metagRoot

F430276

General Info

Members	Datasets	Scaffolds	Average Seq Length
385	232	385	330

Family's Representative Sequence

Representative Sequence	3300045976\|Ga0466967_0143819\|Ga0466967_0143819_114_1229
Length	371
Sequence	MMRYAKALTLAFGAAALAVVVAGRPAASAQQANGPTMEPTNALPNPYETITGWAKMPDGRTWGSTSAVDIDRDGKTIWVAERCGANACVGSNLDPVLHFDENGTLIKSFGAGMFVSPHGIFVDKDDNVWVTDCACTVGGGRGRGGEAAAPPAEAKGHQVYKFSPDGKLLMTLGKPGGGRGAEFFYQPNDVLVAPNGDIFVSEGHTSAPNATARLFKFSKDGKLIKVWGTKGSGPDDFDQPHALAMDSKGRLFVGDRGNNRIKILDQDGKLLDTWYQFSRPSGIFIDKHDMIYVADSESGSVSRDANGPTRTNWKRGIRIGRIADGKPIALIPDPDEHATGTSAAEGVAVDDAGHIYGAEVGPKALKRYVKK

Samples

	Sample ID	Description	Type	Environment
1	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
2	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
3	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
6	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
7	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
8	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
12	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
13	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
14	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
15	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
22	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
23	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
24	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
25	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
26	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
30	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
31	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
32	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
33	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
34	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
35	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
36	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
37	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
38	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
39	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
40	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
41	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
42	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
43	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
44	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
45	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
46	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
47	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
48	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
49	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
50	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
51	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
54	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
55	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
56	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
57	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
58	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
59	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
60	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
62	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
64	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
66	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
67	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
68	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
69	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
70	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
71	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
72	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
73	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
74	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
75	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
76	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
77	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
78	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
79	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
80	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
81	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
82	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
83	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
137	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
138	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
139	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
140	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
141	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
142	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
143	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
144	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
145	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
146	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
147	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
148	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
149	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
150	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
151	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
152	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
153	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
154	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
155	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
156	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
157	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
158	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
159	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
160	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
161	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
162	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
163	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
164	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
166	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
167	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
168	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
169	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
170	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
171	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
172	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
173	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
174	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
175	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
176	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
177	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
178	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
179	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
180	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
181	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
182	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
183	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
184	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
185	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
186	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
187	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
188	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
189	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
190	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
191	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
192	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
193	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
194	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
195	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
196	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
197	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
198	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
199	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
200	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
201	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
202	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
203	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
204	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
205	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
206	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
207	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
208	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
209	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
212	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
213	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
214	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
215	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
217	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
218	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
219	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
220	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
221	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
222	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
223	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
224	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
225	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
226	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
227	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
228	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
229	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
230	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
231	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
232	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.48
Metatranscriptomes	0.52
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.56
Nodule	0
Rhizoplane	0.52
Rhizosphere	97.92
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0058861_11503876	3300004800	Bacteria	1740
2	Ga0058862_12826741	3300004803	Bacteria	2351
3	Ga0070676_10004034	3300005328	Bacteria	7710
4	Ga0070683_100010824	3300005329	Bacteria	7851
5	Ga0070683_100063505	3300005329	Bacteria	3435
6	Ga0070683_100110181	3300005329	Bacteria	2597
7	Ga0070683_100223794	3300005329	Unclassified	1788
8	Ga0070683_100246685	3300005329	Bacteria	1698
9	Ga0070670_100017119	3300005331	Bacteria	6219
10	Ga0070670_100020503	3300005331	Bacteria	5683
11	Ga0068869_100003439	3300005334	Bacteria	9682
12	Ga0070680_100008077	3300005336	Bacteria	8036
13	Ga0070660_100105928	3300005339	Bacteria	2232
14	Ga0070689_100104338	3300005340	Bacteria	2247
15	Ga0070689_100120263	3300005340	Unclassified	2097
16	Ga0070691_10029373	3300005341	Bacteria	2571
17	Ga0070687_100009121	3300005343	Bacteria	4237
18	Ga0070668_100000444	3300005347	Bacteria	27368
19	Ga0070669_100031784	3300005353	Bacteria	3812
20	Ga0070669_100034468	3300005353	Bacteria	3665
21	Ga0070675_100014907	3300005354	Bacteria	6138
22	Ga0070671_100099076	3300005355	Bacteria	2444
23	Ga0070674_100083017	3300005356	Bacteria	2293
24	Ga0070674_100195339	3300005356	Bacteria	1559
25	Ga0070673_100029674	3300005364	Bacteria	4080
26	Ga0070673_100331528	3300005364	Unclassified	1346
27	Ga0070688_100006370	3300005365	Bacteria	6308
28	Ga0070688_100049829	3300005365	Bacteria	2607
29	Ga0070659_100091713	3300005366	Bacteria	2435
30	Ga0070659_100131103	3300005366	Bacteria	2036
31	Ga0070667_100013376	3300005367	Bacteria	6783
32	Ga0070709_10067902	3300005434	Bacteria	2291
33	Ga0070709_10068976	3300005434	Bacteria	2276
34	Ga0070713_100004409	3300005436	Bacteria	9449
35	Ga0070701_10038353	3300005438	Bacteria	2425
36	Ga0070711_100047916	3300005439	Unclassified	2919
37	Ga0070711_100057567	3300005439	Bacteria	2692
38	Ga0070705_100009444	3300005440	Bacteria	4850
39	Ga0070700_100005703	3300005441	Bacteria	6608
40	Ga0070708_100000549	3300005445	Bacteria	28032
41	Ga0070663_100062181	3300005455	Bacteria	2691
42	Ga0070662_100016978	3300005457	Bacteria	4895
43	Ga0070662_100034704	3300005457	Bacteria	3558
44	Ga0070681_10002478	3300005458	Bacteria	16902
45	Ga0070681_10027782	3300005458	Bacteria	5689
46	Ga0070681_10121919	3300005458	Bacteria	2541
47	Ga0070706_100017325	3300005467	Bacteria	6649
48	Ga0070706_100066065	3300005467	Bacteria	3345
49	Ga0070707_100118046	3300005468	Unclassified	2575
50	Ga0070698_100000353	3300005471	Bacteria	47490
51	Ga0070698_100025715	3300005471	Bacteria	6132
52	Ga0070679_100009381	3300005530	Bacteria	9253
53	Ga0070679_100010107	3300005530	Bacteria	8943
54	Ga0070679_100135750	3300005530	Bacteria	2441
55	Ga0070679_100243865	3300005530	Bacteria	1754
56	Ga0070684_100018797	3300005535	Bacteria	5701
57	Ga0070684_100023616	3300005535	Bacteria	5147
58	Ga0070684_100051917	3300005535	Bacteria	3563
59	Ga0070684_100072308	3300005535	Bacteria	3036
60	Ga0070684_100147727	3300005535	Bacteria	2128
61	Ga0070684_100162522	3300005535	Unclassified	2026
62	Ga0070672_100049705	3300005543	Bacteria	3264
63	Ga0070672_100064728	3300005543	Bacteria	2889
64	Ga0070696_100058911	3300005546	Bacteria	2683
65	Ga0070665_100037240	3300005548	Bacteria	4894
66	Ga0070704_100022216	3300005549	Bacteria	4125
67	Ga0070664_100004392	3300005564	Bacteria	11322
68	Ga0070664_100054639	3300005564	Unclassified	3389
69	Ga0070664_100100133	3300005564	Bacteria	2519
70	Ga0068857_100005706	3300005577	Bacteria	10644
71	Ga0068857_100082803	3300005577	Bacteria	2866
72	Ga0068854_100026113	3300005578	Bacteria	4012
73	Ga0068856_100106939	3300005614	Bacteria	2793
74	Ga0068856_100321034	3300005614	Bacteria	1566
75	Ga0068852_100027475	3300005616	Bacteria	4638
76	Ga0068859_100069981	3300005617	Bacteria	3544
77	Ga0068864_100238592	3300005618	Bacteria	1684
78	Ga0068861_100016097	3300005719	Bacteria	5282
79	Ga0068851_10129230	3300005834	Bacteria	1365
80	Ga0068863_100022872	3300005841	Bacteria	5973
81	Ga0068863_100031527	3300005841	Bacteria	5057
82	Ga0068858_100220222	3300005842	Bacteria	1797
83	Ga0068860_100074411	3300005843	Bacteria	3230
84	Ga0075365_10001939	3300006038	Bacteria	9768
85	Ga0075365_10007489	3300006038	Bacteria	6118
86	Ga0075370_10001417	3300006353	Bacteria	10375
87	Ga0075428_100077192	3300006844	Bacteria	3636
88	Ga0075428_100095286	3300006844	Bacteria	3244
89	Ga0075428_100131771	3300006844	Bacteria	2719
90	Ga0075431_100043472	3300006847	Unclassified	4636
91	Ga0075431_100078301	3300006847	Unclassified	3412
92	Ga0075431_100139375	3300006847	Bacteria	2501
93	Ga0075431_100181590	3300006847	Bacteria	2159
94	Ga0075431_100480008	3300006847	Bacteria	1236
95	Ga0075433_10003192	3300006852	Bacteria	12636
96	Ga0075433_10018953	3300006852	Bacteria	5727
97	Ga0075433_10045205	3300006852	Bacteria	3827
98	Ga0075434_100006350	3300006871	Bacteria	10836
99	Ga0075434_100018278	3300006871	Bacteria	6769
100	Ga0075434_100023121	3300006871	Bacteria	6054
101	Ga0075434_100051281	3300006871	Bacteria	4100
102	Ga0075429_100007342	3300006880	Bacteria	9568
103	Ga0075429_100015985	3300006880	Bacteria	6502
104	Ga0068865_100179728	3300006881	Archaea	1628
105	Ga0068865_100408885	3300006881	Unclassified	1113
106	Ga0097620_100069978	3300006931	Bacteria	3544
107	Ga0075435_100173645	3300007076	Bacteria	1819
108	Ga0075435_100315027	3300007076	Bacteria	1339
109	Ga0111539_10002911	3300009094	Bacteria	22707
110	Ga0111539_10025417	3300009094	Bacteria	7260
111	Ga0111539_10064459	3300009094	Bacteria	4334
112	Ga0111539_10137713	3300009094	Bacteria	2859
113	Ga0111539_10137774	3300009094	Bacteria	2858
114	Ga0111539_10344357	3300009094	Bacteria	1735
115	Ga0105245_10151168	3300009098	Bacteria	2196
116	Ga0114129_10000688	3300009147	Bacteria	42747
117	Ga0114129_10008596	3300009147	Bacteria	14561
118	Ga0114129_10028340	3300009147	Bacteria	7935
119	Ga0114129_10039053	3300009147	Bacteria	6692
120	Ga0114129_10178224	3300009147	Bacteria	2893
121	Ga0105241_10255814	3300009174	Bacteria	1486
122	Ga0105242_10213492	3300009176	Unclassified	1721
123	Ga0105248_10034349	3300009177	Bacteria	5670
124	Ga0105248_10151983	3300009177	Bacteria	2612
125	Ga0105237_10259265	3300009545	Bacteria	1741
126	Ga0105249_10003594	3300009553	Bacteria	13417
127	Ga0105239_10055210	3300010375	Bacteria	4356
128	Ga0157371_10020712	3300013102	Bacteria	4837
129	Ga0157370_10001160	3300013104	Bacteria	32869
130	Ga0157369_10021769	3300013105	Bacteria	7168
131	Ga0157369_10068031	3300013105	Bacteria	3827
132	Ga0157374_10113630	3300013296	Bacteria	2606
133	Ga0163162_10000455	3300013306	Bacteria	37915
134	Ga0163162_10086452	3300013306	Bacteria	3213
135	Ga0157372_10231486	3300013307	Bacteria	2142
136	Ga0157375_10008714	3300013308	Bacteria	8888
137	Ga0157375_10024757	3300013308	Bacteria	5562
138	Ga0157375_10249914	3300013308	Unclassified	1934
139	Ga0163163_10006856	3300014325	Bacteria	10000
140	Ga0157380_10008768	3300014326	Bacteria	7224
141	Ga0157379_10018699	3300014968	Bacteria	6109
142	Ga0157376_10171244	3300014969	Bacteria	1977
143	Ga0163161_10009702	3300017792	Bacteria	6665
144	Ga0207697_10004603	3300025315	Bacteria	6554
145	Ga0207656_10014973	3300025321	Bacteria	2998
146	Ga0207642_10044686	3300025899	Bacteria	1962
147	Ga0207680_10199965	3300025903	Bacteria	1361
148	Ga0207647_10030615	3300025904	Bacteria	3469
149	Ga0207699_10131244	3300025906	Unclassified	1634
150	Ga0207645_10000687	3300025907	Bacteria	28066
151	Ga0207645_10060619	3300025907	Bacteria	2416
152	Ga0207705_10141717	3300025909	Bacteria	1796
153	Ga0207684_10023540	3300025910	Bacteria	5259
154	Ga0207684_10046601	3300025910	Bacteria	3678
155	Ga0207707_10006674	3300025912	Bacteria	10066
156	Ga0207707_10017517	3300025912	Bacteria	6246
157	Ga0207707_10117869	3300025912	Bacteria	2321
158	Ga0207695_10235719	3300025913	Unclassified	1733
159	Ga0207695_10315238	3300025913	Bacteria	1454
160	Ga0207693_10005649	3300025915	Bacteria	10403
161	Ga0207663_10210906	3300025916	Bacteria	1407
162	Ga0207660_10003398	3300025917	Bacteria	10375
163	Ga0207660_10016002	3300025917	Bacteria	4958
164	Ga0207662_10001597	3300025918	Bacteria	11096
165	Ga0207662_10052898	3300025918	Bacteria	2418
166	Ga0207657_10052336	3300025919	Bacteria	3544
167	Ga0207649_10053694	3300025920	Bacteria	2505
168	Ga0207652_10007563	3300025921	Bacteria	8747
169	Ga0207652_10037185	3300025921	Bacteria	4120
170	Ga0207652_10039161	3300025921	Bacteria	4022
171	Ga0207652_10048271	3300025921	Bacteria	3639
172	Ga0207646_10040245	3300025922	Bacteria	4204
173	Ga0207681_10010449	3300025923	Bacteria	5680
174	Ga0207681_10041410	3300025923	Bacteria	3071
175	Ga0207650_10023479	3300025925	Bacteria	4374
176	Ga0207659_10026394	3300025926	Bacteria	3919
177	Ga0207659_10050299	3300025926	Bacteria	2960
178	Ga0207687_10142770	3300025927	Bacteria	1818
179	Ga0207700_10017871	3300025928	Bacteria	4747
180	Ga0207664_10171910	3300025929	Bacteria	1855
181	Ga0207644_10123831	3300025931	Bacteria	1971
182	Ga0207690_10028153	3300025932	Bacteria	3559
183	Ga0207706_10001099	3300025933	Bacteria	27517
184	Ga0207706_10027672	3300025933	Bacteria	5069
185	Ga0207706_10029337	3300025933	Bacteria	4911
186	Ga0207691_10002827	3300025940	Bacteria	16911
187	Ga0207691_10032056	3300025940	Bacteria	4902
188	Ga0207691_10089489	3300025940	Bacteria	2760
189	Ga0207691_10279883	3300025940	Bacteria	1435
190	Ga0207711_10099334	3300025941	Bacteria	2573
191	Ga0207689_10002768	3300025942	Bacteria	16209
192	Ga0207689_10062626	3300025942	Bacteria	3059
193	Ga0207661_10078151	3300025944	Bacteria	2723
194	Ga0207661_10109272	3300025944	Bacteria	2336
195	Ga0207661_10177303	3300025944	Unclassified	1859
196	Ga0207679_10015881	3300025945	Bacteria	4991
197	Ga0207679_10028174	3300025945	Bacteria	3894
198	Ga0207679_10044627	3300025945	Bacteria	3199
199	Ga0207651_10116253	3300025960	Bacteria	2019
200	Ga0207651_10366746	3300025960	Unclassified	1217
201	Ga0207712_10018433	3300025961	Bacteria	4547
202	Ga0207668_10101742	3300025972	Bacteria	2137
203	Ga0207640_10060457	3300025981	Bacteria	2505
204	Ga0207658_10016778	3300025986	Bacteria	5040
205	Ga0207658_10145270	3300025986	Bacteria	1925
206	Ga0207677_10013685	3300026023	Bacteria	4710
207	Ga0207703_10202863	3300026035	Bacteria	1763
208	Ga0207678_10021160	3300026067	Bacteria	5701
209	Ga0207708_10014222	3300026075	Bacteria	5951
210	Ga0207702_10022813	3300026078	Bacteria	5192
211	Ga0207702_10117101	3300026078	Bacteria	2379
212	Ga0207702_10294737	3300026078	Bacteria	1538
213	Ga0207641_10028189	3300026088	Bacteria	4639
214	Ga0207648_10017903	3300026089	Bacteria	6427
215	Ga0207648_10156530	3300026089	Bacteria	2011
216	Ga0207676_10018936	3300026095	Bacteria	5014
217	Ga0207676_10021540	3300026095	Bacteria	4729
218	Ga0207676_10267072	3300026095	Bacteria	1548
219	Ga0207674_10000142	3300026116	Bacteria	83392
220	Ga0207674_10005242	3300026116	Bacteria	15432
221	Ga0207674_10101016	3300026116	Unclassified	2865
222	Ga0207675_100000141	3300026118	Bacteria	61869
223	Ga0207683_10084566	3300026121	Bacteria	2820
224	Ga0207698_10060083	3300026142	Bacteria	2954
225	Ga0209588_1005138	3300027671	Bacteria	3733
226	Ga0207428_10052731	3300027907	Bacteria	3247
227	Ga0207428_10266288	3300027907	Bacteria	1275
228	Ga0268266_10080535	3300028379	Bacteria	2838
229	Ga0265337_1000882	3300028556	Bacteria	15761
230	Ga0265334_10002053	3300028573	Bacteria	9530
231	Ga0265334_10009418	3300028573	Bacteria	4130
232	Ga0265318_10010895	3300028577	Bacteria	3939
233	Ga0265338_10030988	3300028800	Bacteria	5253
234	Ga0265332_10009239	3300031238	Bacteria	4405
235	Ga0265320_10024413	3300031240	Bacteria	3197
236	Ga0265325_10053776	3300031241	Bacteria	2063
237	Ga0265331_10024078	3300031250	Bacteria	3085
238	Ga0307408_100047454	3300031548	Bacteria	3076
239	Ga0307408_100051677	3300031548	Bacteria	2961
240	Ga0265313_10018890	3300031595	Bacteria	3857
241	Ga0265314_10004846	3300031711	Bacteria	12304
242	Ga0265314_10055952	3300031711	Bacteria	2718
243	Ga0265342_10030513	3300031712	Bacteria	3340
244	Ga0307406_10002220	3300031901	Bacteria	10569
245	Ga0307407_10006034	3300031903	Bacteria	5340
246	Ga0307409_100046092	3300031995	Bacteria	3298
247	Ga0307415_100043751	3300032126	Bacteria	2990
248	Ga0373934_0003202	3300035086	Bacteria	5984
249	Ga0373934_0021166	3300035086	Unclassified	2504
250	Ga0373923_0000342	3300035111	Bacteria	10483
251	Ga0373945_0007199	3300035116	Bacteria	3602
252	Ga0373954_0008450	3300035118	Bacteria	4518
253	Ga0373943_0007913	3300035170	Bacteria	4771
254	Ga0373943_0103578	3300035170	Bacteria	1492
255	Ga0373943_0129597	3300035170	Unclassified	1349
256	Ga0373955_0003907	3300035172	Bacteria	6574
257	Ga0373955_0007405	3300035172	Bacteria	5046
258	Ga0373924_0015867	3300035410	Bacteria	2869
259	Ga0373931_0003118	3300035691	Bacteria	7403
260	Ga0373935_0011411	3300035692	Bacteria	5334
261	Ga0373927_0008060	3300035695	Bacteria	7112
262	Ga0373933_0001447	3300035724	Bacteria	13882
263	Ga0373937_0000101	3300036401	Bacteria	81054
264	Ga0373937_0000129	3300036401	Bacteria	72836
265	Ga0373925_0025503	3300037068	Unclassified	4319
266	Ga0373925_0105572	3300037068	Bacteria	2171
267	Ga0439455_0008140	3300042012	Bacteria	2241
268	Ga0439462_0026918	3300042015	Unclassified	1517
269	Ga0439446_0015218	3300042156	Unclassified	2133
270	Ga0439460_0005953	3300042461	Bacteria	3008
271	Ga0451577_0000005	3300042876	Bacteria	712599
272	Ga0451577_0185145	3300042876	Bacteria	1878
273	Ga0466966_0042672	3300044684	Bacteria	2910
274	Ga0466967_0010713	3300045976	Bacteria	6893
275	Ga0466967_0089237	3300045976	Bacteria	2799
276	Ga0466967_0143819	3300045976	Unclassified	2223
277	Ga0495592_0029451	3300046454	Bacteria	4157
278	Ga0495603_0005433	3300046455	Bacteria	7608
279	Ga0495629_0025605	3300046459	Bacteria	4192
280	Ga0495651_0010571	3300046462	Bacteria	7095
281	Ga0495653_0000078	3300046463	Bacteria	81730
282	Ga0495580_0002198	3300046472	Bacteria	17067
283	Ga0495580_0007000	3300046472	Bacteria	9091
284	Ga0495639_0000103	3300046475	Bacteria	42126
285	Ga0495639_0016547	3300046475	Bacteria	3202
286	Ga0495664_0063768	3300046477	Bacteria	2196
287	Ga0495594_0058564	3300046499	Bacteria	2129
288	Ga0495594_0187132	3300046499	Bacteria	1179
289	Ga0495608_0004387	3300046511	Bacteria	10112
290	Ga0495628_0000296	3300046516	Bacteria	44953
291	Ga0495630_0004874	3300046517	Bacteria	9425
292	Ga0495630_0012766	3300046517	Bacteria	6104
293	Ga0495630_0067745	3300046517	Unclassified	2683
294	Ga0495652_0000270	3300046529	Bacteria	61249
295	Ga0495652_0015570	3300046529	Bacteria	6807
296	Ga0495665_0000287	3300046531	Bacteria	25599
297	Ga0495665_0100783	3300046531	Bacteria	1515
298	Ga0495586_0025133	3300046535	Bacteria	3186
299	Ga0495586_0029350	3300046535	Bacteria	2943
300	Ga0495586_0049804	3300046535	Unclassified	2265
301	Ga0495586_0123497	3300046535	Bacteria	1447
302	Ga0495587_0000450	3300046536	Bacteria	28753
303	Ga0495587_0001287	3300046536	Bacteria	16670
304	Ga0495645_0000645	3300046543	Bacteria	24032
305	Ga0495645_0007235	3300046543	Bacteria	7724
306	Ga0495667_0003465	3300046559	Bacteria	10571
307	Ga0495667_0024162	3300046559	Bacteria	4092
308	Ga0495635_0000047	3300046663	Bacteria	79780
309	Ga0495588_0000569	3300046674	Bacteria	17617
310	Ga0495657_0000116	3300046675	Bacteria	71961
311	Ga0495599_0000730	3300046678	Bacteria	18538
312	Ga0495599_0005619	3300046678	Bacteria	7522
313	Ga0495623_0000049	3300046679	Bacteria	73356
314	Ga0495623_0007971	3300046679	Bacteria	6882
315	Ga0495646_0021399	3300046680	Bacteria	4085
316	Ga0495658_0001006	3300046683	Bacteria	14891
317	Ga0495658_0004163	3300046683	Bacteria	7126
318	Ga0495613_0012074	3300046689	Bacteria	6421
319	Ga0495600_0000108	3300046809	Bacteria	46097
320	Ga0495581_0024621	3300047315	Unclassified	3488
321	Ga0495581_0104016	3300047315	Bacteria	1650
322	Ga0495604_0000133	3300047317	Bacteria	63136
323	Ga0495674_0015276	3300047319	Bacteria	7183
324	Ga0495674_0152382	3300047319	Bacteria	1938
325	Ga0495674_0156859	3300047319	Bacteria	1906
326	Ga0495680_0059428	3300047322	Bacteria	2951
327	Ga0495675_0019160	3300047444	Bacteria	4347
328	Ga0495675_0025453	3300047444	Bacteria	3773
329	Ga0495684_0000109	3300047471	Bacteria	59534
330	Ga0495684_0051929	3300047471	Unclassified	3128
331	Ga0495684_0071011	3300047471	Bacteria	2646
332	Ga0495593_0000067	3300047673	Bacteria	44297
333	Ga0495593_0076852	3300047673	Unclassified	1730
334	Ga0495602_0000679	3300048088	Bacteria	31936
335	Ga0496108_0181663	3300048911	Bacteria	1822
336	Ga0496109_0420062	3300048912	Unclassified	1263
337	Ga0501031_0316168	3300049568	Unclassified	1012
338	Ga0501033_0354269	3300049570	Unclassified	1028
339	Ga0501072_0098313	3300049588	Bacteria	2326
340	Ga0501074_0062891	3300049590	Bacteria	2674
341	Ga0501079_0218699	3300049741	Bacteria	1488
342	Ga0501081_0009924	3300049743	Bacteria	6203
343	Ga0501045_0015279	3300049824	Bacteria	5449
344	nmdc:mga0yw44_16897_c1	3300050492	Bacteria	3954
345	nmdc:mga06z11_27035_c1	3300050494	Bacteria	2739
346	nmdc:mga07m45_12703_c1	3300050496	Bacteria	4453
347	nmdc:mga05p37_1288_c1	3300050507	Bacteria	29118
348	nmdc:mga05p37_228848_c1	3300050507	Bacteria	2241
349	nmdc:mga05p37_36476_c1	3300050507	Bacteria	6031
350	nmdc:mga05p37_62858_c1	3300050507	Bacteria	4569
351	nmdc:mga05p37_76544_c1	3300050507	Bacteria	4119
352	nmdc:mga09592_17987_c1	3300050508	Bacteria	5792
353	nmdc:mga09592_22254_c1	3300050508	Bacteria	5231
354	nmdc:mga0qj67_114640_c1	3300050509	Bacteria	2177
355	nmdc:mga0qj67_38185_c1	3300050509	Bacteria	3767
356	nmdc:mga0qj67_38304_c1	3300050509	Plasmid	3761
357	nmdc:mga0qj67_84494_c1	3300050509	Bacteria	2545
358	nmdc:mga06r32_160294_c1	3300050510	Bacteria	2232
359	nmdc:mga06r32_18689_c1	3300050510	Bacteria	6350
360	nmdc:mga06r32_241138_c1	3300050510	Bacteria	1795
361	nmdc:mga06r32_457245_c1	3300050510	Bacteria	1256
362	nmdc:mga06r32_8420_c1	3300050510	Bacteria	9293
363	nmdc:mga08y16_139963_c1	3300050511	Bacteria	2515
364	nmdc:mga08y16_367098_c1	3300050511	Bacteria	1477
365	nmdc:mga08y16_39004_c1	3300050511	Bacteria	4985
366	nmdc:mga08y16_58736_c1	3300050511	Bacteria	3603
367	nmdc:mga08y16_7421_c1	3300050511	Bacteria	11485
368	nmdc:mga0n895_14197_c1	3300050512	Bacteria	7223
369	nmdc:mga0n895_14917_c1	3300050512	Bacteria	7076
370	nmdc:mga0n895_17167_c1	3300050512	Bacteria	6668
371	nmdc:mga0n895_5969_c1	3300050512	Bacteria	10253
372	nmdc:mga0n895_80085_c1	3300050512	Bacteria	3253
373	nmdc:mga0rr50_217937_c1	3300050513	Unclassified	1575
374	nmdc:mga0rr50_517868_c1	3300050513	Bacteria	1015
375	nmdc:mga0rr50_74806_c1	3300050513	Bacteria	2594
376	nmdc:mga0a205_11699_c1	3300050515	Bacteria	8092
377	nmdc:mga0a205_22049_c1	3300050515	Bacteria	6028
378	nmdc:mga0a205_454849_c1	3300050515	Bacteria	1140
379	nmdc:mga0a205_65593_c1	3300050515	Bacteria	3508
380	Ga0495601_0001026	3300053077	Bacteria	15271
381	Ga0495612_0003143	3300053078	Bacteria	6841
382	Ga0590071_000727	3300059421	Bacteria	9283
383	Ga0590075_001270	3300059424	Bacteria	6337
384	Ga0590077_000570	3300059426	Bacteria	10177
385	Ga0530510_0005978	3300061734	Bacteria	8443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050515	nmdc:mga0a205_454849_c1	nmdc:mga0a205_454849_c1_43_930	258
2	3300049568	Ga0501031_0316168	Ga0501031_0316168_34_963	267
3	3300049570	Ga0501033_0354269	Ga0501033_0354269_16_999	282
4	3300049741	Ga0501079_0218699	Ga0501079_0218699_474_1457	282
5	3300050509	nmdc:mga0qj67_38185_c1	nmdc:mga0qj67_38185_c1_20_1003	282
6	3300028573	Ga0265334_10009418	Ga0265334_100094184	285
7	3300028577	Ga0265318_10010895	Ga0265318_100108953	285
8	3300031240	Ga0265320_10024413	Ga0265320_100244133	285
9	3300031241	Ga0265325_10053776	Ga0265325_100537763	285
10	3300031250	Ga0265331_10024078	Ga0265331_100240781	285
11	3300031711	Ga0265314_10055952	Ga0265314_100559523	285
12	3300031712	Ga0265342_10030513	Ga0265342_100305133	285
13	3300005617	Ga0068859_100069981	Ga0068859_1000699812	289
14	3300006038	Ga0075365_10007489	Ga0075365_100074892	289
15	3300006931	Ga0097620_100069978	Ga0097620_1000699783	289
16	3300013308	Ga0157375_10008714	Ga0157375_100087144	289
17	3300025903	Ga0207680_10199965	Ga0207680_101999651	289
18	3300025907	Ga0207645_10060619	Ga0207645_100606193	289
19	3300025918	Ga0207662_10052898	Ga0207662_100528981	289
20	3300025941	Ga0207711_10099334	Ga0207711_100993343	289
21	3300025986	Ga0207658_10145270	Ga0207658_101452702	289
22	3300026121	Ga0207683_10084566	Ga0207683_100845662	289
23	3300006871	Ga0075434_100051281	Ga0075434_1000512813	290
24	3300009147	Ga0114129_10028340	Ga0114129_100283403	290
25	3300050507	nmdc:mga05p37_36476_c1	nmdc:mga05p37_36476_c1_4296_5294	290
26	3300050512	nmdc:mga0n895_14917_c1	nmdc:mga0n895_14917_c1_1132_2130	290
27	3300050513	nmdc:mga0rr50_74806_c1	nmdc:mga0rr50_74806_c1_1247_2245	290
28	3300005440	Ga0070705_100009444	Ga0070705_1000094443	291
29	3300006880	Ga0075429_100015985	Ga0075429_1000159851	291
30	3300042461	Ga0439460_0005953	Ga0439460_0005953_1170_2144	291
31	3300050508	nmdc:mga09592_17987_c1	nmdc:mga09592_17987_c1_4425_5432	291
32	3300050509	nmdc:mga0qj67_38304_c1	nmdc:mga0qj67_38304_c1_1455_2462	291
33	3300059421	Ga0590071_000727	Ga0590071_000727_5255_6292	291
34	3300059424	Ga0590075_001270	Ga0590075_001270_5243_6280	291
35	3300059426	Ga0590077_000570	Ga0590077_000570_4115_5197	291
36	3300025940	Ga0207691_10089489	Ga0207691_100894892	292
37	3300050513	nmdc:mga0rr50_517868_c1	nmdc:mga0rr50_517868_c1_15_950	293
38	3300006847	Ga0075431_100043472	Ga0075431_1000434725	294
39	3300050510	nmdc:mga06r32_18689_c1	nmdc:mga06r32_18689_c1_2630_3637	294
40	3300005471	Ga0070698_100000353	Ga0070698_10000035340	295
41	3300050515	nmdc:mga0a205_22049_c1	nmdc:mga0a205_22049_c1_737_1708	295
42	3300005546	Ga0070696_100058911	Ga0070696_1000589113	296
43	3300005618	Ga0068864_100238592	Ga0068864_1002385922	296
44	3300006852	Ga0075433_10018953	Ga0075433_100189534	296
45	3300006871	Ga0075434_100023121	Ga0075434_1000231213	296
46	3300007076	Ga0075435_100173645	Ga0075435_1001736452	296
47	3300009174	Ga0105241_10255814	Ga0105241_102558142	296
48	3300010375	Ga0105239_10055210	Ga0105239_100552102	296
49	3300050512	nmdc:mga0n895_5969_c1	nmdc:mga0n895_5969_c1_8183_9229	296
50	3300050513	nmdc:mga0rr50_217937_c1	nmdc:mga0rr50_217937_c1_32_1078	296
51	3300005328	Ga0070676_10004034	Ga0070676_100040343	297
52	3300005329	Ga0070683_100246685	Ga0070683_1002466851	297
53	3300005334	Ga0068869_100003439	Ga0068869_1000034392	297
54	3300005339	Ga0070660_100105928	Ga0070660_1001059283	297
55	3300005340	Ga0070689_100104338	Ga0070689_1001043383	297
56	3300005343	Ga0070687_100009121	Ga0070687_1000091213	297
57	3300005347	Ga0070668_100000444	Ga0070668_10000044410	297
58	3300005353	Ga0070669_100031784	Ga0070669_1000317842	297
59	3300005354	Ga0070675_100014907	Ga0070675_1000149073	297
60	3300005364	Ga0070673_100029674	Ga0070673_1000296743	297
61	3300005365	Ga0070688_100049829	Ga0070688_1000498292	297
62	3300005366	Ga0070659_100091713	Ga0070659_1000917133	297
63	3300005367	Ga0070667_100013376	Ga0070667_1000133762	297
64	3300005438	Ga0070701_10038353	Ga0070701_100383532	297
65	3300005441	Ga0070700_100005703	Ga0070700_1000057036	297
66	3300005455	Ga0070663_100062181	Ga0070663_1000621812	297
67	3300005535	Ga0070684_100023616	Ga0070684_1000236162	297
68	3300005543	Ga0070672_100064728	Ga0070672_1000647282	297
69	3300005577	Ga0068857_100082803	Ga0068857_1000828031	297
70	3300005578	Ga0068854_100026113	Ga0068854_1000261132	297
71	3300005616	Ga0068852_100027475	Ga0068852_1000274752	297
72	3300005719	Ga0068861_100016097	Ga0068861_1000160973	297
73	3300005841	Ga0068863_100031527	Ga0068863_1000315273	297
74	3300005843	Ga0068860_100074411	Ga0068860_1000744113	297
75	3300009098	Ga0105245_10151168	Ga0105245_101511682	297
76	3300009147	Ga0114129_10178224	Ga0114129_101782242	297
77	3300009177	Ga0105248_10034349	Ga0105248_100343493	297
78	3300009553	Ga0105249_10003594	Ga0105249_100035947	297
79	3300013102	Ga0157371_10020712	Ga0157371_100207121	297
80	3300013306	Ga0163162_10000455	Ga0163162_100004553	297
81	3300014326	Ga0157380_10008768	Ga0157380_100087685	297
82	3300014968	Ga0157379_10018699	Ga0157379_100186992	297
83	3300017792	Ga0163161_10009702	Ga0163161_100097022	297
84	3300025315	Ga0207697_10004603	Ga0207697_100046033	297
85	3300025904	Ga0207647_10030615	Ga0207647_100306152	297
86	3300025907	Ga0207645_10000687	Ga0207645_1000068710	297
87	3300025913	Ga0207695_10315238	Ga0207695_103152381	297
88	3300025918	Ga0207662_10001597	Ga0207662_100015975	297
89	3300025919	Ga0207657_10052336	Ga0207657_100523363	297
90	3300025920	Ga0207649_10053694	Ga0207649_100536943	297
91	3300025923	Ga0207681_10010449	Ga0207681_100104493	297
92	3300025926	Ga0207659_10050299	Ga0207659_100502992	297
93	3300025927	Ga0207687_10142770	Ga0207687_101427703	297
94	3300025933	Ga0207706_10001099	Ga0207706_1000109918	297
95	3300025940	Ga0207691_10002827	Ga0207691_100028273	297
96	3300025942	Ga0207689_10002768	Ga0207689_100027689	297
97	3300025944	Ga0207661_10078151	Ga0207661_100781513	297
98	3300025945	Ga0207679_10028174	Ga0207679_100281741	297
99	3300025960	Ga0207651_10366746	Ga0207651_103667461	297
100	3300025961	Ga0207712_10018433	Ga0207712_100184332	297
101	3300025981	Ga0207640_10060457	Ga0207640_100604571	297
102	3300025986	Ga0207658_10016778	Ga0207658_100167783	297
103	3300026023	Ga0207677_10013685	Ga0207677_100136853	297
104	3300026067	Ga0207678_10021160	Ga0207678_100211602	297
105	3300026075	Ga0207708_10014222	Ga0207708_100142222	297
106	3300026116	Ga0207674_10005242	Ga0207674_100052421	297
107	3300026118	Ga0207675_100000141	Ga0207675_10000014140	297
108	3300026142	Ga0207698_10060083	Ga0207698_100600832	297
109	3300042012	Ga0439455_0008140	Ga0439455_0008140_1085_2131	297
110	3300050507	nmdc:mga05p37_228848_c1	nmdc:mga05p37_228848_c1_1109_2155	297
111	3300005356	Ga0070674_100083017	Ga0070674_1000830171	298
112	3300005467	Ga0070706_100017325	Ga0070706_1000173252	298
113	3300005543	Ga0070672_100049705	Ga0070672_1000497052	298
114	3300005549	Ga0070704_100022216	Ga0070704_1000222162	298
115	3300005614	Ga0068856_100106939	Ga0068856_1001069393	298
116	3300006881	Ga0068865_100179728	Ga0068865_1001797282	298
117	3300025910	Ga0207684_10023540	Ga0207684_100235403	298
118	3300025940	Ga0207691_10279883	Ga0207691_102798832	298
119	3300025960	Ga0207651_10116253	Ga0207651_101162532	298
120	3300026078	Ga0207702_10022813	Ga0207702_100228132	298
121	3300006844	Ga0075428_100095286	Ga0075428_1000952862	299
122	3300006847	Ga0075431_100181590	Ga0075431_1001815902	299
123	3300006852	Ga0075433_10003192	Ga0075433_1000319210	299
124	3300006871	Ga0075434_100006350	Ga0075434_1000063504	299
125	3300046683	Ga0495658_0004163	Ga0495658_0004163_570_1712	299
126	3300047315	Ga0495581_0104016	Ga0495581_0104016_485_1630	299
127	3300050510	nmdc:mga06r32_160294_c1	nmdc:mga06r32_160294_c1_630_1676	299
128	3300050512	nmdc:mga0n895_17167_c1	nmdc:mga0n895_17167_c1_5560_6606	299
129	3300050515	nmdc:mga0a205_11699_c1	nmdc:mga0a205_11699_c1_4487_5533	299
130	3300025942	Ga0207689_10062626	Ga0207689_100626263	300
131	3300006847	Ga0075431_100078301	Ga0075431_1000783013	303
132	3300006847	Ga0075431_100480008	Ga0075431_1004800081	303
133	3300009094	Ga0111539_10025417	Ga0111539_100254173	303
134	3300027907	Ga0207428_10266288	Ga0207428_102662881	303
135	3300049588	Ga0501072_0098313	Ga0501072_0098313_859_2022	303
136	3300049590	Ga0501074_0062891	Ga0501074_0062891_1448_2611	303
137	3300049743	Ga0501081_0009924	Ga0501081_0009924_79_1155	303
138	3300049824	Ga0501045_0015279	Ga0501045_0015279_995_2158	303
139	3300050510	nmdc:mga06r32_457245_c1	nmdc:mga06r32_457245_c1_124_1140	303
140	3300050510	nmdc:mga06r32_8420_c1	nmdc:mga06r32_8420_c1_1306_2382	303
141	3300050511	nmdc:mga08y16_139963_c1	nmdc:mga08y16_139963_c1_342_1418	303
142	3300061734	Ga0530510_0005978	Ga0530510_0005978_2590_3753	303
143	3300005340	Ga0070689_100120263	Ga0070689_1001202632	304
144	3300005468	Ga0070707_100118046	Ga0070707_1001180464	304
145	3300009176	Ga0105242_10213492	Ga0105242_102134922	304
146	3300013104	Ga0157370_10001160	Ga0157370_1000116031	304
147	3300013308	Ga0157375_10249914	Ga0157375_102499142	304
148	3300025922	Ga0207646_10040245	Ga0207646_100402453	304
149	3300035691	Ga0373931_0003118	Ga0373931_0003118_2722_3744	304
150	3300047319	Ga0495674_0152382	Ga0495674_0152382_218_1222	304
151	3300006880	Ga0075429_100007342	Ga0075429_1000073426	305
152	3300028556	Ga0265337_1000882	Ga0265337_10008827	305
153	3300028573	Ga0265334_10002053	Ga0265334_100020536	305
154	3300028800	Ga0265338_10030988	Ga0265338_100309886	305
155	3300031595	Ga0265313_10018890	Ga0265313_100188902	305
156	3300050508	nmdc:mga09592_22254_c1	nmdc:mga09592_22254_c1_1251_2324	305
157	3300050509	nmdc:mga0qj67_114640_c1	nmdc:mga0qj67_114640_c1_954_2027	305
158	3300005445	Ga0070708_100000549	Ga0070708_1000005499	306
159	3300006852	Ga0075433_10045205	Ga0075433_100452052	306
160	3300009147	Ga0114129_10000688	Ga0114129_1000068815	306
161	3300046499	Ga0495594_0187132	Ga0495594_0187132_28_1128	306
162	3300050507	nmdc:mga05p37_1288_c1	nmdc:mga05p37_1288_c1_1541_2743	306
163	3300006871	Ga0075434_100018278	Ga0075434_1000182783	307
164	3300050512	nmdc:mga0n895_14197_c1	nmdc:mga0n895_14197_c1_3253_4320	307
165	3300009094	Ga0111539_10064459	Ga0111539_100644593	308
166	3300025899	Ga0207642_10044686	Ga0207642_100446862	308
167	3300026089	Ga0207648_10017903	Ga0207648_100179032	308
168	3300050494	nmdc:mga06z11_27035_c1	nmdc:mga06z11_27035_c1_802_1917	309
169	3300006847	Ga0075431_100139375	Ga0075431_1001393752	310
170	3300035116	Ga0373945_0007199	Ga0373945_0007199_2134_3117	310
171	3300035170	Ga0373943_0007913	Ga0373943_0007913_2668_3651	310
172	3300035692	Ga0373935_0011411	Ga0373935_0011411_1988_2971	310
173	3300037068	Ga0373925_0025503	Ga0373925_0025503_2111_3094	310
174	3300046455	Ga0495603_0005433	Ga0495603_0005433_6029_7012	310
175	3300046472	Ga0495580_0002198	Ga0495580_0002198_15374_16357	310
176	3300046475	Ga0495639_0000103	Ga0495639_0000103_33896_34879	310
177	3300046517	Ga0495630_0004874	Ga0495630_0004874_299_1282	310
178	3300046531	Ga0495665_0000287	Ga0495665_0000287_15060_16043	310
179	3300046674	Ga0495588_0000569	Ga0495588_0000569_14784_15767	310
180	3300046683	Ga0495658_0001006	Ga0495658_0001006_9010_9993	310
181	3300046689	Ga0495613_0012074	Ga0495613_0012074_5122_6105	310
182	3300047673	Ga0495593_0000067	Ga0495593_0000067_31714_32697	310
183	3300005434	Ga0070709_10068976	Ga0070709_100689762	311
184	3300006353	Ga0075370_10001417	Ga0075370_1000141712	311
185	3300009147	Ga0114129_10008596	Ga0114129_100085969	311
186	3300025906	Ga0207699_10131244	Ga0207699_101312441	311
187	3300027671	Ga0209588_1005138	Ga0209588_10051384	311
188	3300031903	Ga0307407_10006034	Ga0307407_100060342	311
189	3300050496	nmdc:mga07m45_12703_c1	nmdc:mga07m45_12703_c1_1924_3039	311
190	3300050507	nmdc:mga05p37_76544_c1	nmdc:mga05p37_76544_c1_19_1107	311
191	3300050511	nmdc:mga08y16_39004_c1	nmdc:mga08y16_39004_c1_2746_3789	311
192	3300031548	Ga0307408_100051677	Ga0307408_1000516773	312
193	3300031901	Ga0307406_10002220	Ga0307406_100022205	312
194	3300037068	Ga0373925_0105572	Ga0373925_0105572_703_1749	312
195	3300050511	nmdc:mga08y16_367098_c1	nmdc:mga08y16_367098_c1_33_1079	312
196	3300005355	Ga0070671_100099076	Ga0070671_1000990763	313
197	3300005457	Ga0070662_100034704	Ga0070662_1000347043	313
198	3300006038	Ga0075365_10001939	Ga0075365_1000193910	313
199	3300006844	Ga0075428_100131771	Ga0075428_1001317713	313
200	3300009094	Ga0111539_10002911	Ga0111539_1000291115	313
201	3300025931	Ga0207644_10123831	Ga0207644_101238313	313
202	3300025933	Ga0207706_10027672	Ga0207706_100276721	313
203	3300035695	Ga0373927_0008060	Ga0373927_0008060_3003_4091	313
204	3300050492	nmdc:mga0yw44_16897_c1	nmdc:mga0yw44_16897_c1_20_1135	313
205	3300050511	nmdc:mga08y16_7421_c1	nmdc:mga08y16_7421_c1_7832_9187	313
206	3300005356	Ga0070674_100195339	Ga0070674_1001953391	314
207	3300005365	Ga0070688_100006370	Ga0070688_1000063703	314
208	3300028379	Ga0268266_10080535	Ga0268266_100805353	314
209	3300035086	Ga0373934_0003202	Ga0373934_0003202_4805_5863	314
210	3300046459	Ga0495629_0025605	Ga0495629_0025605_773_1831	314
211	3300046511	Ga0495608_0004387	Ga0495608_0004387_1842_2900	314
212	3300046516	Ga0495628_0000296	Ga0495628_0000296_7912_8970	314
213	3300046529	Ga0495652_0000270	Ga0495652_0000270_37026_38084	314
214	3300046531	Ga0495665_0100783	Ga0495665_0100783_205_1263	314
215	3300046543	Ga0495645_0007235	Ga0495645_0007235_3832_4890	314
216	3300046559	Ga0495667_0024162	Ga0495667_0024162_2959_4017	314
217	3300046679	Ga0495623_0000049	Ga0495623_0000049_9281_10339	314
218	3300046680	Ga0495646_0021399	Ga0495646_0021399_1237_2295	314
219	3300047319	Ga0495674_0015276	Ga0495674_0015276_1537_2595	314
220	3300047471	Ga0495684_0000109	Ga0495684_0000109_51484_52542	314
221	3300005548	Ga0070665_100037240	Ga0070665_1000372402	315
222	3300009094	Ga0111539_10344357	Ga0111539_103443572	315
223	3300013308	Ga0157375_10024757	Ga0157375_100247575	315
224	3300014969	Ga0157376_10171244	Ga0157376_101712442	315
225	3300025972	Ga0207668_10101742	Ga0207668_101017423	315
226	3300026095	Ga0207676_10021540	Ga0207676_100215405	315
227	3300042876	Ga0451577_0000005	Ga0451577_0000005_656942_658000	315
228	3300005336	Ga0070680_100008077	Ga0070680_1000080772	316
229	3300005530	Ga0070679_100135750	Ga0070679_1001357502	316
230	3300025909	Ga0207705_10141717	Ga0207705_101417171	316
231	3300025917	Ga0207660_10003398	Ga0207660_100033988	316
232	3300025921	Ga0207652_10037185	Ga0207652_100371852	316
233	3300031995	Ga0307409_100046092	Ga0307409_1000460922	316
234	3300035170	Ga0373943_0103578	Ga0373943_0103578_17_1063	317
235	3300046535	Ga0495586_0123497	Ga0495586_0123497_94_1140	317
236	3300005329	Ga0070683_100223794	Ga0070683_1002237942	318
237	3300005331	Ga0070670_100017119	Ga0070670_1000171193	318
238	3300005366	Ga0070659_100131103	Ga0070659_1001311031	318
239	3300005458	Ga0070681_10027782	Ga0070681_100277823	318
240	3300005530	Ga0070679_100010107	Ga0070679_1000101078	318
241	3300005535	Ga0070684_100018797	Ga0070684_1000187974	318
242	3300005564	Ga0070664_100004392	Ga0070664_1000043926	318
243	3300005577	Ga0068857_100005706	Ga0068857_1000057067	318
244	3300005834	Ga0068851_10129230	Ga0068851_101292302	318
245	3300013105	Ga0157369_10021769	Ga0157369_100217693	318
246	3300013296	Ga0157374_10113630	Ga0157374_101136302	318
247	3300014325	Ga0163163_10006856	Ga0163163_100068565	318
248	3300025321	Ga0207656_10014973	Ga0207656_100149733	318
249	3300025912	Ga0207707_10017517	Ga0207707_100175174	318
250	3300025917	Ga0207660_10016002	Ga0207660_100160023	318
251	3300025921	Ga0207652_10039161	Ga0207652_100391613	318
252	3300025921	Ga0207652_10048271	Ga0207652_100482713	318
253	3300025932	Ga0207690_10028153	Ga0207690_100281533	318
254	3300025944	Ga0207661_10177303	Ga0207661_101773032	318
255	3300025945	Ga0207679_10015881	Ga0207679_100158813	318
256	3300026095	Ga0207676_10018936	Ga0207676_100189361	318
257	3300026116	Ga0207674_10000142	Ga0207674_100001423	318
258	3300035170	Ga0373943_0129597	Ga0373943_0129597_216_1304	318
259	3300042876	Ga0451577_0185145	Ga0451577_0185145_182_1219	318
260	3300046517	Ga0495630_0067745	Ga0495630_0067745_859_1947	318
261	3300046535	Ga0495586_0049804	Ga0495586_0049804_658_1746	318
262	3300047315	Ga0495581_0024621	Ga0495581_0024621_1008_2096	318
263	3300047471	Ga0495684_0051929	Ga0495684_0051929_890_1978	318
264	3300047673	Ga0495593_0076852	Ga0495593_0076852_184_1272	318
265	3300048912	Ga0496109_0420062	Ga0496109_0420062_148_1194	318
266	3300025945	Ga0207679_10044627	Ga0207679_100446273	319
267	3300046535	Ga0495586_0025133	Ga0495586_0025133_12_1073	320
268	3300005535	Ga0070684_100051917	Ga0070684_1000519173	322
269	3300026078	Ga0207702_10117101	Ga0207702_101171012	323
270	3300005535	Ga0070684_100162522	Ga0070684_1001625222	325
271	3300044684	Ga0466966_0042672	Ga0466966_0042672_281_1345	325
272	3300013306	Ga0163162_10086452	Ga0163162_100864524	327
273	3300047444	Ga0495675_0025453	Ga0495675_0025453_1974_3047	327
274	3300050509	nmdc:mga0qj67_84494_c1	nmdc:mga0qj67_84494_c1_971_2038	327
275	3300047471	Ga0495684_0071011	Ga0495684_0071011_13_1137	328
276	3300006844	Ga0075428_100077192	Ga0075428_1000771923	330
277	3300050512	nmdc:mga0n895_80085_c1	nmdc:mga0n895_80085_c1_313_1395	330
278	3300005458	Ga0070681_10121919	Ga0070681_101219192	331
279	3300005467	Ga0070706_100066065	Ga0070706_1000660653	331
280	3300005471	Ga0070698_100025715	Ga0070698_1000257155	331
281	3300025910	Ga0207684_10046601	Ga0207684_100466013	331
282	3300025912	Ga0207707_10117869	Ga0207707_101178692	331
283	3300005434	Ga0070709_10067902	Ga0070709_100679022	332
284	3300005841	Ga0068863_100022872	Ga0068863_1000228724	332
285	3300005842	Ga0068858_100220222	Ga0068858_1002202223	332
286	3300009094	Ga0111539_10137713	Ga0111539_101377133	332
287	3300025928	Ga0207700_10017871	Ga0207700_100178713	332
288	3300025929	Ga0207664_10171910	Ga0207664_101719102	332
289	3300026035	Ga0207703_10202863	Ga0207703_102028631	332
290	3300026088	Ga0207641_10028189	Ga0207641_100281894	332
291	3300005329	Ga0070683_100010824	Ga0070683_1000108245	333
292	3300005439	Ga0070711_100047916	Ga0070711_1000479162	333
293	3300005535	Ga0070684_100147727	Ga0070684_1001477272	333
294	3300005564	Ga0070664_100100133	Ga0070664_1001001332	333
295	3300005614	Ga0068856_100321034	Ga0068856_1003210342	333
296	3300009094	Ga0111539_10137774	Ga0111539_101377742	333
297	3300009545	Ga0105237_10259265	Ga0105237_102592652	333
298	3300013307	Ga0157372_10231486	Ga0157372_102314862	333
299	3300025913	Ga0207695_10235719	Ga0207695_102357192	333
300	3300025915	Ga0207693_10005649	Ga0207693_100056495	333
301	3300025916	Ga0207663_10210906	Ga0207663_102109061	333
302	3300026078	Ga0207702_10294737	Ga0207702_102947371	333
303	3300026116	Ga0207674_10101016	Ga0207674_101010161	333
304	3300027907	Ga0207428_10052731	Ga0207428_100527313	333
305	3300031548	Ga0307408_100047454	Ga0307408_1000474543	333
306	3300032126	Ga0307415_100043751	Ga0307415_1000437513	333
307	3300035111	Ga0373923_0000342	Ga0373923_0000342_1178_2236	333
308	3300035118	Ga0373954_0008450	Ga0373954_0008450_1755_2813	333
309	3300035172	Ga0373955_0007405	Ga0373955_0007405_1523_2581	333
310	3300035410	Ga0373924_0015867	Ga0373924_0015867_193_1251	333
311	3300035724	Ga0373933_0001447	Ga0373933_0001447_7911_8969	333
312	3300036401	Ga0373937_0000129	Ga0373937_0000129_7213_8271	333
313	3300045976	Ga0466967_0010713	Ga0466967_0010713_780_1844	333
314	3300046454	Ga0495592_0029451	Ga0495592_0029451_1229_2287	333
315	3300046462	Ga0495651_0010571	Ga0495651_0010571_152_1210	333
316	3300046463	Ga0495653_0000078	Ga0495653_0000078_62311_63369	333
317	3300046477	Ga0495664_0063768	Ga0495664_0063768_575_1633	333
318	3300046517	Ga0495630_0012766	Ga0495630_0012766_3832_4890	333
319	3300046535	Ga0495586_0029350	Ga0495586_0029350_946_2004	333
320	3300046536	Ga0495587_0000450	Ga0495587_0000450_7353_8411	333
321	3300046663	Ga0495635_0000047	Ga0495635_0000047_26552_27610	333
322	3300046675	Ga0495657_0000116	Ga0495657_0000116_7353_8411	333
323	3300046678	Ga0495599_0005619	Ga0495599_0005619_1283_2341	333
324	3300046809	Ga0495600_0000108	Ga0495600_0000108_8192_9250	333
325	3300047317	Ga0495604_0000133	Ga0495604_0000133_35469_36527	333
326	3300047322	Ga0495680_0059428	Ga0495680_0059428_1312_2370	333
327	3300047444	Ga0495675_0019160	Ga0495675_0019160_1970_3028	333
328	3300048088	Ga0495602_0000679	Ga0495602_0000679_23973_25031	333
329	3300050511	nmdc:mga08y16_58736_c1	nmdc:mga08y16_58736_c1_1567_2664	333
330	3300053077	Ga0495601_0001026	Ga0495601_0001026_5918_6976	333
331	3300053078	Ga0495612_0003143	Ga0495612_0003143_1191_2249	333
332	3300005436	Ga0070713_100004409	Ga0070713_1000044096	334
333	3300005439	Ga0070711_100057567	Ga0070711_1000575672	334
334	3300005458	Ga0070681_10002478	Ga0070681_100024789	334
335	3300005530	Ga0070679_100009381	Ga0070679_1000093816	334
336	3300007076	Ga0075435_100315027	Ga0075435_1003150272	334
337	3300009147	Ga0114129_10039053	Ga0114129_100390532	334
338	3300025912	Ga0207707_10006674	Ga0207707_100066747	334
339	3300025921	Ga0207652_10007563	Ga0207652_100075634	334
340	3300031238	Ga0265332_10009239	Ga0265332_100092393	334
341	3300031711	Ga0265314_10004846	Ga0265314_100048465	334
342	3300035086	Ga0373934_0021166	Ga0373934_0021166_582_1676	334
343	3300035172	Ga0373955_0003907	Ga0373955_0003907_1408_2502	334
344	3300036401	Ga0373937_0000101	Ga0373937_0000101_8914_10008	334
345	3300042015	Ga0439462_0026918	Ga0439462_0026918_208_1302	334
346	3300042156	Ga0439446_0015218	Ga0439446_0015218_192_1286	334
347	3300045976	Ga0466967_0089237	Ga0466967_0089237_697_1824	334
348	3300046529	Ga0495652_0015570	Ga0495652_0015570_4220_5314	334
349	3300046536	Ga0495587_0001287	Ga0495587_0001287_11854_12948	334
350	3300046543	Ga0495645_0000645	Ga0495645_0000645_14011_15105	334
351	3300046559	Ga0495667_0003465	Ga0495667_0003465_9271_10365	334
352	3300046678	Ga0495599_0000730	Ga0495599_0000730_9215_10309	334
353	3300046679	Ga0495623_0007971	Ga0495623_0007971_2104_3198	334
354	3300048911	Ga0496108_0181663	Ga0496108_0181663_250_1296	334
355	3300050507	nmdc:mga05p37_62858_c1	nmdc:mga05p37_62858_c1_3122_4357	334
356	3300050510	nmdc:mga06r32_241138_c1	nmdc:mga06r32_241138_c1_532_1761	334
357	3300005329	Ga0070683_100110181	Ga0070683_1001101813	335
358	3300005535	Ga0070684_100072308	Ga0070684_1000723081	335
359	3300005341	Ga0070691_10029373	Ga0070691_100293732	336
360	3300013105	Ga0157369_10068031	Ga0157369_100680312	336
361	3300050515	nmdc:mga0a205_65593_c1	nmdc:mga0a205_65593_c1_744_1841	336
362	3300046472	Ga0495580_0007000	Ga0495580_0007000_1491_2654	337
363	3300046475	Ga0495639_0016547	Ga0495639_0016547_305_1468	337
364	3300046499	Ga0495594_0058564	Ga0495594_0058564_768_1931	337
365	3300047319	Ga0495674_0156859	Ga0495674_0156859_703_1866	337
366	3300005329	Ga0070683_100063505	Ga0070683_1000635052	338
367	3300005331	Ga0070670_100020503	Ga0070670_1000205034	338
368	3300005353	Ga0070669_100034468	Ga0070669_1000344681	338
369	3300005364	Ga0070673_100331528	Ga0070673_1003315281	338
370	3300005457	Ga0070662_100016978	Ga0070662_1000169782	338
371	3300005564	Ga0070664_100054639	Ga0070664_1000546392	338
372	3300006881	Ga0068865_100408885	Ga0068865_1004088851	338
373	3300009177	Ga0105248_10151983	Ga0105248_101519833	338
374	3300025923	Ga0207681_10041410	Ga0207681_100414101	338
375	3300025925	Ga0207650_10023479	Ga0207650_100234794	338
376	3300025926	Ga0207659_10026394	Ga0207659_100263944	338
377	3300025933	Ga0207706_10029337	Ga0207706_100293372	338
378	3300025940	Ga0207691_10032056	Ga0207691_100320562	338
379	3300025944	Ga0207661_10109272	Ga0207661_101092722	338
380	3300026089	Ga0207648_10156530	Ga0207648_101565301	338
381	3300026095	Ga0207676_10267072	Ga0207676_102670722	338
382	3300045976	Ga0466967_0143819	Ga0466967_0143819_114_1229	339
383	3300005530	Ga0070679_100243865	Ga0070679_1002438651	342
384	3300004800	Ga0058861_11503876	Ga0058861_115038762	344
385	3300004803	Ga0058862_12826741	Ga0058862_128267412	344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01436

NHL

NHL repeat

237

264

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7qrv-assembly2.cif.gz_B	crystal structure of nhl domain of trim2 (full c-terminal)	0.8455	53	343
7qrw-assembly1.cif.gz_A	crystal structure of nhl domain of trim3	0.8394	49	344
6qsh-assembly1.cif.gz_A-2	crystal structure of the hybrid bioinorganic complex of pizza6s linked by the 1:2 ce-substituted keggin	0.8391	42	341
7nyq-assembly1.cif.gz_A	crystal structure of the mei-p26 nhl domain	0.8382	112	330
4zlr-assembly1.cif.gz_A	structure of the brat-nhl domain bound to consensus rna motif	0.8249	37	343

ID	Description	Score	Start	End	Superfamily
af_B7YZK8_1340_1431_2.40.10.500	Mainly Beta;Beta Barrel;Thrombin, subunit H;	0.933	161	250	2.40.10.500
af_D3ZVM4_770_855_2.40.10.500	Mainly Beta;Beta Barrel;Thrombin, subunit H;	0.8905	150	242	2.40.10.500
af_Q9U489_879_1020_2.40.10.500	Mainly Beta;Beta Barrel;Thrombin, subunit H;	0.886	109	244	2.40.10.500
af_B7YZK8_1231_1339_2.40.10.500	Mainly Beta;Beta Barrel;Thrombin, subunit H;	0.8753	142	252	2.40.10.500
af_Q03601_692_793_2.40.10.500	Mainly Beta;Beta Barrel;Thrombin, subunit H;	0.875	156	250	2.40.10.500

ID	Description	Score	Start	End	GO Terms
AF-A0A812IPI2-F1-model_v4	deleted	0.9669	47	344
AF-A0A534V770-F1-model_v4	6-bladed beta-propeller	0.9591	34	344
AF-A0A2A5W755-F1-model_v4	6-bladed beta-propeller	0.9591	32	343	GO:0005576
AF-A0A536SU18-F1-model_v4	6-bladed beta-propeller	0.9563	170	344
AF-A0A2D6QYE7-F1-model_v4	6-bladed beta-propeller	0.9551	30	343

Feature Viewer

pLDDT	pTM	Quality
86.49	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F430276

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01436

NHL

NHL repeat

237

264

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map