F429510

General Info

Members Datasets Scaffolds Average Seq Length
383 161 766 299

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100243047|Ga0070662_1002430472
Length 321
Sequence MRYDFMTLDVFTDTPFGGNQLAVLTDARGLTTEAMQAIAKEFDYPETTFVLPPDDPAHARRVRIFTPGGELPFAGHPTVGTACALVMSNQCPVGDFVLEEGVGPVAVSTRRDGGAYSARLRIARAPEVPDTVPASNDVAAVVSLQPGDVLGVFCAGMGPRFTFAQVASREVVDRAQLDHQSWRRILADSWGAQVFVFAGELSDGSELYGRMFAPALGIAEDPATGAAAAAIVGTAALRAGAVKSRTFGLDIVQGVAMGRPSFLSASAELEAGTVSAIEVGGGCAFIAEGQIEVPDHLLEQDWLRGTKAAANETVSMCEEHE

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.53
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100243047 3300005457 Bacteria 1444
2 JGI24736J21556_1006787 3300001904 Bacteria 1925
3 JGI24737J22298_10008905 3300001990 Bacteria 3348
4 Ga0065712_10174295 3300005290 Unclassified 1226
5 Ga0065715_10282325 3300005293 Bacteria 1083
6 Ga0070658_10380972 3300005327 Bacteria 1210
7 Ga0070658_10395108 3300005327 Bacteria 1187
8 Ga0070683_100024150 3300005329 Bacteria 5441
9 Ga0070690_100000906 3300005330 Bacteria 15097
10 Ga0070690_100009642 3300005330 Bacteria 5598
11 Ga0070690_100113494 3300005330 Bacteria 1811
12 Ga0070690_100180172 3300005330 Bacteria 1459
13 Ga0070670_100003051 3300005331 Bacteria 13855
14 Ga0070670_100038081 3300005331 Bacteria 4135
15 Ga0070670_100061767 3300005331 Bacteria 3216
16 Ga0070670_100063441 3300005331 Bacteria 3171
17 Ga0070670_100086110 3300005331 Bacteria 2700
18 Ga0070670_100514699 3300005331 Bacteria 1065
19 Ga0070670_100597629 3300005331 Bacteria 987
20 Ga0068869_100005365 3300005334 Bacteria 8056
21 Ga0068869_100040847 3300005334 Bacteria 3318
22 Ga0070666_10001960 3300005335 Bacteria 12530
23 Ga0070666_10009066 3300005335 Bacteria 6201
24 Ga0070666_10053207 3300005335 Bacteria 2730
25 Ga0070666_10085115 3300005335 Bacteria 2165
26 Ga0070680_100063688 3300005336 Bacteria 3021
27 Ga0068868_100012977 3300005338 Bacteria 6096
28 Ga0068868_100020618 3300005338 Bacteria 4956
29 Ga0068868_100241299 3300005338 Bacteria 1518
30 Ga0070687_100053841 3300005343 Bacteria 2094
31 Ga0070687_100208991 3300005343 Bacteria 1188
32 Ga0070661_100053092 3300005344 Bacteria 2966
33 Ga0070661_100349583 3300005344 Bacteria 1159
34 Ga0070692_10004020 3300005345 Bacteria 6073
35 Ga0070692_10012145 3300005345 Bacteria 3975
36 Ga0070668_100052877 3300005347 Bacteria 3132
37 Ga0070668_100066124 3300005347 Bacteria 2804
38 Ga0070668_100079983 3300005347 Bacteria 2560
39 Ga0070669_100015518 3300005353 Bacteria 5430
40 Ga0070669_100043036 3300005353 Bacteria 3287
41 Ga0070669_100071984 3300005353 Bacteria 2559
42 Ga0070669_100125356 3300005353 Bacteria 1965
43 Ga0070675_100028757 3300005354 Bacteria 4476
44 Ga0070671_100008370 3300005355 Bacteria 8287
45 Ga0070671_100016112 3300005355 Bacteria 6043
46 Ga0070671_100534084 3300005355 Bacteria 1011
47 Ga0070673_100008718 3300005364 Bacteria 6766
48 Ga0070673_100040473 3300005364 Bacteria 3576
49 Ga0070673_100064692 3300005364 Bacteria 2915
50 Ga0070673_100078675 3300005364 Bacteria 2668
51 Ga0070659_100003703 3300005366 Bacteria 10905
52 Ga0070659_100031802 3300005366 Unclassified 4089
53 Ga0070667_100005169 3300005367 Bacteria 10915
54 Ga0070667_100011036 3300005367 Bacteria 7472
55 Ga0070667_100016380 3300005367 Bacteria 6133
56 Ga0070667_100021157 3300005367 Bacteria 5405
57 Ga0070667_100024510 3300005367 Bacteria 5010
58 Ga0070667_100079268 3300005367 Bacteria 2807
59 Ga0070667_100117555 3300005367 Bacteria 2310
60 Ga0070667_100161919 3300005367 Bacteria 1971
61 Ga0070667_100184819 3300005367 Unclassified 1844
62 Ga0070667_100274470 3300005367 Bacteria 1512
63 Ga0070701_10020176 3300005438 Bacteria 3161
64 Ga0070700_100002523 3300005441 Bacteria 9337
65 Ga0070694_100003942 3300005444 Bacteria 8882
66 Ga0070663_100014592 3300005455 Bacteria 5047
67 Ga0070678_100013999 3300005456 Bacteria 5044
68 Ga0070678_100045760 3300005456 Bacteria 3133
69 Ga0070678_100098228 3300005456 Bacteria 2263
70 Ga0070662_100002727 3300005457 Bacteria 10907
71 Ga0070662_100003588 3300005457 Bacteria 9676
72 Ga0070662_100027615 3300005457 Unclassified 3942
73 Ga0070662_100062810 3300005457 Bacteria 2715
74 Ga0070662_100421541 3300005457 Bacteria 1104
75 Ga0068867_100003220 3300005459 Bacteria 11510
76 Ga0068867_100073479 3300005459 Bacteria 2560
77 Ga0068867_100156188 3300005459 Bacteria 1796
78 Ga0070707_100392846 3300005468 Unclassified 1347
79 Ga0070684_100012260 3300005535 Bacteria 6864
80 Ga0070684_100381508 3300005535 Bacteria 1298
81 Ga0070672_100015913 3300005543 Bacteria 5372
82 Ga0070672_100080713 3300005543 Bacteria 2606
83 Ga0070686_100000683 3300005544 Bacteria 19702
84 Ga0070686_100103891 3300005544 Bacteria 1924
85 Ga0070696_100005042 3300005546 Bacteria 8822
86 Ga0070693_100030237 3300005547 Bacteria 2960
87 Ga0070665_100000132 3300005548 Bacteria 140229
88 Ga0070665_100021330 3300005548 Bacteria 6516
89 Ga0070665_100028082 3300005548 Bacteria 5667
90 Ga0070665_100184438 3300005548 Bacteria 2087
91 Ga0070704_100140942 3300005549 Bacteria 1882
92 Ga0068855_100047326 3300005563 Bacteria 5081
93 Ga0068855_100104812 3300005563 Bacteria 3252
94 Ga0068855_100188195 3300005563 Bacteria 2330
95 Ga0070664_100002315 3300005564 Bacteria 15306
96 Ga0070664_100002816 3300005564 Bacteria 14064
97 Ga0070664_100003997 3300005564 Bacteria 11853
98 Ga0070664_100016758 3300005564 Bacteria 6012
99 Ga0070664_100057156 3300005564 Bacteria 3315
100 Ga0068857_100013039 3300005577 Bacteria 7241
101 Ga0068857_100064988 3300005577 Unclassified 3244
102 Ga0068854_100122175 3300005578 Bacteria 1979
103 Ga0070702_100005588 3300005615 Bacteria 5879
104 Ga0068852_100138461 3300005616 Bacteria 2250
105 Ga0068859_100000689 3300005617 Bacteria 33880
106 Ga0068859_100030537 3300005617 Bacteria 5408
107 Ga0068859_100111486 3300005617 Bacteria 2799
108 Ga0068859_100119424 3300005617 Bacteria 2703
109 Ga0068859_100130256 3300005617 Bacteria 2587
110 Ga0068859_100150228 3300005617 Unclassified 2405
111 Ga0068859_100205609 3300005617 Unclassified 2054
112 Ga0068864_100001152 3300005618 Bacteria 21995
113 Ga0068864_100016766 3300005618 Bacteria 6106
114 Ga0068864_100042287 3300005618 Bacteria 3899
115 Ga0068864_100080240 3300005618 Unclassified 2858
116 Ga0068866_10000810 3300005718 Bacteria 13967
117 Ga0068861_100008809 3300005719 Bacteria 6949
118 Ga0068851_10010025 3300005834 Bacteria 4412
119 Ga0068863_100004516 3300005841 Bacteria 13729
120 Ga0068863_100004910 3300005841 Bacteria 13176
121 Ga0068863_100006956 3300005841 Bacteria 11092
122 Ga0068863_100009253 3300005841 Bacteria 9609
123 Ga0068863_100125610 3300005841 Bacteria 2447
124 Ga0068863_100232930 3300005841 Bacteria 1777
125 Ga0068858_100014168 3300005842 Bacteria 7519
126 Ga0068858_100031271 3300005842 Bacteria 4942
127 Ga0068858_100035016 3300005842 Bacteria 4657
128 Ga0068858_100080105 3300005842 Bacteria 3034
129 Ga0068858_100110348 3300005842 Bacteria 2569
130 Ga0068858_100121338 3300005842 Unclassified 2444
131 Ga0068860_100010288 3300005843 Bacteria 9253
132 Ga0068860_100018770 3300005843 Bacteria 6719
133 Ga0068860_100019591 3300005843 Bacteria 6561
134 Ga0068860_100020647 3300005843 Bacteria 6381
135 Ga0068860_100055653 3300005843 Plasmid 3761
136 Ga0068862_100007859 3300005844 Bacteria 8823
137 Ga0068862_100008525 3300005844 Bacteria 8480
138 Ga0068862_100013464 3300005844 Bacteria 6771
139 Ga0068862_100016074 3300005844 Bacteria 6223
140 Ga0068862_100035301 3300005844 Bacteria 4233
141 Ga0068862_100208598 3300005844 Bacteria 1765
142 Ga0097621_100001668 3300006237 Bacteria 15192
143 Ga0097621_100245481 3300006237 Bacteria 1566
144 Ga0068871_100095397 3300006358 Unclassified 2484
145 Ga0075433_10015055 3300006852 Bacteria 6332
146 Ga0068865_100002868 3300006881 Bacteria 10272
147 Ga0068865_100039955 3300006881 Bacteria 3185
148 Ga0068865_100145543 3300006881 Unclassified 1792
149 Ga0068865_100442082 3300006881 Bacteria 1073
150 Ga0097620_100000689 3300006931 Bacteria 33880
151 Ga0097620_100030539 3300006931 Bacteria 5408
152 Ga0097620_100111483 3300006931 Bacteria 2799
153 Ga0097620_100119427 3300006931 Bacteria 2703
154 Ga0097620_100130253 3300006931 Bacteria 2587
155 Ga0097620_100150233 3300006931 Unclassified 2405
156 Ga0097620_100205612 3300006931 Unclassified 2054
157 Ga0105250_10011428 3300009092 Bacteria 3683
158 Ga0105240_10030382 3300009093 Bacteria 7022
159 Ga0105240_10114679 3300009093 Bacteria 3255
160 Ga0105245_10002540 3300009098 Bacteria 16450
161 Ga0105245_10049384 3300009098 Bacteria 3768
162 Ga0105245_10331697 3300009098 Bacteria 1502
163 Ga0105247_10119521 3300009101 Bacteria 1706
164 Ga0105243_10002977 3300009148 Bacteria 13997
165 Ga0105243_10014246 3300009148 Bacteria 6016
166 Ga0105242_10024901 3300009176 Bacteria 4730
167 Ga0105242_10034772 3300009176 Bacteria 4040
168 Ga0105242_10181338 3300009176 Bacteria 1858
169 Ga0105248_10005351 3300009177 Bacteria 14122
170 Ga0105248_10005826 3300009177 Bacteria 13544
171 Ga0105248_10007623 3300009177 Bacteria 11890
172 Ga0105248_10021399 3300009177 Bacteria 7166
173 Ga0105248_10268888 3300009177 Bacteria 1919
174 Ga0105248_10443397 3300009177 Bacteria 1463
175 Ga0105238_10425505 3300009551 Bacteria 1323
176 Ga0105249_10001380 3300009553 Bacteria 21246
177 Ga0105249_10013203 3300009553 Bacteria 7289
178 Ga0105249_10021634 3300009553 Bacteria 5759
179 Ga0105249_10082199 3300009553 Bacteria 2997
180 Ga0105249_10160945 3300009553 Bacteria 2169
181 Ga0105246_10078048 3300011119 Bacteria 2351
182 Ga0105246_10415811 3300011119 Bacteria 1121
183 Ga0157373_10009695 3300013100 Bacteria 7108
184 Ga0157373_10032760 3300013100 Bacteria 3740
185 Ga0157373_10042838 3300013100 Bacteria 3234
186 Ga0157373_10073400 3300013100 Bacteria 2414
187 Ga0157371_10019191 3300013102 Bacteria 5045
188 Ga0157371_10047525 3300013102 Bacteria 3051
189 Ga0157369_10051955 3300013105 Bacteria 4435
190 Ga0171462_1028 3300013250 Bacteria 110760
191 Ga0157374_10004572 3300013296 Bacteria 11608
192 Ga0157378_10096695 3300013297 Unclassified 2691
193 Ga0163162_10046516 3300013306 Bacteria 4349
194 Ga0163162_10064748 3300013306 Plasmid 3701
195 Ga0163162_10069704 3300013306 Bacteria 3568
196 Ga0163162_10120808 3300013306 Bacteria 2724
197 Ga0163162_10218879 3300013306 Bacteria 2034
198 Ga0163162_10275259 3300013306 Bacteria 1815
199 Ga0157375_10001728 3300013308 Bacteria 18764
200 Ga0157375_10038959 3300013308 Bacteria 4568
201 Ga0157375_10210266 3300013308 Bacteria 2103
202 Ga0157375_10342232 3300013308 Bacteria 1661
203 Ga0157375_10600422 3300013308 Bacteria 1260
204 Ga0163163_10020424 3300014325 Bacteria 6235
205 Ga0163163_10064360 3300014325 Bacteria 3638
206 Ga0163163_10392312 3300014325 Bacteria 1446
207 Ga0157380_10145824 3300014326 Bacteria 2040
208 Ga0157379_10006841 3300014968 Bacteria 9857
209 Ga0157379_10026282 3300014968 Bacteria 5182
210 Ga0157379_10076867 3300014968 Bacteria 2989
211 Ga0157376_10009802 3300014969 Bacteria 6981
212 Ga0157376_10053733 3300014969 Bacteria 3355
213 Ga0213875_10000157 3300021388 Bacteria 71961
214 Ga0207710_10066826 3300025900 Bacteria 1641
215 Ga0207688_10046432 3300025901 Bacteria 2425
216 Ga0207680_10205465 3300025903 Bacteria 1344
217 Ga0207647_10005894 3300025904 Bacteria 8932
218 Ga0207645_10000896 3300025907 Bacteria 24720
219 Ga0207645_10026824 3300025907 Bacteria 3722
220 Ga0207705_10138522 3300025909 Bacteria 1816
221 Ga0207695_10228966 3300025913 Bacteria 1764
222 Ga0207660_10256885 3300025917 Bacteria 1380
223 Ga0207657_10025540 3300025919 Bacteria 5445
224 Ga0207657_10083353 3300025919 Bacteria 2682
225 Ga0207657_10135872 3300025919 Bacteria 2012
226 Ga0207649_10057951 3300025920 Bacteria 2424
227 Ga0207646_10346390 3300025922 Unclassified 1343
228 Ga0207681_10004506 3300025923 Bacteria 8580
229 Ga0207681_10019554 3300025923 Bacteria 4280
230 Ga0207681_10102758 3300025923 Bacteria 2064
231 Ga0207681_10164884 3300025923 Unclassified 1674
232 Ga0207694_10284965 3300025924 Bacteria 1358
233 Ga0207650_10001442 3300025925 Bacteria 17123
234 Ga0207650_10004391 3300025925 Bacteria 9636
235 Ga0207659_10075751 3300025926 Bacteria 2470
236 Ga0207687_10043340 3300025927 Bacteria 3100
237 Ga0207687_10059217 3300025927 Bacteria 2697
238 Ga0207644_10002809 3300025931 Bacteria 11222
239 Ga0207644_10024526 3300025931 Bacteria 4142
240 Ga0207644_10183667 3300025931 Bacteria 1640
241 Ga0207690_10007225 3300025932 Bacteria 6597
242 Ga0207706_10000511 3300025933 Bacteria 41312
243 Ga0207706_10006959 3300025933 Bacteria 10453
244 Ga0207706_10010750 3300025933 Bacteria 8356
245 Ga0207706_10057697 3300025933 Unclassified 3420
246 Ga0207706_10095279 3300025933 Bacteria 2618
247 Ga0207706_10119366 3300025933 Bacteria 2318
248 Ga0207706_10393175 3300025933 Bacteria 1202
249 Ga0207686_10005231 3300025934 Bacteria 6967
250 Ga0207686_10297408 3300025934 Bacteria 1198
251 Ga0207669_10023801 3300025937 Unclassified 3279
252 Ga0207704_10007486 3300025938 Bacteria 5163
253 Ga0207704_10342026 3300025938 Unclassified 1162
254 Ga0207691_10001489 3300025940 Bacteria 23346
255 Ga0207691_10005733 3300025940 Bacteria 12009
256 Ga0207691_10046594 3300025940 Bacteria 3982
257 Ga0207691_10049867 3300025940 Bacteria 3835
258 Ga0207691_10079351 3300025940 Unclassified 2954
259 Ga0207711_10000044 3300025941 Bacteria 157113
260 Ga0207711_10002214 3300025941 Bacteria 17465
261 Ga0207689_10000558 3300025942 Bacteria 35566
262 Ga0207689_10003382 3300025942 Bacteria 14579
263 Ga0207689_10016284 3300025942 Bacteria 6298
264 Ga0207679_10001973 3300025945 Bacteria 12721
265 Ga0207679_10034914 3300025945 Bacteria 3553
266 Ga0207679_10189510 3300025945 Bacteria 1708
267 Ga0207667_10011837 3300025949 Bacteria 10104
268 Ga0207667_10022500 3300025949 Bacteria 6960
269 Ga0207651_10006467 3300025960 Bacteria 6138
270 Ga0207651_10028744 3300025960 Bacteria 3511
271 Ga0207651_10038264 3300025960 Unclassified 3151
272 Ga0207651_10047537 3300025960 Bacteria 2894
273 Ga0207651_10065932 3300025960 Bacteria 2542
274 Ga0207712_10002871 3300025961 Bacteria 11020
275 Ga0207712_10320921 3300025961 Bacteria 1278
276 Ga0207668_10000070 3300025972 Bacteria 78666
277 Ga0207668_10053536 3300025972 Bacteria 2797
278 Ga0207668_10109767 3300025972 Unclassified 2067
279 Ga0207668_10117916 3300025972 Bacteria 2004
280 Ga0207658_10003675 3300025986 Bacteria 10817
281 Ga0207658_10008681 3300025986 Bacteria 6903
282 Ga0207658_10030715 3300025986 Bacteria 3807
283 Ga0207658_10108530 3300025986 Bacteria 2189
284 Ga0207677_10016947 3300026023 Unclassified 4329
285 Ga0207677_10071266 3300026023 Bacteria 2452
286 Ga0207703_10000872 3300026035 Bacteria 29607
287 Ga0207703_10006599 3300026035 Bacteria 9258
288 Ga0207703_10024725 3300026035 Bacteria 4726
289 Ga0207703_10089069 3300026035 Bacteria 2591
290 Ga0207703_10177202 3300026035 Bacteria 1879
291 Ga0207703_10596203 3300026035 Bacteria 1045
292 Ga0207678_10017006 3300026067 Bacteria 6386
293 Ga0207708_10000362 3300026075 Bacteria 35576
294 Ga0207641_10002463 3300026088 Bacteria 17101
295 Ga0207641_10006980 3300026088 Bacteria 9448
296 Ga0207641_10106872 3300026088 Bacteria 2474
297 Ga0207641_10204247 3300026088 Bacteria 1824
298 Ga0207648_10000159 3300026089 Bacteria 69221
299 Ga0207648_10007626 3300026089 Bacteria 10608
300 Ga0207648_10190456 3300026089 Bacteria 1817
301 Ga0207648_10272965 3300026089 Bacteria 1511
302 Ga0207676_10001310 3300026095 Bacteria 18517
303 Ga0207676_10025400 3300026095 Unclassified 4395
304 Ga0207676_10063079 3300026095 Bacteria 2942
305 Ga0207676_10083824 3300026095 Bacteria 2597
306 Ga0207676_10332980 3300026095 Bacteria 1398
307 Ga0207674_10000881 3300026116 Bacteria 39300
308 Ga0207674_10025185 3300026116 Bacteria 6348
309 Ga0207674_10234622 3300026116 Bacteria 1782
310 Ga0207675_100000068 3300026118 Bacteria 78105
311 Ga0207683_10002541 3300026121 Bacteria 15925
312 Ga0207683_10027405 3300026121 Bacteria 4924
313 Ga0207683_10066992 3300026121 Bacteria 3167
314 Ga0207698_10137212 3300026142 Bacteria 2101
315 Ga0268266_10002088 3300028379 Bacteria 22109
316 Ga0268266_10002339 3300028379 Bacteria 20508
317 Ga0268265_10003541 3300028380 Bacteria 11174
318 Ga0268265_10004081 3300028380 Bacteria 10259
319 Ga0268265_10012680 3300028380 Bacteria 5719
320 Ga0268265_10030876 3300028380 Bacteria 3864
321 Ga0268265_10199571 3300028380 Bacteria 1734
322 Ga0268265_10216007 3300028380 Bacteria 1674
323 Ga0268265_10255859 3300028380 Unclassified 1554
324 Ga0268264_10001254 3300028381 Bacteria 24199
325 Ga0268264_10002566 3300028381 Bacteria 15920
326 Ga0268264_10004576 3300028381 Bacteria 11775
327 Ga0268264_10182161 3300028381 Bacteria 1908
328 Ga0268264_10267247 3300028381 Bacteria 1596
329 Ga0268264_10306118 3300028381 Bacteria 1498
330 Ga0268264_10470461 3300028381 Unclassified 1221
331 Ga0395899_0020963 3300037312 Bacteria 4957
332 Ga0395900_0015806 3300037418 Bacteria 7694
333 Ga0395905_0009056 3300037471 Bacteria 9764
334 Ga0395905_0094687 3300037471 Bacteria 2802
335 Ga0395905_0201728 3300037471 Bacteria 1865
336 Ga0436364_1125036 3300037853 Bacteria 39298
337 Ga0395901_0097037 3300038443 Bacteria 3089
338 Ga0436365_0495567 3300039437 Bacteria 1949
339 Ga0495663_0013699 3300046525 Bacteria 2268
340 Ga0495657_0098320 3300046675 Bacteria 1868
341 Ga0495669_0002034 3300046684 Bacteria 8290
342 Ga0495669_0012251 3300046684 Bacteria 3647
343 Ga0495669_0110188 3300046684 Bacteria 1285
344 Ga0495677_0021968 3300047445 Bacteria 2312
345 Ga0496100_0087495 3300048903 Bacteria 2118
346 Ga0496101_0097727 3300048904 Bacteria 2193
347 Ga0496103_0079551 3300048906 Unclassified 2060
348 Ga0496104_0027695 3300048907 Bacteria 5247
349 Ga0496106_0065742 3300048909 Bacteria 2761
350 Ga0496106_0367153 3300048909 Bacteria 1156
351 Ga0496107_0061976 3300048910 Bacteria 2709
352 Ga0496108_0278424 3300048911 Bacteria 1456
353 Ga0496108_0329231 3300048911 Bacteria 1332
354 Ga0496108_0513619 3300048911 Bacteria 1046
355 Ga0496109_0003560 3300048912 Bacteria 13005
356 Ga0496109_0251751 3300048912 Bacteria 1663
357 Ga0496110_0278042 3300048913 Bacteria 1524
358 Ga0496111_0022874 3300048914 Bacteria 4381
359 Ga0496111_0153431 3300048914 Bacteria 1709
360 Ga0496111_0174721 3300048914 Bacteria 1596
361 Ga0496112_0054517 3300048915 Bacteria 3928
362 Ga0496112_0063867 3300048915 Bacteria 3632
363 Ga0496112_0080371 3300048915 Bacteria 3224
364 Ga0496112_0301414 3300048915 Bacteria 1548
365 Ga0496112_0378600 3300048915 Bacteria 1356
366 Ga0496113_0040914 3300048916 Bacteria 3417
367 Ga0496113_0090478 3300048916 Unclassified 2357
368 Ga0496114_0016242 3300048917 Bacteria 5995
369 Ga0496115_0077104 3300048918 Bacteria 2710
370 Ga0496122_0031098 3300048925 Bacteria 4452
371 Ga0496122_0091896 3300048925 Bacteria 2065
372 Ga0501033_0032399 3300049570 Bacteria 3926
373 Ga0501034_0140828 3300049571 Bacteria 2392
374 Ga0501047_0218373 3300049581 Bacteria 1763
375 Ga0501070_0068769 3300049586 Bacteria 2932
376 Ga0501079_0270653 3300049741 Bacteria 1328
377 Ga0501081_0123789 3300049743 Bacteria 1844
378 Ga0501035_0027207 3300049822 Bacteria 5227
379 Ga0501044_0457919 3300049823 Bacteria 1181
380 nmdc:mga0a205_3647_c1 3300050515 Bacteria 13789
381 Ga0495655_0021612 3300053083 Bacteria 1459
382 Ga0495655_0027920 3300053083 Bacteria 1343
383 2828308537 2828305725 Bacteria 4916900
384 Ga0070662_100243047
385 JGI24736J21556_1006787
386 JGI24737J22298_10008905
387 Ga0065712_10174295
388 Ga0065715_10282325
389 Ga0070658_10380972
390 Ga0070658_10395108
391 Ga0070683_100024150
392 Ga0070690_100000906
393 Ga0070690_100009642
394 Ga0070690_100113494
395 Ga0070690_100180172
396 Ga0070670_100003051
397 Ga0070670_100038081
398 Ga0070670_100061767
399 Ga0070670_100063441
400 Ga0070670_100086110
401 Ga0070670_100514699
402 Ga0070670_100597629
403 Ga0068869_100005365
404 Ga0068869_100040847
405 Ga0070666_10001960
406 Ga0070666_10009066
407 Ga0070666_10053207
408 Ga0070666_10085115
409 Ga0070680_100063688
410 Ga0068868_100012977
411 Ga0068868_100020618
412 Ga0068868_100241299
413 Ga0070687_100053841
414 Ga0070687_100208991
415 Ga0070661_100053092
416 Ga0070661_100349583
417 Ga0070692_10004020
418 Ga0070692_10012145
419 Ga0070668_100052877
420 Ga0070668_100066124
421 Ga0070668_100079983
422 Ga0070669_100015518
423 Ga0070669_100043036
424 Ga0070669_100071984
425 Ga0070669_100125356
426 Ga0070675_100028757
427 Ga0070671_100008370
428 Ga0070671_100016112
429 Ga0070671_100534084
430 Ga0070673_100008718
431 Ga0070673_100040473
432 Ga0070673_100064692
433 Ga0070673_100078675
434 Ga0070659_100003703
435 Ga0070659_100031802
436 Ga0070667_100005169
437 Ga0070667_100011036
438 Ga0070667_100016380
439 Ga0070667_100021157
440 Ga0070667_100024510
441 Ga0070667_100079268
442 Ga0070667_100117555
443 Ga0070667_100161919
444 Ga0070667_100184819
445 Ga0070667_100274470
446 Ga0070701_10020176
447 Ga0070700_100002523
448 Ga0070694_100003942
449 Ga0070663_100014592
450 Ga0070678_100013999
451 Ga0070678_100045760
452 Ga0070678_100098228
453 Ga0070662_100002727
454 Ga0070662_100003588
455 Ga0070662_100027615
456 Ga0070662_100062810
457 Ga0070662_100421541
458 Ga0068867_100003220
459 Ga0068867_100073479
460 Ga0068867_100156188
461 Ga0070707_100392846
462 Ga0070684_100012260
463 Ga0070684_100381508
464 Ga0070672_100015913
465 Ga0070672_100080713
466 Ga0070686_100000683
467 Ga0070686_100103891
468 Ga0070696_100005042
469 Ga0070693_100030237
470 Ga0070665_100000132
471 Ga0070665_100021330
472 Ga0070665_100028082
473 Ga0070665_100184438
474 Ga0070704_100140942
475 Ga0068855_100047326
476 Ga0068855_100104812
477 Ga0068855_100188195
478 Ga0070664_100002315
479 Ga0070664_100002816
480 Ga0070664_100003997
481 Ga0070664_100016758
482 Ga0070664_100057156
483 Ga0068857_100013039
484 Ga0068857_100064988
485 Ga0068854_100122175
486 Ga0070702_100005588
487 Ga0068852_100138461
488 Ga0068859_100000689
489 Ga0068859_100030537
490 Ga0068859_100111486
491 Ga0068859_100119424
492 Ga0068859_100130256
493 Ga0068859_100150228
494 Ga0068859_100205609
495 Ga0068864_100001152
496 Ga0068864_100016766
497 Ga0068864_100042287
498 Ga0068864_100080240
499 Ga0068866_10000810
500 Ga0068861_100008809
501 Ga0068851_10010025
502 Ga0068863_100004516
503 Ga0068863_100004910
504 Ga0068863_100006956
505 Ga0068863_100009253
506 Ga0068863_100125610
507 Ga0068863_100232930
508 Ga0068858_100014168
509 Ga0068858_100031271
510 Ga0068858_100035016
511 Ga0068858_100080105
512 Ga0068858_100110348
513 Ga0068858_100121338
514 Ga0068860_100010288
515 Ga0068860_100018770
516 Ga0068860_100019591
517 Ga0068860_100020647
518 Ga0068860_100055653
519 Ga0068862_100007859
520 Ga0068862_100008525
521 Ga0068862_100013464
522 Ga0068862_100016074
523 Ga0068862_100035301
524 Ga0068862_100208598
525 Ga0097621_100001668
526 Ga0097621_100245481
527 Ga0068871_100095397
528 Ga0075433_10015055
529 Ga0068865_100002868
530 Ga0068865_100039955
531 Ga0068865_100145543
532 Ga0068865_100442082
533 Ga0097620_100000689
534 Ga0097620_100030539
535 Ga0097620_100111483
536 Ga0097620_100119427
537 Ga0097620_100130253
538 Ga0097620_100150233
539 Ga0097620_100205612
540 Ga0105250_10011428
541 Ga0105240_10030382
542 Ga0105240_10114679
543 Ga0105245_10002540
544 Ga0105245_10049384
545 Ga0105245_10331697
546 Ga0105247_10119521
547 Ga0105243_10002977
548 Ga0105243_10014246
549 Ga0105242_10024901
550 Ga0105242_10034772
551 Ga0105242_10181338
552 Ga0105248_10005351
553 Ga0105248_10005826
554 Ga0105248_10007623
555 Ga0105248_10021399
556 Ga0105248_10268888
557 Ga0105248_10443397
558 Ga0105238_10425505
559 Ga0105249_10001380
560 Ga0105249_10013203
561 Ga0105249_10021634
562 Ga0105249_10082199
563 Ga0105249_10160945
564 Ga0105246_10078048
565 Ga0105246_10415811
566 Ga0157373_10009695
567 Ga0157373_10032760
568 Ga0157373_10042838
569 Ga0157373_10073400
570 Ga0157371_10019191
571 Ga0157371_10047525
572 Ga0157369_10051955
573 Ga0171462_1028
574 Ga0157374_10004572
575 Ga0157378_10096695
576 Ga0163162_10046516
577 Ga0163162_10064748
578 Ga0163162_10069704
579 Ga0163162_10120808
580 Ga0163162_10218879
581 Ga0163162_10275259
582 Ga0157375_10001728
583 Ga0157375_10038959
584 Ga0157375_10210266
585 Ga0157375_10342232
586 Ga0157375_10600422
587 Ga0163163_10020424
588 Ga0163163_10064360
589 Ga0163163_10392312
590 Ga0157380_10145824
591 Ga0157379_10006841
592 Ga0157379_10026282
593 Ga0157379_10076867
594 Ga0157376_10009802
595 Ga0157376_10053733
596 Ga0213875_10000157
597 Ga0207710_10066826
598 Ga0207688_10046432
599 Ga0207680_10205465
600 Ga0207647_10005894
601 Ga0207645_10000896
602 Ga0207645_10026824
603 Ga0207705_10138522
604 Ga0207695_10228966
605 Ga0207660_10256885
606 Ga0207657_10025540
607 Ga0207657_10083353
608 Ga0207657_10135872
609 Ga0207649_10057951
610 Ga0207646_10346390
611 Ga0207681_10004506
612 Ga0207681_10019554
613 Ga0207681_10102758
614 Ga0207681_10164884
615 Ga0207694_10284965
616 Ga0207650_10001442
617 Ga0207650_10004391
618 Ga0207659_10075751
619 Ga0207687_10043340
620 Ga0207687_10059217
621 Ga0207644_10002809
622 Ga0207644_10024526
623 Ga0207644_10183667
624 Ga0207690_10007225
625 Ga0207706_10000511
626 Ga0207706_10006959
627 Ga0207706_10010750
628 Ga0207706_10057697
629 Ga0207706_10095279
630 Ga0207706_10119366
631 Ga0207706_10393175
632 Ga0207686_10005231
633 Ga0207686_10297408
634 Ga0207669_10023801
635 Ga0207704_10007486
636 Ga0207704_10342026
637 Ga0207691_10001489
638 Ga0207691_10005733
639 Ga0207691_10046594
640 Ga0207691_10049867
641 Ga0207691_10079351
642 Ga0207711_10000044
643 Ga0207711_10002214
644 Ga0207689_10000558
645 Ga0207689_10003382
646 Ga0207689_10016284
647 Ga0207679_10001973
648 Ga0207679_10034914
649 Ga0207679_10189510
650 Ga0207667_10011837
651 Ga0207667_10022500
652 Ga0207651_10006467
653 Ga0207651_10028744
654 Ga0207651_10038264
655 Ga0207651_10047537
656 Ga0207651_10065932
657 Ga0207712_10002871
658 Ga0207712_10320921
659 Ga0207668_10000070
660 Ga0207668_10053536
661 Ga0207668_10109767
662 Ga0207668_10117916
663 Ga0207658_10003675
664 Ga0207658_10008681
665 Ga0207658_10030715
666 Ga0207658_10108530
667 Ga0207677_10016947
668 Ga0207677_10071266
669 Ga0207703_10000872
670 Ga0207703_10006599
671 Ga0207703_10024725
672 Ga0207703_10089069
673 Ga0207703_10177202
674 Ga0207703_10596203
675 Ga0207678_10017006
676 Ga0207708_10000362
677 Ga0207641_10002463
678 Ga0207641_10006980
679 Ga0207641_10106872
680 Ga0207641_10204247
681 Ga0207648_10000159
682 Ga0207648_10007626
683 Ga0207648_10190456
684 Ga0207648_10272965
685 Ga0207676_10001310
686 Ga0207676_10025400
687 Ga0207676_10063079
688 Ga0207676_10083824
689 Ga0207676_10332980
690 Ga0207674_10000881
691 Ga0207674_10025185
692 Ga0207674_10234622
693 Ga0207675_100000068
694 Ga0207683_10002541
695 Ga0207683_10027405
696 Ga0207683_10066992
697 Ga0207698_10137212
698 Ga0268266_10002088
699 Ga0268266_10002339
700 Ga0268265_10003541
701 Ga0268265_10004081
702 Ga0268265_10012680
703 Ga0268265_10030876
704 Ga0268265_10199571
705 Ga0268265_10216007
706 Ga0268265_10255859
707 Ga0268264_10001254
708 Ga0268264_10002566
709 Ga0268264_10004576
710 Ga0268264_10182161
711 Ga0268264_10267247
712 Ga0268264_10306118
713 Ga0268264_10470461
714 Ga0395899_0020963
715 Ga0395900_0015806
716 Ga0395905_0009056
717 Ga0395905_0094687
718 Ga0395905_0201728
719 Ga0436364_1125036
720 Ga0395901_0097037
721 Ga0436365_0495567
722 Ga0495663_0013699
723 Ga0495657_0098320
724 Ga0495669_0002034
725 Ga0495669_0012251
726 Ga0495669_0110188
727 Ga0495677_0021968
728 Ga0496100_0087495
729 Ga0496101_0097727
730 Ga0496103_0079551
731 Ga0496104_0027695
732 Ga0496106_0065742
733 Ga0496106_0367153
734 Ga0496107_0061976
735 Ga0496108_0278424
736 Ga0496108_0329231
737 Ga0496108_0513619
738 Ga0496109_0003560
739 Ga0496109_0251751
740 Ga0496110_0278042
741 Ga0496111_0022874
742 Ga0496111_0153431
743 Ga0496111_0174721
744 Ga0496112_0054517
745 Ga0496112_0063867
746 Ga0496112_0080371
747 Ga0496112_0301414
748 Ga0496112_0378600
749 Ga0496113_0040914
750 Ga0496113_0090478
751 Ga0496114_0016242
752 Ga0496115_0077104
753 Ga0496122_0031098
754 Ga0496122_0091896
755 Ga0501033_0032399
756 Ga0501034_0140828
757 Ga0501047_0218373
758 Ga0501070_0068769
759 Ga0501079_0270653
760 Ga0501081_0123789
761 Ga0501035_0027207
762 Ga0501044_0457919
763 nmdc:mga0a205_3647_c1
764 Ga0495655_0021612
765 Ga0495655_0027920
766 2828308537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

8

289

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8955 1 293
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8947 3 293
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8925 1 293
1u1x-assembly1.cif.gz_B structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 0.8907 1 293
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8886 3 293
ID Description Score Start End Superfamily
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9707 5 106 3.10.310.10
1sdjA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9331 2 120 3.10.310.10
1qyaA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9 1 120 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8936 5 106 3.10.310.10
3ednB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8915 1 113 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A3D4BA42-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9932 5 82 GO:0005737
GO:0009058
GO:0016853
AF-A0A2V6YUI9-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9899 3 78 GO:0005737
GO:0009058
GO:0016853
AF-A0A536NHP5-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9872 1 91 GO:0005737
GO:0009058
GO:0016853
AF-A0A537C2G8-F1-model_v4 PhzF family phenazine biosynthesis protein 0.985 5 236 GO:0005737
GO:0009058
GO:0016853
AF-A0A534Q3P8-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9846 5 92 GO:0005737
GO:0009058
GO:0016853

Map