F429440

General Info

Members Datasets Scaffolds Average Seq Length
382 219 764 154

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0024272|Ga0500616_0024272_692_1222
Length 176
Sequence MVRNLIALCMLGGNADGVMTMEKTGMNNQESLLKLENFLCFAIYSTANAVTRAYQPRLAALGLTYPQYLVMVVLWEEENQTVKAIGDKLSLDSGTLTPLLKRLEAAGLITRRRDTVDERQVLIGLTADGRAMRAQAEAVPIAMGKAFGCTMDEAKSLRSELIAMRDNLVESIDEVK

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
79 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
80 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
83 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
84 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
87 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
88 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
89 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
90 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
91 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
92 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
164 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
165 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
168 2506520008 Serratia plymuthica AS12 Isolate Unclassified
169 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
170 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
171 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
172 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
173 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
174 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
175 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
176 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
177 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
178 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
179 2734482264 Dyella sp. AD052 Isolate Unclassified
180 2738543009 Luteibacter sp. OK325 Isolate Unclassified
181 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
182 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
183 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
184 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
185 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
186 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
187 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
188 2818991457 Xanthomonas translucens 569 Isolate Unclassified
189 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
190 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
191 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
192 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
193 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
194 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
195 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
196 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
197 2876601092 Pantoea endophytica 596 Isolate Unclassified
198 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
199 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
200 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
201 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
202 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
203 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
204 2919085039 Luteibacter sp. 1214 Isolate Unclassified
205 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
206 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
207 2919404418 Luteibacter sp. 3190 Isolate Unclassified
208 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
209 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
210 2937967321 Serratia sp. YC16 Isolate Unclassified
211 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
212 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
213 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
214 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
215 640753048 Serratia proteamaculans 568 Isolate Endosphere
216 8004592986 Serratia sp. S119 Isolate Unclassified
217 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
218 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
219 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.13
Metatranscriptomes 0
Isolates 13.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.52
Nodule 1.31
Rhizoplane 3.66
Rhizosphere 56.81
Stem 0
Stem Tuber 0.26
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0024272 3300053153 Bacteria 3372
2 SwRhRL2b_contig_1248189 2162886007 Bacteria 3079
3 SwRhRL2b_contig_614768 2162886007 Bacteria 1268
4 JGI24736J21556_1001809 3300001904 Bacteria 3831
5 JGI24738J21930_10000208 3300002075 Bacteria 15688
6 JGI25162J39368_1000007 3300002737 Bacteria 403947
7 JGI25163J39215_1000410 3300002771 Bacteria 13470
8 JGI25164J39214_1000010 3300002772 Bacteria 288863
9 JGI25164J39214_1000016 3300002772 Bacteria 202035
10 JGI25165J46597_1041433 3300003214 Bacteria 591
11 Ga0055538_1000006 3300003751 Bacteria 403947
12 Ga0055539_1000010 3300003752 Bacteria 403947
13 Ga0055533_1000013 3300003756 Bacteria 403947
14 Ga0055533_1010992 3300003756 Bacteria 1000
15 Ga0055525_1000015 3300003759 Bacteria 403947
16 Ga0055542_1006790 3300003762 Bacteria 2402
17 Ga0055541_1000007 3300003841 Bacteria 403947
18 Ga0058692_1000071 3300003856 Bacteria 79048
19 Ga0058692_1001743 3300003856 Bacteria 7741
20 Ga0058692_1006139 3300003856 Bacteria 3335
21 Ga0065703_1018785 3300005272 Bacteria 8196
22 Ga0065704_10000667 3300005289 Bacteria 21743
23 Ga0070670_100013954 3300005331 Bacteria 6890
24 Ga0070670_100440961 3300005331 Bacteria 1153
25 Ga0070661_100096127 3300005344 Bacteria 2198
26 Ga0068857_101429667 3300005577 Bacteria 673
27 Ga0068852_100000636 3300005616 Bacteria 22926
28 Ga0075365_10517490 3300006038 Bacteria 843
29 Ga0075364_10051764 3300006051 Bacteria 2682
30 Ga0075362_10376997 3300006177 Bacteria 713
31 Ga0075369_10028304 3300006186 Bacteria 2348
32 Ga0079104_1000214 3300006946 Bacteria 81097
33 Ga0079104_1010534 3300006946 Bacteria 3041
34 Ga0105251_10000223 3300009011 Bacteria 57260
35 Ga0105251_10000377 3300009011 Bacteria 43767
36 Ga0105251_10004105 3300009011 Bacteria 10183
37 Ga0105251_10011702 3300009011 Bacteria 5000
38 Ga0105244_10007872 3300009036 Bacteria 6721
39 Ga0105244_10013663 3300009036 Bacteria 4732
40 Ga0105244_10033567 3300009036 Bacteria 2704
41 Ga0105244_10043780 3300009036 Bacteria 2308
42 Ga0105244_10058184 3300009036 Bacteria 1951
43 Ga0105250_10000889 3300009092 Bacteria 17674
44 Ga0105250_10002903 3300009092 Bacteria 8373
45 Ga0105247_10000610 3300009101 Bacteria 28776
46 Ga0105243_10001627 3300009148 Bacteria 19547
47 Ga0105241_10000010 3300009174 Bacteria 253836
48 Ga0105237_10987643 3300009545 Bacteria 849
49 Ga0105238_10379467 3300009551 Bacteria 1405
50 Ga0105239_10114176 3300010375 Bacteria 2996
51 Ga0105239_10458620 3300010375 Bacteria 1446
52 Ga0105246_10020844 3300011119 Bacteria 4210
53 Ga0105246_10030191 3300011119 Bacteria 3577
54 Ga0157373_10020794 3300013100 Bacteria 4765
55 Ga0157373_10117728 3300013100 Bacteria 1867
56 Ga0157371_10000044 3300013102 Bacteria 194689
57 Ga0157371_10020349 3300013102 Bacteria 4883
58 Ga0157370_10000272 3300013104 Bacteria 65739
59 Ga0157370_10148043 3300013104 Bacteria 2186
60 Ga0157370_10258660 3300013104 Bacteria 1609
61 Ga0163162_10241183 3300013306 Bacteria 1938
62 Ga0157372_10073733 3300013307 Bacteria 3848
63 Ga0157372_10210698 3300013307 Bacteria 2252
64 Ga0157372_10210883 3300013307 Bacteria 2251
65 Ga0182008_10011500 3300014497 Bacteria 4704
66 Ga0182008_10064208 3300014497 Bacteria 1808
67 Ga0182006_1000034 3300015261 Bacteria 232484
68 Ga0182006_1000563 3300015261 Bacteria 27731
69 Ga0182006_1004966 3300015261 Bacteria 6422
70 Ga0182007_10005931 3300015262 Bacteria 5305
71 Ga0182007_10036049 3300015262 Bacteria 1665
72 Ga0182005_1000362 3300015265 Bacteria 25350
73 Ga0182005_1004355 3300015265 Bacteria 4598
74 Ga0182005_1015361 3300015265 Bacteria 2136
75 Ga0182005_1021444 3300015265 Bacteria 1772
76 Ga0163161_10000006 3300017792 Bacteria 302708
77 Ga0163161_10016741 3300017792 Bacteria 5123
78 Ga0163161_10036386 3300017792 Bacteria 3525
79 Ga0209760_100034 3300025207 Bacteria 135933
80 Ga0209784_100022 3300025224 Bacteria 403999
81 Ga0209566_100021 3300025225 Bacteria 403999
82 Ga0209674_100038 3300025226 Bacteria 403999
83 Ga0209674_104741 3300025226 Bacteria 2151
84 Ga0209563_100042 3300025230 Bacteria 403999
85 Ga0207427_100027 3300025231 Bacteria 403999
86 Ga0207427_118178 3300025231 Bacteria 645
87 Ga0209437_100049 3300025233 Bacteria 403999
88 Ga0209677_100025 3300025253 Bacteria 403999
89 Ga0209148_1001507 3300025254 Bacteria 11543
90 Ga0209129_1000835 3300025258 Bacteria 19351
91 Ga0209233_1002834 3300025261 Bacteria 6221
92 Ga0209050_1031870 3300025298 Bacteria 1633
93 Ga0209256_1017775 3300025299 Bacteria 2344
94 Ga0209257_1000790 3300025304 Bacteria 46332
95 Ga0209257_1027218 3300025304 Bacteria 1907
96 Ga0207656_10284238 3300025321 Bacteria 816
97 Ga0207696_1000046 3300025711 Bacteria 291327
98 Ga0207696_1000291 3300025711 Bacteria 58593
99 Ga0207696_1000952 3300025711 Bacteria 17674
100 Ga0207655_1000111 3300025728 Bacteria 170772
101 Ga0207655_1000468 3300025728 Bacteria 52445
102 Ga0207655_1009713 3300025728 Bacteria 5938
103 Ga0207655_1010888 3300025728 Bacteria 5469
104 Ga0207655_1014788 3300025728 Bacteria 4382
105 Ga0207655_1073468 3300025728 Bacteria 1261
106 Ga0207713_1000056 3300025735 Bacteria 217615
107 Ga0207713_1000075 3300025735 Bacteria 179242
108 Ga0207713_1000175 3300025735 Bacteria 92467
109 Ga0207713_1014077 3300025735 Bacteria 4176
110 Ga0207710_10000024 3300025900 Bacteria 319633
111 Ga0207647_10000415 3300025904 Bacteria 35115
112 Ga0207654_10000010 3300025911 Bacteria 304367
113 Ga0207650_10007772 3300025925 Bacteria 7309
114 Ga0207650_10301478 3300025925 Bacteria 1309
115 Ga0207709_10001254 3300025935 Bacteria 18219
116 Ga0207678_10053668 3300026067 Bacteria 3473
117 Ga0207674_11679889 3300026116 Bacteria 603
118 Ga0207698_10002859 3300026142 Bacteria 10325
119 Ga0209281_1000120 3300027111 Bacteria 206692
120 Ga0209281_1000139 3300027111 Bacteria 179588
121 Ga0209281_1003804 3300027111 Bacteria 4782
122 Ga0209371_1000068 3300027312 Bacteria 209008
123 Ga0209371_1000209 3300027312 Bacteria 81879
124 Ga0209371_1005924 3300027312 Bacteria 4693
125 Ga0209371_1006754 3300027312 Bacteria 4171
126 Ga0268256_1000064 3300030500 Bacteria 210320
127 Ga0268256_1000167 3300030500 Bacteria 81875
128 Ga0268256_1004940 3300030500 Bacteria 5381
129 Ga0268256_1024161 3300030500 Bacteria 1563
130 Ga0307412_10001032 3300031911 Bacteria 15910
131 Ga0439436_0000109 3300041404 Bacteria 19183
132 Ga0439438_067300 3300041405 Bacteria 890
133 Ga0439447_049577 3300041407 Bacteria 1005
134 Ga0439466_0012484 3300041411 Bacteria 3128
135 Ga0439465_0005089 3300041413 Bacteria 4218
136 Ga0451797_1251083 3300041453 Bacteria 623
137 Ga0451795_1325375 3300041456 Bacteria 1751
138 Ga0451806_350952 3300041462 Bacteria 1811
139 Ga0451807_0832304 3300041486 Bacteria 1033
140 Ga0439445_0099533 3300042004 Bacteria 824
141 Ga0439432_000104 3300042006 Bacteria 26816
142 Ga0439456_002153 3300042013 Bacteria 3963
143 Ga0450900_015349 3300042136 Bacteria 1029
144 Ga0450904_020376 3300042139 Bacteria 672
145 Ga0450908_000669 3300042184 Bacteria 6604
146 Ga0450893_0000327 3300042532 Bacteria 6642
147 Ga0495617_000487 3300046452 Bacteria 21009
148 Ga0495627_000096 3300046453 Bacteria 107809
149 Ga0495591_000031 3300046458 Bacteria 177747
150 Ga0495638_0079580 3300046460 Bacteria 1993
151 Ga0495650_0000039 3300046471 Bacteria 375501
152 Ga0495650_0001294 3300046471 Bacteria 25431
153 Ga0495650_0039230 3300046471 Bacteria 2045
154 Ga0495584_0004523 3300046491 Bacteria 7466
155 Ga0495585_0001164 3300046492 Bacteria 21400
156 Ga0495607_0000247 3300046501 Bacteria 57993
157 Ga0495607_0001296 3300046501 Bacteria 22305
158 Ga0495607_0028791 3300046501 Bacteria 3423
159 Ga0495583_0051206 3300046506 Bacteria 1883
160 Ga0495606_0002600 3300046507 Bacteria 20645
161 Ga0495606_0005815 3300046507 Bacteria 11634
162 Ga0495606_0015399 3300046507 Bacteria 5893
163 Ga0495606_0036246 3300046507 Bacteria 3361
164 Ga0495606_0072217 3300046507 Bacteria 2169
165 Ga0495616_0006200 3300046513 Bacteria 7271
166 Ga0495620_0006081 3300046515 Bacteria 6673
167 Ga0495620_0014456 3300046515 Bacteria 4011
168 Ga0495631_0000153 3300046518 Bacteria 47259
169 Ga0495631_0001341 3300046518 Bacteria 15064
170 Ga0495632_0000008 3300046519 Bacteria 294056
171 Ga0495632_0013215 3300046519 Bacteria 4720
172 Ga0495632_0018635 3300046519 Bacteria 3804
173 Ga0495632_0123848 3300046519 Bacteria 1206
174 Ga0495632_0465601 3300046519 Bacteria 547
175 Ga0495637_0025897 3300046520 Bacteria 2639
176 Ga0495648_0010067 3300046524 Bacteria 7244
177 Ga0495648_0096395 3300046524 Bacteria 1643
178 Ga0495654_0000040 3300046530 Bacteria 184580
179 Ga0495654_0000144 3300046530 Bacteria 74173
180 Ga0495654_0042764 3300046530 Bacteria 2247
181 Ga0495622_0288584 3300046557 Bacteria 716
182 Ga0495668_0008642 3300046616 Bacteria 6331
183 Ga0495668_0066267 3300046616 Bacteria 1987
184 Ga0495611_0000029 3300046648 Bacteria 115887
185 Ga0495611_0000076 3300046648 Bacteria 69480
186 Ga0495625_0000260 3300046660 Bacteria 82175
187 Ga0495625_0044988 3300046660 Bacteria 3193
188 Ga0495625_0761728 3300046660 Bacteria 566
189 Ga0495661_0001341 3300046665 Bacteria 20869
190 Ga0495661_0109443 3300046665 Bacteria 1542
191 Ga0495670_0004638 3300046691 Bacteria 6737
192 Ga0495670_0007820 3300046691 Bacteria 5257
193 Ga0495670_0008473 3300046691 Bacteria 5057
194 Ga0495671_0000881 3300046692 Bacteria 21419
195 Ga0495649_0016377 3300046694 Bacteria 4200
196 Ga0495589_0000050 3300046794 Bacteria 116034
197 Ga0495589_0000144 3300046794 Bacteria 65654
198 Ga0495660_0000023 3300046810 Bacteria 272605
199 Ga0495660_0001067 3300046810 Bacteria 19811
200 Ga0495660_0004897 3300046810 Bacteria 8065
201 Ga0495660_0159979 3300046810 Bacteria 1105
202 Ga0495672_0000132 3300047320 Bacteria 111537
203 Ga0495683_0003452 3300047323 Bacteria 9220
204 Ga0495679_000091 3300047446 Bacteria 82366
205 Ga0495673_0000175 3300047469 Bacteria 105273
206 Ga0495673_0000548 3300047469 Bacteria 38312
207 Ga0495673_0010908 3300047469 Bacteria 4917
208 Ga0495686_0011041 3300047472 Bacteria 6389
209 Ga0495686_0015513 3300047472 Bacteria 5196
210 Ga0495686_0015877 3300047472 Bacteria 5122
211 Ga0495686_0021276 3300047472 Bacteria 4310
212 Ga0495686_0149845 3300047472 Bacteria 1370
213 Ga0496100_0033091 3300048903 Bacteria 3232
214 Ga0496100_0739112 3300048903 Bacteria 769
215 Ga0496101_0000294 3300048904 Bacteria 34861
216 Ga0496101_0001399 3300048904 Bacteria 14442
217 Ga0496101_0100092 3300048904 Bacteria 2168
218 Ga0496104_0000208 3300048907 Bacteria 52252
219 Ga0496104_1560436 3300048907 Bacteria 563
220 Ga0496106_0016048 3300048909 Bacteria 5537
221 Ga0496116_0000058 3300048919 Bacteria 279767
222 Ga0496116_0000112 3300048919 Bacteria 181946
223 Ga0496116_0016420 3300048919 Bacteria 5793
224 Ga0496116_0079832 3300048919 Bacteria 2034
225 Ga0496116_0162687 3300048919 Bacteria 1222
226 Ga0496117_0003512 3300048920 Bacteria 18161
227 Ga0496117_0007526 3300048920 Bacteria 10617
228 Ga0496117_0019998 3300048920 Bacteria 5476
229 Ga0496117_0040733 3300048920 Bacteria 3412
230 Ga0496117_0047629 3300048920 Bacteria 3071
231 Ga0496117_0066456 3300048920 Bacteria 2446
232 Ga0496117_0096884 3300048920 Bacteria 1881
233 Ga0496118_0000454 3300048921 Bacteria 67788
234 Ga0496118_0001826 3300048921 Bacteria 30584
235 Ga0496118_0046457 3300048921 Bacteria 3377
236 Ga0496118_0053377 3300048921 Bacteria 3073
237 Ga0496118_0061925 3300048921 Bacteria 2766
238 Ga0496118_0077134 3300048921 Bacteria 2365
239 Ga0496118_0092480 3300048921 Bacteria 2075
240 Ga0496118_0118515 3300048921 Bacteria 1733
241 Ga0496118_0179444 3300048921 Bacteria 1281
242 Ga0496118_0226537 3300048921 Bacteria 1083
243 Ga0496118_0422274 3300048921 Bacteria 685
244 Ga0496119_0001206 3300048922 Bacteria 32260
245 Ga0496119_0004106 3300048922 Bacteria 14678
246 Ga0496119_0007737 3300048922 Bacteria 9599
247 Ga0496119_0009626 3300048922 Bacteria 8246
248 Ga0496119_0012594 3300048922 Bacteria 6849
249 Ga0496119_0027971 3300048922 Bacteria 3861
250 Ga0496119_0032248 3300048922 Bacteria 3495
251 Ga0496119_0041634 3300048922 Bacteria 2922
252 Ga0496119_0097222 3300048922 Bacteria 1660
253 Ga0496120_0000288 3300048923 Bacteria 84836
254 Ga0496120_0000308 3300048923 Bacteria 81512
255 Ga0496120_0000377 3300048923 Bacteria 72242
256 Ga0496120_0001249 3300048923 Bacteria 32021
257 Ga0496120_0001277 3300048923 Bacteria 31458
258 Ga0496120_0032098 3300048923 Bacteria 3170
259 Ga0496120_0138763 3300048923 Bacteria 1236
260 Ga0496121_0000290 3300048924 Bacteria 104280
261 Ga0496121_0015404 3300048924 Bacteria 8013
262 Ga0496121_0018825 3300048924 Bacteria 6934
263 Ga0496122_0000067 3300048925 Bacteria 231365
264 Ga0496122_0001071 3300048925 Bacteria 47543
265 Ga0496122_0010816 3300048925 Bacteria 9346
266 Ga0496122_0011329 3300048925 Bacteria 9049
267 Ga0496122_0014485 3300048925 Bacteria 7616
268 Ga0496122_0035981 3300048925 Bacteria 4015
269 Ga0496122_0167899 3300048925 Bacteria 1327
270 Ga0496123_0000056 3300048926 Bacteria 231365
271 Ga0496123_0000282 3300048926 Bacteria 99907
272 Ga0496123_0007734 3300048926 Bacteria 10032
273 Ga0496123_0010666 3300048926 Bacteria 8086
274 Ga0496123_0079899 3300048926 Bacteria 1996
275 Ga0496123_0109912 3300048926 Bacteria 1578
276 Ga0496123_0138403 3300048926 Bacteria 1336
277 Ga0496124_0000136 3300048927 Bacteria 151846
278 Ga0496124_0000187 3300048927 Bacteria 122984
279 Ga0496124_0000362 3300048927 Bacteria 82902
280 Ga0496124_0002828 3300048927 Bacteria 21966
281 Ga0496124_0015719 3300048927 Bacteria 7236
282 Ga0496124_0027678 3300048927 Bacteria 5082
283 Ga0496124_0028072 3300048927 Bacteria 5037
284 Ga0496124_0028081 3300048927 Bacteria 5036
285 Ga0496124_0057507 3300048927 Bacteria 3276
286 Ga0496124_0204730 3300048927 Bacteria 1497
287 Ga0496125_0000183 3300048928 Bacteria 137652
288 Ga0496125_0038266 3300048928 Bacteria 4156
289 Ga0496126_0006344 3300048929 Bacteria 13188
290 Ga0496126_0016462 3300048929 Bacteria 7392
291 Ga0496126_0191995 3300048929 Bacteria 1729
292 Ga0496126_0521247 3300048929 Bacteria 947
293 Ga0496126_0811108 3300048929 Bacteria 717
294 Ga0495678_000762 3300049459 Bacteria 29192
295 Ga0495678_229096 3300049459 Bacteria 560
296 Ga0495682_0003660 3300049460 Bacteria 6776
297 Ga0501031_0013172 3300049568 Bacteria 5398
298 Ga0501031_0388009 3300049568 Bacteria 903
299 Ga0501032_0044280 3300049569 Bacteria 3013
300 Ga0501033_0016008 3300049570 Bacteria 5680
301 Ga0501034_0037043 3300049571 Bacteria 4939
302 Ga0501034_0226783 3300049571 Bacteria 1819
303 Ga0501036_0206808 3300049572 Bacteria 1650
304 Ga0501036_0835011 3300049572 Bacteria 758
305 Ga0501037_0133813 3300049573 Bacteria 1776
306 Ga0501037_0233966 3300049573 Bacteria 1289
307 Ga0501038_0321906 3300049574 Bacteria 1209
308 Ga0501039_0235203 3300049575 Bacteria 1440
309 Ga0501043_0072190 3300049579 Bacteria 2711
310 Ga0501043_0203796 3300049579 Bacteria 1534
311 Ga0501047_0357488 3300049581 Bacteria 1296
312 Ga0501048_0490198 3300049582 Bacteria 881
313 Ga0501070_0444142 3300049586 Bacteria 1046
314 Ga0501073_0266111 3300049589 Bacteria 1183
315 Ga0501080_0209894 3300049742 Bacteria 1785
316 Ga0501035_0028123 3300049822 Bacteria 5134
317 Ga0501044_0046244 3300049823 Bacteria 4507
318 Ga0501044_0693885 3300049823 Bacteria 904
319 Ga0501044_0779470 3300049823 Bacteria 836
320 Ga0501045_0514387 3300049824 Bacteria 889
321 nmdc:mga00v17_73652_c1 3300050491 Bacteria 2121
322 nmdc:mga0yw44_702202_c1 3300050492 Bacteria 687
323 nmdc:mga0sz30_66558_c1 3300050516 Bacteria 1546
324 Ga0500643_000120 3300053087 Bacteria 81701
325 Ga0500643_093653 3300053087 Bacteria 818
326 Ga0500555_001389 3300053103 Bacteria 7473
327 Ga0500652_067947 3300053131 Bacteria 1474
328 Ga0500634_0081662 3300053161 Bacteria 1664
329 Ga0500645_005182 3300053730 Bacteria 4855
330 2506576098 2506520007 Bacteria 5442880
331 2506581236 2506520008 Bacteria 5443009
332 2508850065 2508501071 Bacteria 5454741
333 2511379771 2511231025 Bacteria 5324661
334 2511391858 2511231027 Bacteria 5013807
335 2511436243 2511231035 Bacteria 5341610
336 2595448035 2593339238 Bacteria 4182970
337 2595451331 2593339239 Bacteria 4124669
338 2656277503 2654587920 Bacteria 5475511
339 2689442528 2687453601 Bacteria 5546041
340 2707098439 2706794495 Bacteria 4536932
341 2721028647 2718218334 Bacteria 4765486
342 2735835761 2734482264 Unclassified 5014763
343 2739227033 2738543009 Bacteria 4944499
344 2765465746 2765235802 Bacteria 5618596
345 2770198297 2767802442 Bacteria 5747986
346 2772436673 2772190666 Bacteria 5117644
347 2776269543 2775506902 Bacteria 6208009
348 2776282474 2775506904 Bacteria 5954060
349 2807178542 2806310673 Bacteria 4801221
350 2819565868 2818991440 Bacteria 4774720
351 2819661716 2818991457 Bacteria 5323295
352 2839993389 2839993093 Bacteria 5512535
353 2840766393 2840764183 Bacteria 6358399
354 2842874010 2842871566 Bacteria 4827117
355 2842918204 2842914999 Bacteria 4419378
356 2842922208 2842918807 Bacteria 4289178
357 2852688359 2852684882 Bacteria 5463342
358 2854601861 2854601825 Bacteria 4797592
359 2869551940 2869551831 Bacteria 5474685
360 2876603466 2876601092 Bacteria 5114497
361 2884339539 2884338543 Bacteria 4610696
362 2888366719 2888366609 Bacteria 5155009
363 2894653740 2894652903 Bacteria 4587256
364 2904434655 2904434214 Bacteria 6230908
365 2904466139 2904463128 Bacteria 4775606
366 2904579962 2904578770 Bacteria 5302906
367 2919086823 2919085039 Bacteria 4532964
368 2919120366 2919119836 Bacteria 5208557
369 2919134236 2919130084 Bacteria 5301837
370 2919408081 2919404418 Bacteria 4232372
371 2928522743 2928521798 Bacteria 4960112
372 2929199722 2929195423 Bacteria 5325372
373 2937971539 2937967321 Bacteria 5094075
374 2953997326 2953994433 Bacteria 4303959
375 2954013890 2954011201 Bacteria 4762601
376 2978977342 2978975091 Bacteria 4704313
377 3002141724 3002141150 Bacteria 5254435
378 640935615 640753048 Bacteria 5495657
379 8004593456 8004592986 Bacteria 5122074
380 8015399748 8015394850 Bacteria 5064660
381 8016737810 8016733728 Bacteria 5274317
382 8019503632 8019499862 Bacteria 5169538
383 Ga0500616_0024272
384 SwRhRL2b_contig_1248189
385 SwRhRL2b_contig_614768
386 JGI24736J21556_1001809
387 JGI24738J21930_10000208
388 JGI25162J39368_1000007
389 JGI25163J39215_1000410
390 JGI25164J39214_1000010
391 JGI25164J39214_1000016
392 JGI25165J46597_1041433
393 Ga0055538_1000006
394 Ga0055539_1000010
395 Ga0055533_1000013
396 Ga0055533_1010992
397 Ga0055525_1000015
398 Ga0055542_1006790
399 Ga0055541_1000007
400 Ga0058692_1000071
401 Ga0058692_1001743
402 Ga0058692_1006139
403 Ga0065703_1018785
404 Ga0065704_10000667
405 Ga0070670_100013954
406 Ga0070670_100440961
407 Ga0070661_100096127
408 Ga0068857_101429667
409 Ga0068852_100000636
410 Ga0075365_10517490
411 Ga0075364_10051764
412 Ga0075362_10376997
413 Ga0075369_10028304
414 Ga0079104_1000214
415 Ga0079104_1010534
416 Ga0105251_10000223
417 Ga0105251_10000377
418 Ga0105251_10004105
419 Ga0105251_10011702
420 Ga0105244_10007872
421 Ga0105244_10013663
422 Ga0105244_10033567
423 Ga0105244_10043780
424 Ga0105244_10058184
425 Ga0105250_10000889
426 Ga0105250_10002903
427 Ga0105247_10000610
428 Ga0105243_10001627
429 Ga0105241_10000010
430 Ga0105237_10987643
431 Ga0105238_10379467
432 Ga0105239_10114176
433 Ga0105239_10458620
434 Ga0105246_10020844
435 Ga0105246_10030191
436 Ga0157373_10020794
437 Ga0157373_10117728
438 Ga0157371_10000044
439 Ga0157371_10020349
440 Ga0157370_10000272
441 Ga0157370_10148043
442 Ga0157370_10258660
443 Ga0163162_10241183
444 Ga0157372_10073733
445 Ga0157372_10210698
446 Ga0157372_10210883
447 Ga0182008_10011500
448 Ga0182008_10064208
449 Ga0182006_1000034
450 Ga0182006_1000563
451 Ga0182006_1004966
452 Ga0182007_10005931
453 Ga0182007_10036049
454 Ga0182005_1000362
455 Ga0182005_1004355
456 Ga0182005_1015361
457 Ga0182005_1021444
458 Ga0163161_10000006
459 Ga0163161_10016741
460 Ga0163161_10036386
461 Ga0209760_100034
462 Ga0209784_100022
463 Ga0209566_100021
464 Ga0209674_100038
465 Ga0209674_104741
466 Ga0209563_100042
467 Ga0207427_100027
468 Ga0207427_118178
469 Ga0209437_100049
470 Ga0209677_100025
471 Ga0209148_1001507
472 Ga0209129_1000835
473 Ga0209233_1002834
474 Ga0209050_1031870
475 Ga0209256_1017775
476 Ga0209257_1000790
477 Ga0209257_1027218
478 Ga0207656_10284238
479 Ga0207696_1000046
480 Ga0207696_1000291
481 Ga0207696_1000952
482 Ga0207655_1000111
483 Ga0207655_1000468
484 Ga0207655_1009713
485 Ga0207655_1010888
486 Ga0207655_1014788
487 Ga0207655_1073468
488 Ga0207713_1000056
489 Ga0207713_1000075
490 Ga0207713_1000175
491 Ga0207713_1014077
492 Ga0207710_10000024
493 Ga0207647_10000415
494 Ga0207654_10000010
495 Ga0207650_10007772
496 Ga0207650_10301478
497 Ga0207709_10001254
498 Ga0207678_10053668
499 Ga0207674_11679889
500 Ga0207698_10002859
501 Ga0209281_1000120
502 Ga0209281_1000139
503 Ga0209281_1003804
504 Ga0209371_1000068
505 Ga0209371_1000209
506 Ga0209371_1005924
507 Ga0209371_1006754
508 Ga0268256_1000064
509 Ga0268256_1000167
510 Ga0268256_1004940
511 Ga0268256_1024161
512 Ga0307412_10001032
513 Ga0439436_0000109
514 Ga0439438_067300
515 Ga0439447_049577
516 Ga0439466_0012484
517 Ga0439465_0005089
518 Ga0451797_1251083
519 Ga0451795_1325375
520 Ga0451806_350952
521 Ga0451807_0832304
522 Ga0439445_0099533
523 Ga0439432_000104
524 Ga0439456_002153
525 Ga0450900_015349
526 Ga0450904_020376
527 Ga0450908_000669
528 Ga0450893_0000327
529 Ga0495617_000487
530 Ga0495627_000096
531 Ga0495591_000031
532 Ga0495638_0079580
533 Ga0495650_0000039
534 Ga0495650_0001294
535 Ga0495650_0039230
536 Ga0495584_0004523
537 Ga0495585_0001164
538 Ga0495607_0000247
539 Ga0495607_0001296
540 Ga0495607_0028791
541 Ga0495583_0051206
542 Ga0495606_0002600
543 Ga0495606_0005815
544 Ga0495606_0015399
545 Ga0495606_0036246
546 Ga0495606_0072217
547 Ga0495616_0006200
548 Ga0495620_0006081
549 Ga0495620_0014456
550 Ga0495631_0000153
551 Ga0495631_0001341
552 Ga0495632_0000008
553 Ga0495632_0013215
554 Ga0495632_0018635
555 Ga0495632_0123848
556 Ga0495632_0465601
557 Ga0495637_0025897
558 Ga0495648_0010067
559 Ga0495648_0096395
560 Ga0495654_0000040
561 Ga0495654_0000144
562 Ga0495654_0042764
563 Ga0495622_0288584
564 Ga0495668_0008642
565 Ga0495668_0066267
566 Ga0495611_0000029
567 Ga0495611_0000076
568 Ga0495625_0000260
569 Ga0495625_0044988
570 Ga0495625_0761728
571 Ga0495661_0001341
572 Ga0495661_0109443
573 Ga0495670_0004638
574 Ga0495670_0007820
575 Ga0495670_0008473
576 Ga0495671_0000881
577 Ga0495649_0016377
578 Ga0495589_0000050
579 Ga0495589_0000144
580 Ga0495660_0000023
581 Ga0495660_0001067
582 Ga0495660_0004897
583 Ga0495660_0159979
584 Ga0495672_0000132
585 Ga0495683_0003452
586 Ga0495679_000091
587 Ga0495673_0000175
588 Ga0495673_0000548
589 Ga0495673_0010908
590 Ga0495686_0011041
591 Ga0495686_0015513
592 Ga0495686_0015877
593 Ga0495686_0021276
594 Ga0495686_0149845
595 Ga0496100_0033091
596 Ga0496100_0739112
597 Ga0496101_0000294
598 Ga0496101_0001399
599 Ga0496101_0100092
600 Ga0496104_0000208
601 Ga0496104_1560436
602 Ga0496106_0016048
603 Ga0496116_0000058
604 Ga0496116_0000112
605 Ga0496116_0016420
606 Ga0496116_0079832
607 Ga0496116_0162687
608 Ga0496117_0003512
609 Ga0496117_0007526
610 Ga0496117_0019998
611 Ga0496117_0040733
612 Ga0496117_0047629
613 Ga0496117_0066456
614 Ga0496117_0096884
615 Ga0496118_0000454
616 Ga0496118_0001826
617 Ga0496118_0046457
618 Ga0496118_0053377
619 Ga0496118_0061925
620 Ga0496118_0077134
621 Ga0496118_0092480
622 Ga0496118_0118515
623 Ga0496118_0179444
624 Ga0496118_0226537
625 Ga0496118_0422274
626 Ga0496119_0001206
627 Ga0496119_0004106
628 Ga0496119_0007737
629 Ga0496119_0009626
630 Ga0496119_0012594
631 Ga0496119_0027971
632 Ga0496119_0032248
633 Ga0496119_0041634
634 Ga0496119_0097222
635 Ga0496120_0000288
636 Ga0496120_0000308
637 Ga0496120_0000377
638 Ga0496120_0001249
639 Ga0496120_0001277
640 Ga0496120_0032098
641 Ga0496120_0138763
642 Ga0496121_0000290
643 Ga0496121_0015404
644 Ga0496121_0018825
645 Ga0496122_0000067
646 Ga0496122_0001071
647 Ga0496122_0010816
648 Ga0496122_0011329
649 Ga0496122_0014485
650 Ga0496122_0035981
651 Ga0496122_0167899
652 Ga0496123_0000056
653 Ga0496123_0000282
654 Ga0496123_0007734
655 Ga0496123_0010666
656 Ga0496123_0079899
657 Ga0496123_0109912
658 Ga0496123_0138403
659 Ga0496124_0000136
660 Ga0496124_0000187
661 Ga0496124_0000362
662 Ga0496124_0002828
663 Ga0496124_0015719
664 Ga0496124_0027678
665 Ga0496124_0028072
666 Ga0496124_0028081
667 Ga0496124_0057507
668 Ga0496124_0204730
669 Ga0496125_0000183
670 Ga0496125_0038266
671 Ga0496126_0006344
672 Ga0496126_0016462
673 Ga0496126_0191995
674 Ga0496126_0521247
675 Ga0496126_0811108
676 Ga0495678_000762
677 Ga0495678_229096
678 Ga0495682_0003660
679 Ga0501031_0013172
680 Ga0501031_0388009
681 Ga0501032_0044280
682 Ga0501033_0016008
683 Ga0501034_0037043
684 Ga0501034_0226783
685 Ga0501036_0206808
686 Ga0501036_0835011
687 Ga0501037_0133813
688 Ga0501037_0233966
689 Ga0501038_0321906
690 Ga0501039_0235203
691 Ga0501043_0072190
692 Ga0501043_0203796
693 Ga0501047_0357488
694 Ga0501048_0490198
695 Ga0501070_0444142
696 Ga0501073_0266111
697 Ga0501080_0209894
698 Ga0501035_0028123
699 Ga0501044_0046244
700 Ga0501044_0693885
701 Ga0501044_0779470
702 Ga0501045_0514387
703 nmdc:mga00v17_73652_c1
704 nmdc:mga0yw44_702202_c1
705 nmdc:mga0sz30_66558_c1
706 Ga0500643_000120
707 Ga0500643_093653
708 Ga0500555_001389
709 Ga0500652_067947
710 Ga0500634_0081662
711 Ga0500645_005182
712 2506576098
713 2506581236
714 2508850065
715 2511379771
716 2511391858
717 2511436243
718 2595448035
719 2595451331
720 2656277503
721 2689442528
722 2707098439
723 2721028647
724 2735835761
725 2739227033
726 2765465746
727 2770198297
728 2772436673
729 2776269543
730 2776282474
731 2807178542
732 2819565868
733 2819661716
734 2839993389
735 2840766393
736 2842874010
737 2842918204
738 2842922208
739 2852688359
740 2854601861
741 2869551940
742 2876603466
743 2884339539
744 2888366719
745 2894653740
746 2904434655
747 2904466139
748 2904579962
749 2919086823
750 2919120366
751 2919134236
752 2919408081
753 2928522743
754 2929199722
755 2937971539
756 2953997326
757 2954013890
758 2978977342
759 3002141724
760 640935615
761 8004593456
762 8015399748
763 8016737810
764 8019503632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

63

121

0.99

PF12802

MarR_2

MarR family

61

120

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

63

129

0.97

PF22381

Staph_reg_Sar_Rot

Transcriptional regulator SarA/Rot

52

135

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pex-assembly1.cif.gz_A structure of reduced c22s ohrr from xanthamonas campestris 0.9402 12 150
1z9c-assembly2.cif.gz_C crystal structure of ohrr bound to the ohra promoter: structure of marr family protein with operator dna 0.9353 17 150
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9257 49 108
2wte-assembly1.cif.gz_B the structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution. 0.9219 52 121
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9163 52 117
ID Description Score Start End Superfamily
2pexB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9466 11 150 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9407 45 106 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9378 49 107 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9354 49 108 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9348 45 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A377N689-F1-model_v4 Organic hydroperoxide resistance transcriptional regulator 0.995 22 154 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-A0A7W4I905-F1-model_v4 MarR family transcriptional regulator 0.9922 22 151 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-A0A7U4L6Y2-F1-model_v4 deleted 0.9908 22 153
AF-A0A411Z2Q8-F1-model_v4 MarR family transcriptional regulator 0.9902 22 151 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-A0A380PVI3-F1-model_v4 Homoprotocatechuate degradative operon repressor 0.9891 22 154 GO:0003677
GO:0003700
GO:0005737
GO:0006950

Map