254 Ga0495649_0015346 3300046694 Bacteria 4362
255 Ga0495649_0018209 3300046694 Bacteria 3956
256 Ga0495649_0023252 3300046694 Bacteria 3463
257 Ga0495649_0133852 3300046694 Bacteria 1307
258 Ga0495589_0005299 3300046794 Bacteria 6812
259 Ga0495589_0011757 3300046794 Bacteria 4540
260 Ga0495589_0018799 3300046794 Bacteria 3542
261 Ga0495589_0059242 3300046794 Bacteria 1882
262 Ga0495600_0018008 3300046809 Bacteria 4497
263 Ga0495660_0002230 3300046810 Bacteria 12466
264 Ga0495660_0027330 3300046810 Bacteria 3229
265 Ga0495660_0033350 3300046810 Bacteria 2887
266 Ga0495660_0075131 3300046810 Bacteria 1783
267 Ga0495660_0092782 3300046810 Bacteria 1566
268 Ga0495636_0003292 3300047318 Bacteria 6258
269 Ga0495636_0037221 3300047318 Bacteria 2009
270 Ga0495672_0002327 3300047320 Bacteria 17622
271 Ga0495672_0006285 3300047320 Bacteria 9249
272 Ga0495672_0008468 3300047320 Bacteria 7584
273 Ga0495672_0015957 3300047320 Bacteria 5084
274 Ga0495672_0028761 3300047320 Bacteria 3509
275 Ga0495672_0069206 3300047320 Bacteria 2004
276 Ga0495676_0032455 3300047321 Bacteria 4406
277 Ga0495680_0036134 3300047322 Bacteria 3970
278 Ga0495683_0002976 3300047323 Bacteria 10005
279 Ga0495683_0016148 3300047323 Bacteria 3877
280 Ga0495683_0041531 3300047323 Bacteria 2320
281 Ga0495687_002632 3300047443 Bacteria 14064
282 Ga0495687_003817 3300047443 Bacteria 10625
283 Ga0495687_008041 3300047443 Bacteria 6095
284 Ga0495677_0005401 3300047445 Bacteria 4846
285 Ga0495679_007650 3300047446 Bacteria 4480
286 Ga0495679_009240 3300047446 Bacteria 3958
287 Ga0495679_014110 3300047446 Bacteria 2973
288 Ga0495673_0001605 3300047469 Bacteria 17595
289 Ga0495673_0002737 3300047469 Bacteria 12081
290 Ga0495673_0014062 3300047469 Bacteria 4174
291 Ga0495673_0022295 3300047469 Bacteria 3107
292 Ga0495673_0040937 3300047469 Bacteria 2089
293 Ga0495673_0042602 3300047469 Bacteria 2036
294 Ga0495673_0076763 3300047469 Bacteria 1392
295 Ga0495681_0006776 3300047470 Bacteria 7453
296 Ga0495681_0007364 3300047470 Bacteria 7040
297 Ga0495681_0009004 3300047470 Bacteria 6195
298 Ga0495681_0013676 3300047470 Bacteria 4695
299 Ga0495681_0018879 3300047470 Bacteria 3784
300 Ga0495681_0044473 3300047470 Bacteria 2133
301 Ga0495681_0057309 3300047470 Bacteria 1810
302 Ga0495684_0029966 3300047471 Bacteria 4177
303 Ga0495686_0009991 3300047472 Bacteria 6784
304 Ga0495593_0043767 3300047673 Bacteria 2397
305 Ga0495593_0116775 3300047673 Bacteria 1359
306 Ga0495602_0037686 3300048088 Bacteria 4481
307 Ga0495614_0083808 3300048089 Bacteria 1383
308 Ga0495626_0000881 3300048091 Bacteria 26581
309 Ga0495626_0001573 3300048091 Bacteria 17887
310 Ga0495626_0010983 3300048091 Bacteria 4805
311 Ga0495626_0014099 3300048091 Bacteria 4134
312 Ga0495626_0024733 3300048091 Bacteria 2942
313 Ga0496106_0147823 3300048909 Bacteria 1852
314 Ga0496110_0283935 3300048913 Bacteria 1507
315 Ga0496116_0000221 3300048919 Bacteria 106314
316 Ga0496116_0025435 3300048919 Bacteria 4350
317 Ga0496117_0023161 3300048920 Bacteria 4958
318 Ga0496117_0025253 3300048920 Bacteria 4676
319 Ga0496117_0056400 3300048920 Bacteria 2736
320 Ga0496118_0002156 3300048921 Bacteria 27424
321 Ga0496118_0011347 3300048921 Bacteria 8709
322 Ga0496118_0015572 3300048921 Bacteria 7032
323 Ga0496118_0146316 3300048921 Bacteria 1487
324 Ga0496120_0026778 3300048923 Bacteria 3556
325 Ga0496121_0208033 3300048924 Bacteria 1388
326 Ga0496122_0001763 3300048925 Bacteria 33210
327 Ga0496122_0015220 3300048925 Bacteria 7361
328 Ga0496122_0031383 3300048925 Bacteria 4423
329 Ga0496122_0098406 3300048925 Bacteria 1964
330 Ga0496123_0000207 3300048926 Bacteria 120277
331 Ga0496123_0005421 3300048926 Bacteria 12852
332 Ga0496123_0011583 3300048926 Bacteria 7624
333 Ga0496123_0048265 3300048926 Bacteria 2865
334 Ga0496124_0021838 3300048927 Bacteria 5887
335 Ga0496124_0132286 3300048927 Bacteria 1980
336 Ga0496124_0269925 3300048927 Bacteria 1246
337 Ga0496125_0018390 3300048928 Bacteria 6639
338 Ga0496125_0028646 3300048928 Bacteria 5024
339 Ga0496126_0278734 3300048929 Bacteria 1385
340 Ga0495678_003513 3300049459 Bacteria 9642
341 Ga0495678_010486 3300049459 Bacteria 4504
342 Ga0495678_014240 3300049459 Bacteria 3705
343 Ga0495678_016412 3300049459 Bacteria 3386
344 Ga0495678_018327 3300049459 Bacteria 3150
345 Ga0495682_0028622 3300049460 Bacteria 2064
346 Ga0495682_0046800 3300049460 Bacteria 1578
347 Ga0495682_0082307 3300049460 Bacteria 1157
348 Ga0501034_0001905 3300049571 Bacteria 26410
349 Ga0501036_0006836 3300049572 Bacteria 9268
350 Ga0501037_0139666 3300049573 Bacteria 1734
351 Ga0501038_0061094 3300049574 Bacteria 3223
352 Ga0501039_0056589 3300049575 Bacteria 3038
353 Ga0501042_0232181 3300049578 Bacteria 1331
354 Ga0501043_0025525 3300049579 Bacteria 4637
355 Ga0501046_0003572 3300049580 Bacteria 14255
356 Ga0501047_0001035 3300049581 Bacteria 27861
357 Ga0501048_0019454 3300049582 Bacteria 4981
358 Ga0501067_0062212 3300049583 Bacteria 2066
359 Ga0501068_0010192 3300049584 Bacteria 5274
360 Ga0501070_0226337 3300049586 Bacteria 1533
361 Ga0501072_0075707 3300049588 Bacteria 2662
362 Ga0501073_0005692 3300049589 Bacteria 9323
363 Ga0501080_0011705 3300049742 Bacteria 8039
364 Ga0501241_002024 3300049758 Bacteria 3973
365 Ga0501044_0050235 3300049823 Bacteria 4304
366 Ga0501082_0003616 3300060353 Bacteria 13502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0232181 Ga0501042_0232181_199_1293 332
2 3300003781 Ga0055536_1000133 Ga0055536_100013329 333
3 3300003791 Ga0055530_10000147 Ga0055530_1000014729 333
4 3300003792 Ga0055540_1001392 Ga0055540_100139210 333
5 3300009011 Ga0105251_10059995 Ga0105251_100599952 333
6 3300009036 Ga0105244_10000154 Ga0105244_100001545 333
7 3300009148 Ga0105243_10047025 Ga0105243_100470252 333
8 3300011119 Ga0105246_10043739 Ga0105246_100437392 333
9 3300025292 Ga0209676_1000003 Ga0209676_10000031302 333
10 3300025298 Ga0209050_1000004 Ga0209050_10000041284 333
11 3300025303 Ga0209051_1000187 Ga0209051_100018768 333
12 3300025728 Ga0207655_1013681 Ga0207655_10136813 333
13 3300025935 Ga0207709_10026471 Ga0207709_100264712 333
14 3300031235 Ga0265330_10022400 Ga0265330_100224003 333
15 3300031250 Ga0265331_10001250 Ga0265331_100012502 333
16 3300031251 Ga0265327_10029901 Ga0265327_100299012 333
17 3300044712 Ga0453684_0372934 Ga0453684_0372934_459_1469 333
18 iso_pu_bacteria 2511231008 2511281028 333
19 iso_pu_bacteria 2511231011 2511298134 333
20 iso_pu_bacteria 2511231018 2511338528 333
21 iso_pu_bacteria 2511231019 2511345597 333
22 iso_pu_bacteria 2511231020 2511351331 333
23 iso_pu_bacteria 2511231021 2511353806 333
24 iso_pu_bacteria 2511231022 2511365281 333
25 iso_pu_bacteria 2511231023 2511367676 333
26 iso_pu_bacteria 2599185309 2599983508 333
27 iso_pu_bacteria 2643221565 2643841925 333
28 iso_pu_bacteria 2718217725 2718635367 333
29 iso_pu_bacteria 2808606382 2808957127 333
30 iso_pu_bacteria 2852657418 2852661310 333
31 iso_pu_bacteria 2931396565 2931396774 333
32 iso_pu_bacteria 3007855910 3007858827 333
33 iso_pu_bacteria 3007861166 3007865626 333
34 3300021384 Ga0213876_10056164 Ga0213876_100561641 334
35 iso_pu_bacteria 2597489887 2597857565 334
36 iso_pu_bacteria 2599185185 2599484511 334
37 3300042016 Ga0439463_000055 Ga0439463_000055_21648_22664 335
38 3300042127 Ga0450890_000208 Ga0450890_000208_280_1410 335
39 3300044712 Ga0453684_0002892 Ga0453684_0002892_33533_34552 335
40 3300046501 Ga0495607_0057742 Ga0495607_0057742_1054_2070 335
41 3300049459 Ga0495678_014240 Ga0495678_014240_2376_3392 335
42 3300005288 Ga0065714_10066390 Ga0065714_100663905 336
43 3300005548 Ga0070665_100294356 Ga0070665_1002943562 336
44 3300009092 Ga0105250_10046458 Ga0105250_100464582 336
45 3300025292 Ga0209676_1003968 Ga0209676_10039686 336
46 3300025303 Ga0209051_1030233 Ga0209051_10302332 336
47 3300025728 Ga0207655_1062643 Ga0207655_10626432 336
48 3300025735 Ga0207713_1000834 Ga0207713_10008344 336
49 3300025960 Ga0207651_10166130 Ga0207651_101661302 336
50 3300027111 Ga0209281_1000070 Ga0209281_100007049 336
51 3300027907 Ga0207428_10058446 Ga0207428_100584461 336
52 3300027907 Ga0207428_10259044 Ga0207428_102590441 336
53 3300030500 Ga0268256_1000743 Ga0268256_100074314 336
54 3300031242 Ga0265329_10005879 Ga0265329_100058794 336
55 3300031344 Ga0265316_10163610 Ga0265316_101636102 336
56 3300031711 Ga0265314_10000154 Ga0265314_1000015443 336
57 3300041411 Ga0439466_0009416 Ga0439466_0009416_1422_2519 336
58 3300042010 Ga0439452_015088 Ga0439452_015088_581_1678 336
59 3300046452 Ga0495617_001335 Ga0495617_001335_3563_4663 336
60 3300046452 Ga0495617_008127 Ga0495617_008127_1266_2279 336
61 3300046457 Ga0495590_0001512 Ga0495590_0001512_1402_2415 336
62 3300046460 Ga0495638_0016267 Ga0495638_0016267_1456_2553 336
63 3300046460 Ga0495638_0031235 Ga0495638_0031235_2204_3301 336
64 3300046474 Ga0495605_0000106 Ga0495605_0000106_79585_80601 336
65 3300046474 Ga0495605_0005887 Ga0495605_0005887_1730_2740 336
66 3300046474 Ga0495605_0007011 Ga0495605_0007011_112_1122 336
67 3300046491 Ga0495584_0003630 Ga0495584_0003630_5864_6961 336
68 3300046491 Ga0495584_0042707 Ga0495584_0042707_73_1086 336
69 3300046492 Ga0495585_0042310 Ga0495585_0042310_338_1351 336
70 3300046501 Ga0495607_0057487 Ga0495607_0057487_508_1524 336
71 3300046506 Ga0495583_0005820 Ga0495583_0005820_1457_2470 336
72 3300046507 Ga0495606_0007147 Ga0495606_0007147_1664_2761 336
73 3300046512 Ga0495610_0004121 Ga0495610_0004121_1436_2533 336
74 3300046512 Ga0495610_0032130 Ga0495610_0032130_158_1171 336
75 3300046515 Ga0495620_0013351 Ga0495620_0013351_1661_2758 336
76 3300046515 Ga0495620_0048494 Ga0495620_0048494_702_1715 336
77 3300046518 Ga0495631_0009891 Ga0495631_0009891_1435_2532 336
78 3300046519 Ga0495632_0031301 Ga0495632_0031301_266_1363 336
79 3300046520 Ga0495637_0012670 Ga0495637_0012670_1454_2551 336
80 3300046520 Ga0495637_0023210 Ga0495637_0023210_1755_2768 336
81 3300046524 Ga0495648_0005886 Ga0495648_0005886_7423_8520 336
82 3300046524 Ga0495648_0008998 Ga0495648_0008998_155_1252 336
83 3300046524 Ga0495648_0038793 Ga0495648_0038793_1878_2891 336
84 3300046528 Ga0495642_0000688 Ga0495642_0000688_1459_2472 336
85 3300046530 Ga0495654_0005920 Ga0495654_0005920_1411_2508 336
86 3300046530 Ga0495654_0018829 Ga0495654_0018829_142_1239 336
87 3300046557 Ga0495622_0013976 Ga0495622_0013976_1463_2560 336
88 3300046616 Ga0495668_0007488 Ga0495668_0007488_620_1633 336
89 3300046665 Ga0495661_0035169 Ga0495661_0035169_514_1611 336
90 3300046684 Ga0495669_0007224 Ga0495669_0007224_1396_2409 336
91 3300046691 Ga0495670_0000750 Ga0495670_0000750_12808_13905 336
92 3300046691 Ga0495670_0002706 Ga0495670_0002706_1415_2428 336
93 3300046692 Ga0495671_0019807 Ga0495671_0019807_225_1322 336
94 3300046692 Ga0495671_0043559 Ga0495671_0043559_1219_2232 336
95 3300046694 Ga0495649_0003951 Ga0495649_0003951_4895_5992 336
96 3300046694 Ga0495649_0023252 Ga0495649_0023252_2328_3341 336
97 3300046794 Ga0495589_0005299 Ga0495589_0005299_4288_5385 336
98 3300046794 Ga0495589_0018799 Ga0495589_0018799_1454_2467 336
99 3300046810 Ga0495660_0027330 Ga0495660_0027330_1465_2562 336
100 3300047320 Ga0495672_0002327 Ga0495672_0002327_7236_8249 336
101 3300047320 Ga0495672_0006285 Ga0495672_0006285_491_1588 336
102 3300047320 Ga0495672_0008468 Ga0495672_0008468_6333_7430 336
103 3300047320 Ga0495672_0028761 Ga0495672_0028761_1449_2462 336
104 3300047323 Ga0495683_0002976 Ga0495683_0002976_7455_8552 336
105 3300047443 Ga0495687_002632 Ga0495687_002632_6541_7554 336
106 3300047443 Ga0495687_003817 Ga0495687_003817_5053_6150 336
107 3300047469 Ga0495673_0022295 Ga0495673_0022295_192_1205 336
108 3300047470 Ga0495681_0009004 Ga0495681_0009004_1459_2556 336
109 3300047472 Ga0495686_0009991 Ga0495686_0009991_134_1231 336
110 3300048091 Ga0495626_0000881 Ga0495626_0000881_20008_21105 336
111 3300048920 Ga0496117_0056400 Ga0496117_0056400_1351_2448 336
112 3300048921 Ga0496118_0015572 Ga0496118_0015572_4655_5752 336
113 3300048927 Ga0496124_0021838 Ga0496124_0021838_3377_4474 336
114 3300049460 Ga0495682_0046800 Ga0495682_0046800_352_1449 336
115 3300049571 Ga0501034_0001905 Ga0501034_0001905_2317_3438 336
116 3300049572 Ga0501036_0006836 Ga0501036_0006836_2003_3124 336
117 3300049573 Ga0501037_0139666 Ga0501037_0139666_538_1659 336
118 3300049574 Ga0501038_0061094 Ga0501038_0061094_1736_2857 336
119 3300049575 Ga0501039_0056589 Ga0501039_0056589_1044_2165 336
120 3300049579 Ga0501043_0025525 Ga0501043_0025525_1846_2967 336
121 3300049580 Ga0501046_0003572 Ga0501046_0003572_1837_2958 336
122 3300049581 Ga0501047_0001035 Ga0501047_0001035_23435_24556 336
123 3300049582 Ga0501048_0019454 Ga0501048_0019454_2097_3218 336
124 3300049583 Ga0501067_0062212 Ga0501067_0062212_55_1176 336
125 3300049584 Ga0501068_0010192 Ga0501068_0010192_1041_2162 336
126 3300049588 Ga0501072_0075707 Ga0501072_0075707_1317_2438 336
127 3300049589 Ga0501073_0005692 Ga0501073_0005692_1242_2363 336
128 3300049742 Ga0501080_0011705 Ga0501080_0011705_6552_7673 336
129 3300049823 Ga0501044_0050235 Ga0501044_0050235_367_1488 336
130 3300060353 Ga0501082_0003616 Ga0501082_0003616_1140_2261 336
131 3300003781 Ga0055536_1002461 Ga0055536_10024616 337
132 3300005288 Ga0065714_10000039 Ga0065714_100000391 337
133 3300005457 Ga0070662_100056449 Ga0070662_1000564493 337
134 3300006058 Ga0075432_10008797 Ga0075432_100087973 337
135 3300009011 Ga0105251_10027543 Ga0105251_100275432 337
136 3300009036 Ga0105244_10046678 Ga0105244_100466782 337
137 3300009092 Ga0105250_10001634 Ga0105250_100016349 337
138 3300009553 Ga0105249_10062970 Ga0105249_100629701 337
139 3300013102 Ga0157371_10001092 Ga0157371_1000109228 337
140 3300013102 Ga0157371_10179867 Ga0157371_101798672 337
141 3300013104 Ga0157370_10045224 Ga0157370_100452244 337
142 3300013104 Ga0157370_10049187 Ga0157370_100491873 337
143 3300013104 Ga0157370_10068925 Ga0157370_100689251 337
144 3300013104 Ga0157370_10081316 Ga0157370_100813161 337
145 3300013308 Ga0157375_10402001 Ga0157375_104020012 337
146 3300014497 Ga0182008_10022481 Ga0182008_100224813 337
147 3300014497 Ga0182008_10100330 Ga0182008_101003301 337
148 3300015261 Ga0182006_1001817 Ga0182006_10018172 337
149 3300015261 Ga0182006_1014720 Ga0182006_10147205 337
150 3300015261 Ga0182006_1055452 Ga0182006_10554522 337
151 3300015261 Ga0182006_1055664 Ga0182006_10556641 337
152 3300015265 Ga0182005_1006595 Ga0182005_10065953 337
153 3300015265 Ga0182005_1032775 Ga0182005_10327751 337
154 3300017792 Ga0163161_10041902 Ga0163161_100419023 337
155 3300025292 Ga0209676_1000109 Ga0209676_100010963 337
156 3300025711 Ga0207696_1000130 Ga0207696_1000130102 337
157 3300025728 Ga0207655_1011956 Ga0207655_10119564 337
158 3300025728 Ga0207655_1017267 Ga0207655_10172671 337
159 3300025735 Ga0207713_1017453 Ga0207713_10174534 337
160 3300025735 Ga0207713_1022813 Ga0207713_10228132 337
161 3300025735 Ga0207713_1034694 Ga0207713_10346942 337
162 3300025735 Ga0207713_1051499 Ga0207713_10514992 337
163 3300025933 Ga0207706_10061725 Ga0207706_100617253 337
164 3300025961 Ga0207712_10080984 Ga0207712_100809842 337
165 3300027907 Ga0207428_10071118 Ga0207428_100711182 337
166 3300027907 Ga0207428_10165944 Ga0207428_101659442 337
167 3300031548 Ga0307408_100037682 Ga0307408_1000376823 337
168 3300031911 Ga0307412_10284540 Ga0307412_102845402 337
169 3300039438 Ga0436360_0528171 Ga0436360_0528171_963_2096 337
170 3300041405 Ga0439438_002280 Ga0439438_002280_187_1353 337
171 3300041407 Ga0439447_000861 Ga0439447_000861_188_1210 337
172 3300041407 Ga0439447_004311 Ga0439447_004311_3635_4657 337
173 3300041407 Ga0439447_004607 Ga0439447_004607_572_1738 337
174 3300041411 Ga0439466_0000524 Ga0439466_0000524_13030_14196 337
175 3300041411 Ga0439466_0014425 Ga0439466_0014425_1609_2649 337
176 3300041411 Ga0439466_0018453 Ga0439466_0018453_896_1918 337
177 3300041411 Ga0439466_0019413 Ga0439466_0019413_1090_2112 337
178 3300041411 Ga0439466_0027093 Ga0439466_0027093_148_1170 337
179 3300042006 Ga0439432_004759 Ga0439432_004759_266_1432 337
180 3300042009 Ga0439451_007435 Ga0439451_007435_447_1613 337
181 3300042009 Ga0439451_014072 Ga0439451_014072_115_1137 337
182 3300042010 Ga0439452_005525 Ga0439452_005525_2628_3794 337
183 3300042013 Ga0439456_001857 Ga0439456_001857_342_1508 337
184 3300042013 Ga0439456_015675 Ga0439456_015675_117_1139 337
185 3300042016 Ga0439463_002388 Ga0439463_002388_864_2030 337
186 3300042115 Ga0450911_002564 Ga0450911_002564_197_1219 337
187 3300042121 Ga0450919_000524 Ga0450919_000524_3130_4296 337
188 3300042124 Ga0450922_002993 Ga0450922_002993_356_1522 337
189 3300042137 Ga0450902_008009 Ga0450902_008009_252_1418 337
190 3300042138 Ga0450903_000580 Ga0450903_000580_348_1535 337
191 3300042139 Ga0450904_002795 Ga0450904_002795_404_1477 337
192 3300042145 Ga0450906_001969 Ga0450906_001969_361_1527 337
193 3300042146 Ga0450907_000150 Ga0450907_000150_334_1356 337
194 3300042146 Ga0450907_001459 Ga0450907_001459_187_1353 337
195 3300042147 Ga0450910_012293 Ga0450910_012293_181_1206 337
196 3300042156 Ga0439446_0001494 Ga0439446_0001494_3968_4990 337
197 3300042156 Ga0439446_0013798 Ga0439446_0013798_247_1434 337
198 3300042184 Ga0450908_001582 Ga0450908_001582_136_1302 337
199 3300042185 Ga0450909_000505 Ga0450909_000505_3949_4971 337
200 3300042435 Ga0439434_0002528 Ga0439434_0002528_447_1469 337
201 3300042435 Ga0439434_0012790 Ga0439434_0012790_40_1248 337
202 3300042439 Ga0439464_0003019 Ga0439464_0003019_2730_3896 337
203 3300042461 Ga0439460_0000716 Ga0439460_0000716_5232_6398 337
204 3300042531 Ga0450918_001244 Ga0450918_001244_3793_4815 337
205 3300042993 Ga0439440_0000881 Ga0439440_0000881_748_1914 337
206 3300042993 Ga0439440_0001150 Ga0439440_0001150_188_1210 337
207 3300046452 Ga0495617_016063 Ga0495617_016063_12_1034 337
208 3300046452 Ga0495617_045639 Ga0495617_045639_341_1363 337
209 3300046453 Ga0495627_048053 Ga0495627_048053_111_1133 337
210 3300046454 Ga0495592_0028089 Ga0495592_0028089_2971_4029 337
211 3300046455 Ga0495603_0012326 Ga0495603_0012326_3918_4940 337
212 3300046457 Ga0495590_0001655 Ga0495590_0001655_472_1680 337
213 3300046458 Ga0495591_006610 Ga0495591_006610_3347_4504 337
214 3300046458 Ga0495591_009230 Ga0495591_009230_133_1158 337
215 3300046458 Ga0495591_010133 Ga0495591_010133_134_1156 337
216 3300046459 Ga0495629_0244290 Ga0495629_0244290_81_1103 337
217 3300046460 Ga0495638_0133881 Ga0495638_0133881_334_1380 337
218 3300046460 Ga0495638_0150684 Ga0495638_0150684_180_1205 337
219 3300046463 Ga0495653_0018691 Ga0495653_0018691_510_1568 337
220 3300046471 Ga0495650_0012505 Ga0495650_0012505_3213_4235 337
221 3300046471 Ga0495650_0015022 Ga0495650_0015022_2459_3667 337
222 3300046471 Ga0495650_0036376 Ga0495650_0036376_972_1994 337
223 3300046491 Ga0495584_0005693 Ga0495584_0005693_5354_6376 337
224 3300046491 Ga0495584_0040085 Ga0495584_0040085_124_1146 337
225 3300046491 Ga0495584_0069814 Ga0495584_0069814_194_1216 337
226 3300046491 Ga0495584_0083587 Ga0495584_0083587_75_1283 337
227 3300046491 Ga0495584_0108570 Ga0495584_0108570_226_1248 337
228 3300046492 Ga0495585_0011040 Ga0495585_0011040_552_1577 337
229 3300046492 Ga0495585_0019218 Ga0495585_0019218_102_1259 337
230 3300046492 Ga0495585_0055111 Ga0495585_0055111_550_1572 337
231 3300046499 Ga0495594_0100560 Ga0495594_0100560_114_1319 337
232 3300046501 Ga0495607_0009149 Ga0495607_0009149_4402_5610 337
233 3300046501 Ga0495607_0017946 Ga0495607_0017946_195_1403 337
234 3300046507 Ga0495606_0000789 Ga0495606_0000789_26531_27592 337
235 3300046507 Ga0495606_0015918 Ga0495606_0015918_162_1184 337
236 3300046507 Ga0495606_0023327 Ga0495606_0023327_133_1158 337
237 3300046507 Ga0495606_0085168 Ga0495606_0085168_194_1216 337
238 3300046512 Ga0495610_0002150 Ga0495610_0002150_15142_16167 337
239 3300046512 Ga0495610_0014172 Ga0495610_0014172_292_1314 337
240 3300046512 Ga0495610_0014503 Ga0495610_0014503_188_1210 337
241 3300046512 Ga0495610_0024202 Ga0495610_0024202_1029_2051 337
242 3300046513 Ga0495616_0002466 Ga0495616_0002466_10258_11466 337
243 3300046513 Ga0495616_0012075 Ga0495616_0012075_3225_4382 337
244 3300046513 Ga0495616_0013006 Ga0495616_0013006_194_1216 337
245 3300046513 Ga0495616_0017715 Ga0495616_0017715_2525_3547 337
246 3300046515 Ga0495620_0002668 Ga0495620_0002668_597_1715 337
247 3300046515 Ga0495620_0007123 Ga0495620_0007123_4914_5936 337
248 3300046515 Ga0495620_0083159 Ga0495620_0083159_182_1204 337
249 3300046518 Ga0495631_0115974 Ga0495631_0115974_95_1117 337
250 3300046519 Ga0495632_0008571 Ga0495632_0008571_507_1529 337
251 3300046519 Ga0495632_0014089 Ga0495632_0014089_3329_4351 337
252 3300046520 Ga0495637_0008385 Ga0495637_0008385_186_1208 337
253 3300046520 Ga0495637_0013471 Ga0495637_0013471_2653_3771 337
254 3300046520 Ga0495637_0051340 Ga0495637_0051340_192_1214 337
255 3300046520 Ga0495637_0058331 Ga0495637_0058331_249_1457 337
256 3300046522 Ga0495643_0002478 Ga0495643_0002478_5651_6682 337
257 3300046522 Ga0495643_0116712 Ga0495643_0116712_158_1180 337
258 3300046523 Ga0495644_0087821 Ga0495644_0087821_103_1125 337
259 3300046524 Ga0495648_0018321 Ga0495648_0018321_121_1143 337
260 3300046524 Ga0495648_0064922 Ga0495648_0064922_820_1842 337
261 3300046526 Ga0495666_0014777 Ga0495666_0014777_240_1298 337
262 3300046530 Ga0495654_0002193 Ga0495654_0002193_603_1760 337
263 3300046530 Ga0495654_0036513 Ga0495654_0036513_461_1669 337
264 3300046538 Ga0495609_0002027 Ga0495609_0002027_373_1491 337
265 3300046538 Ga0495609_0035128 Ga0495609_0035128_649_1857 337
266 3300046542 Ga0495597_0010765 Ga0495597_0010765_359_1399 337
267 3300046542 Ga0495597_0025056 Ga0495597_0025056_1337_2359 337
268 3300046542 Ga0495597_0099801 Ga0495597_0099801_128_1207 337
269 3300046543 Ga0495645_0027195 Ga0495645_0027195_2702_3760 337
270 3300046557 Ga0495622_0003365 Ga0495622_0003365_4088_5293 337
271 3300046557 Ga0495622_0039108 Ga0495622_0039108_173_1195 337
272 3300046558 Ga0495633_0016624 Ga0495633_0016624_160_1182 337
273 3300046558 Ga0495633_0102167 Ga0495633_0102167_73_1095 337
274 3300046615 Ga0495656_0022422 Ga0495656_0022422_659_1681 337
275 3300046616 Ga0495668_0003494 Ga0495668_0003494_354_1379 337
276 3300046642 Ga0495634_0026389 Ga0495634_0026389_225_1283 337
277 3300046648 Ga0495611_0009577 Ga0495611_0009577_2493_3701 337
278 3300046660 Ga0495625_0022464 Ga0495625_0022464_3265_4422 337
279 3300046660 Ga0495625_0101466 Ga0495625_0101466_594_1649 337
280 3300046660 Ga0495625_0139209 Ga0495625_0139209_429_1451 337
281 3300046664 Ga0495659_0052521 Ga0495659_0052521_321_1343 337
282 3300046665 Ga0495661_0046057 Ga0495661_0046057_113_1270 337
283 3300046665 Ga0495661_0070377 Ga0495661_0070377_470_1492 337
284 3300046674 Ga0495588_0025633 Ga0495588_0025633_1376_2581 337
285 3300046674 Ga0495588_0043929 Ga0495588_0043929_1132_2154 337
286 3300046684 Ga0495669_0042999 Ga0495669_0042999_96_1118 337
287 3300046689 Ga0495613_0118316 Ga0495613_0118316_359_1417 337
288 3300046690 Ga0495624_0014970 Ga0495624_0014970_3213_4271 337
289 3300046691 Ga0495670_0009049 Ga0495670_0009049_3305_4513 337
290 3300046691 Ga0495670_0013055 Ga0495670_0013055_147_1169 337
291 3300046692 Ga0495671_0012596 Ga0495671_0012596_3072_4229 337
292 3300046694 Ga0495649_0000920 Ga0495649_0000920_4284_5345 337
293 3300046694 Ga0495649_0002550 Ga0495649_0002550_1267_2289 337
294 3300046694 Ga0495649_0014452 Ga0495649_0014452_1783_2805 337
295 3300046694 Ga0495649_0015346 Ga0495649_0015346_3207_4229 337
296 3300046694 Ga0495649_0018209 Ga0495649_0018209_2805_3830 337
297 3300046694 Ga0495649_0133852 Ga0495649_0133852_159_1181 337
298 3300046794 Ga0495589_0011757 Ga0495589_0011757_934_1956 337
299 3300046794 Ga0495589_0059242 Ga0495589_0059242_765_1787 337
300 3300046809 Ga0495600_0018008 Ga0495600_0018008_326_1384 337
301 3300046810 Ga0495660_0002230 Ga0495660_0002230_247_1302 337
302 3300046810 Ga0495660_0033350 Ga0495660_0033350_1208_2365 337
303 3300046810 Ga0495660_0075131 Ga0495660_0075131_641_1663 337
304 3300046810 Ga0495660_0092782 Ga0495660_0092782_320_1438 337
305 3300047318 Ga0495636_0003292 Ga0495636_0003292_649_1857 337
306 3300047318 Ga0495636_0037221 Ga0495636_0037221_384_1406 337
307 3300047320 Ga0495672_0015957 Ga0495672_0015957_485_1543 337
308 3300047320 Ga0495672_0069206 Ga0495672_0069206_148_1356 337
309 3300047321 Ga0495676_0032455 Ga0495676_0032455_2982_4040 337
310 3300047322 Ga0495680_0036134 Ga0495680_0036134_455_1513 337
311 3300047323 Ga0495683_0016148 Ga0495683_0016148_2447_3604 337
312 3300047323 Ga0495683_0041531 Ga0495683_0041531_877_2136 337
313 3300047443 Ga0495687_008041 Ga0495687_008041_4315_5523 337
314 3300047445 Ga0495677_0005401 Ga0495677_0005401_3374_4396 337
315 3300047446 Ga0495679_007650 Ga0495679_007650_3198_4355 337
316 3300047446 Ga0495679_009240 Ga0495679_009240_2803_3828 337
317 3300047446 Ga0495679_014110 Ga0495679_014110_1717_2742 337
318 3300047469 Ga0495673_0001605 Ga0495673_0001605_12163_13185 337
319 3300047469 Ga0495673_0002737 Ga0495673_0002737_7707_8915 337
320 3300047469 Ga0495673_0014062 Ga0495673_0014062_3018_4040 337
321 3300047469 Ga0495673_0040937 Ga0495673_0040937_30_1085 337
322 3300047469 Ga0495673_0042602 Ga0495673_0042602_832_1854 337
323 3300047469 Ga0495673_0076763 Ga0495673_0076763_144_1166 337
324 3300047470 Ga0495681_0006776 Ga0495681_0006776_1516_2538 337
325 3300047470 Ga0495681_0007364 Ga0495681_0007364_430_1452 337
326 3300047470 Ga0495681_0013676 Ga0495681_0013676_131_1249 337
327 3300047470 Ga0495681_0018879 Ga0495681_0018879_2644_3666 337
328 3300047470 Ga0495681_0044473 Ga0495681_0044473_924_1946 337
329 3300047470 Ga0495681_0057309 Ga0495681_0057309_376_1422 337
330 3300047471 Ga0495684_0029966 Ga0495684_0029966_212_1270 337
331 3300047673 Ga0495593_0043767 Ga0495593_0043767_454_1512 337
332 3300047673 Ga0495593_0116775 Ga0495593_0116775_236_1258 337
333 3300048088 Ga0495602_0037686 Ga0495602_0037686_455_1513 337
334 3300048089 Ga0495614_0083808 Ga0495614_0083808_139_1362 337
335 3300048091 Ga0495626_0001573 Ga0495626_0001573_567_1589 337
336 3300048091 Ga0495626_0010983 Ga0495626_0010983_425_1582 337
337 3300048091 Ga0495626_0014099 Ga0495626_0014099_148_1173 337
338 3300048091 Ga0495626_0024733 Ga0495626_0024733_157_1182 337
339 3300048909 Ga0496106_0147823 Ga0496106_0147823_510_1532 337
340 3300048913 Ga0496110_0283935 Ga0496110_0283935_131_1336 337
341 3300048919 Ga0496116_0025435 Ga0496116_0025435_3195_4217 337
342 3300048920 Ga0496117_0025253 Ga0496117_0025253_515_1537 337
343 3300048921 Ga0496118_0011347 Ga0496118_0011347_490_1512 337
344 3300048921 Ga0496118_0146316 Ga0496118_0146316_79_1101 337
345 3300048923 Ga0496120_0026778 Ga0496120_0026778_186_1208 337
346 3300048924 Ga0496121_0208033 Ga0496121_0208033_328_1350 337
347 3300048925 Ga0496122_0031383 Ga0496122_0031383_512_1534 337
348 3300048925 Ga0496122_0098406 Ga0496122_0098406_409_1431 337
349 3300048926 Ga0496123_0011583 Ga0496123_0011583_3092_4114 337
350 3300048926 Ga0496123_0048265 Ga0496123_0048265_395_1417 337
351 3300048927 Ga0496124_0132286 Ga0496124_0132286_829_1851 337
352 3300048927 Ga0496124_0269925 Ga0496124_0269925_89_1111 337
353 3300048928 Ga0496125_0028646 Ga0496125_0028646_451_1473 337
354 3300048929 Ga0496126_0278734 Ga0496126_0278734_303_1325 337
355 3300049459 Ga0495678_003513 Ga0495678_003513_8048_9256 337
356 3300049459 Ga0495678_010486 Ga0495678_010486_139_1296 337
357 3300049459 Ga0495678_016412 Ga0495678_016412_1932_2954 337
358 3300049459 Ga0495678_018327 Ga0495678_018327_1839_2957 337
359 3300049460 Ga0495682_0028622 Ga0495682_0028622_97_1305 337
360 3300049460 Ga0495682_0082307 Ga0495682_0082307_15_1037 337
361 3300049758 Ga0501241_002024 Ga0501241_002024_130_1155 337
362 3300002771 JGI25163J39215_1000234 JGI25163J39215_100023418 338
363 3300002772 JGI25164J39214_1000059 JGI25164J39214_100005926 338
364 3300003214 JGI25165J46597_1000027 JGI25165J46597_100002782 338
365 3300006844 Ga0075428_100057300 Ga0075428_1000573002 338
366 3300025207 Ga0209760_100025 Ga0209760_10002531 338
367 3300025231 Ga0207427_100003 Ga0207427_100003560 338
368 3300025233 Ga0209437_100002 Ga0209437_100002453 338
369 3300025261 Ga0209233_1000004 Ga0209233_1000004972 338
370 3300025935 Ga0207709_10000797 Ga0207709_1000079722 338
371 3300028381 Ga0268264_10004070 Ga0268264_100040707 338
372 3300031649 Ga0307514_10000330 Ga0307514_1000033070 338
373 3300035090 Ga0373949_0000084 Ga0373949_0000084_6485_7798 338
374 3300042013 Ga0439456_004490 Ga0439456_004490_291_1310 338
375 3300046692 Ga0495671_0121137 Ga0495671_0121137_157_1179 338
376 3300048919 Ga0496116_0000221 Ga0496116_0000221_69573_70589 338
377 3300048920 Ga0496117_0023161 Ga0496117_0023161_1525_2541 338
378 3300048921 Ga0496118_0002156 Ga0496118_0002156_25304_26344 338
379 3300048925 Ga0496122_0001763 Ga0496122_0001763_1656_2672 338
380 3300048925 Ga0496122_0015220 Ga0496122_0015220_5343_6383 338
381 3300048926 Ga0496123_0000207 Ga0496123_0000207_77281_78321 338
382 3300048926 Ga0496123_0005421 Ga0496123_0005421_10335_11351 338
383 3300048928 Ga0496125_0018390 Ga0496125_0018390_257_1297 338
384 3300049586 Ga0501070_0226337 Ga0501070_0226337_378_1496 338
385 iso_pu_bacteria 3007803356 3007806627 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06250

YhcG_C

YhcG PDDEXK nuclease domain

252

406

0.98

PF17761

DUF1016_N

DUF1016 N-terminal domain

96

232

0.98

Feature Viewer

pLDDT pTM Quality
72.02 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map