F429265

General Info

Members Datasets Scaffolds Average Seq Length
382 237 335 270

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10003826|Ga0157370_100038266
Length 315
Sequence VERHAGPPRRDSGSRLGAGAGRSLIDLISLSSSFSTHKDNSTMTTNNANTIPAFGLGTFRLQGQVVIDSVKNGLDVGYRVIDTAQIYGNEAEVGQAIAESGVARNDLFITTKIWTDNYAKAKLVPSLKDSLAKLRTDYVDLTLIHWPSPGNTVSVAEFMGALAEAKALGLTKRIGVSNFNIALMKEAIAAVGAENIATNQVELHPYLQNRKVAEFAKSQGIHITSYMTLAYGKVIADPVIEAIAKAHNATTAQVTLAWAMQLGYAVIPSSTKRANLEGNLKAQQLKLTDAEMAQIAALDRNERLTDPAGLSPAWD

Samples

Sample ID Description Type Environment
1 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
10 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
11 2643221556 Massilia sp. Root1485 Isolate Unclassified
12 2643221593 Lysobacter sp. Root690 Isolate Unclassified
13 2643221658 Variovorax sp. Root411 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221684 Massilia sp. Root133 Isolate Unclassified
17 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
18 2738541297 Duganella sp. GV083 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738541357 Duganella sp. GV053 Isolate Unclassified
21 2738543003 Duganella sp. GV066 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543026 Duganella sp. GV089 Isolate Unclassified
24 2738543029 Duganella sp. GV039 Isolate Unclassified
25 2818991441 Niallia circulans 3243 Isolate Rhizosphere
26 2818991446 Variovorax sp. 1180 Isolate Unclassified
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2842677519 Variovorax sp. R-72495 Isolate Unclassified
29 2857564685 Duganella sp. R-74599 Isolate Unclassified
30 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
31 2885198086 Variovorax sp. 679 Isolate Unclassified
32 2885211737 Variovorax sp. 553 Isolate Unclassified
33 2899924645 Variovorax sp. 369 Isolate Unclassified
34 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
35 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
36 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
43 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
44 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
45 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
46 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
47 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
48 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
49 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
52 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
140 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
141 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
142 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
143 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
155 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
225 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
229 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
230 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
234 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
235 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 0
Isolates 12.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.94
Nodule 0.26
Rhizoplane 2.36
Rhizosphere 48.95
Stem 0
Stem Tuber 0
Unclassified 16.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011997 3300001979 Bacteria 3279
2 JGI24739J22299_10079591 3300001989 Bacteria 1008
3 JGI25152J39213_1006909 3300002773 Bacteria 3001
4 JGI25152J39213_1010078 3300002773 Bacteria 2188
5 JGI25150J39212_1001279 3300002774 Bacteria 7194
6 JGI25150J39212_1001363 3300002774 Bacteria 6934
7 JGI25159J45721_1001762 3300002987 Bacteria 8702
8 JGI25151J46595_10000324 3300003187 Bacteria 51796
9 JGI25151J46595_10001164 3300003187 Bacteria 18973
10 JGI25151J46595_10035670 3300003187 Bacteria 1886
11 JGI25153J46596_10029434 3300003215 Bacteria 1886
12 JGI25160J50197_1002414 3300003354 Bacteria 8713
13 JGI25161J50226_1001167 3300003374 Bacteria 8713
14 JGI25161J50226_1001715 3300003374 Bacteria 6234
15 Ga0055535_1000108 3300003761 Bacteria 89707
16 Ga0055542_1000051 3300003762 Bacteria 175242
17 Ga0055526_1000052 3300003771 Bacteria 116035
18 Ga0055526_1004231 3300003771 Bacteria 8713
19 Ga0055526_1004926 3300003771 Bacteria 7849
20 Ga0055537_1001568 3300003773 Bacteria 8713
21 Ga0055537_1015488 3300003773 Bacteria 1333
22 Ga0055537_1015607 3300003773 Bacteria 1324
23 Ga0055524_1002826 3300003775 Bacteria 8713
24 Ga0055524_1018080 3300003775 Bacteria 2461
25 Ga0055536_1004226 3300003781 Bacteria 7416
26 Ga0055536_1004235 3300003781 Bacteria 7405
27 Ga0055536_1008124 3300003781 Bacteria 4572
28 Ga0055534_1002084 3300003784 Bacteria 7208
29 Ga0055534_1003214 3300003784 Bacteria 5251
30 Ga0055534_1016513 3300003784 Bacteria 1324
31 Ga0055528_1003003 3300003790 Bacteria 8713
32 Ga0055528_1032434 3300003790 Bacteria 1333
33 Ga0055528_1032621 3300003790 Bacteria 1324
34 Ga0055530_10016430 3300003791 Bacteria 2364
35 Ga0055530_10058226 3300003791 Bacteria 870
36 Ga0055540_1002243 3300003792 Bacteria 10445
37 Ga0055540_1003134 3300003792 Bacteria 8189
38 Ga0055531_10000506 3300003794 Bacteria 35446
39 Ga0055531_10024330 3300003794 Bacteria 2238
40 Ga0055543_1001589 3300004625 Bacteria 8751
41 Ga0065165_1004420 3300005262 Bacteria 8751
42 Ga0065165_1036022 3300005262 Bacteria 1513
43 Ga0065165_1042691 3300005262 Bacteria 1336
44 Ga0065714_10077000 3300005288 Bacteria 2732
45 Ga0070666_10184780 3300005335 Bacteria 1463
46 Ga0070680_100093306 3300005336 Bacteria 2494
47 Ga0070660_100043420 3300005339 Bacteria 3436
48 Ga0070660_100330811 3300005339 Bacteria 1253
49 Ga0070667_100062302 3300005367 Bacteria 3159
50 Ga0070678_100410753 3300005456 Bacteria 1178
51 Ga0070662_100017603 3300005457 Bacteria 4821
52 Ga0068853_100056550 3300005539 Bacteria 3384
53 Ga0068855_100219029 3300005563 Bacteria 2135
54 Ga0070664_100007670 3300005564 Bacteria 8714
55 Ga0068857_100334238 3300005577 Bacteria 1401
56 Ga0068860_100244400 3300005843 Bacteria 1746
57 Ga0075364_10118251 3300006051 Bacteria 1773
58 Ga0075364_10263531 3300006051 Bacteria 1172
59 Ga0075370_10001484 3300006353 Bacteria 10221
60 Ga0105251_10003726 3300009011 Bacteria 10912
61 Ga0105244_10005378 3300009036 Bacteria 8524
62 Ga0105244_10027904 3300009036 Bacteria 3036
63 Ga0105244_10148511 3300009036 Bacteria 1124
64 Ga0105243_10036676 3300009148 Bacteria 3807
65 Ga0105243_10180298 3300009148 Bacteria 1836
66 Ga0105242_10173078 3300009176 Bacteria 1899
67 Ga0105237_10632694 3300009545 Bacteria 1077
68 Ga0105238_10019143 3300009551 Bacteria 6976
69 Ga0105239_10248570 3300010375 Bacteria 1997
70 Ga0157373_10034174 3300013100 Bacteria 3652
71 Ga0157373_10219405 3300013100 Bacteria 1341
72 Ga0157371_10000158 3300013102 Bacteria 99529
73 Ga0157370_10003826 3300013104 Bacteria 17548
74 Ga0157370_10008069 3300013104 Bacteria 11397
75 Ga0163162_10213565 3300013306 Bacteria 2059
76 Ga0163162_10500353 3300013306 Bacteria 1346
77 Ga0157372_10138429 3300013307 Bacteria 2804
78 Ga0157372_10233036 3300013307 Bacteria 2135
79 Ga0182008_10000063 3300014497 Bacteria 89315
80 Ga0182008_10031760 3300014497 Bacteria 2656
81 Ga0182008_10042928 3300014497 Bacteria 2252
82 Ga0182007_10000019 3300015262 Bacteria 194770
83 Ga0182007_10002877 3300015262 Bacteria 8373
84 Ga0182005_1000088 3300015265 Bacteria 69427
85 Ga0183360_10004 3300015689 Bacteria 289992
86 Ga0163161_10000409 3300017792 Bacteria 36015
87 Ga0163161_10001836 3300017792 Bacteria 15508
88 Ga0209436_101415 3300025208 Bacteria 8428
89 Ga0209436_102196 3300025208 Bacteria 6078
90 Ga0209672_100305 3300025228 Bacteria 33130
91 Ga0209147_100738 3300025229 Bacteria 16190
92 Ga0209563_100007 3300025230 Bacteria 1579402
93 Ga0209258_100132 3300025242 Bacteria 175292
94 Ga0207425_1000719 3300025245 Bacteria 17769
95 Ga0207425_1000872 3300025245 Bacteria 14751
96 Ga0209148_1000007 3300025254 Bacteria 1592273
97 Ga0209759_1004485 3300025256 Bacteria 5195
98 Ga0209129_1000084 3300025258 Bacteria 182554
99 Ga0209129_1001133 3300025258 Bacteria 15435
100 Ga0209129_1002047 3300025258 Bacteria 10411
101 Ga0209565_1000499 3300025263 Bacteria 28588
102 Ga0209565_1002618 3300025263 Bacteria 6358
103 Ga0209565_1003482 3300025263 Bacteria 5070
104 Ga0209565_1003813 3300025263 Bacteria 4758
105 Ga0209673_1000753 3300025273 Bacteria 44125
106 Ga0209673_1001028 3300025273 Bacteria 33067
107 Ga0209673_1001819 3300025273 Bacteria 17493
108 Ga0209130_1000362 3300025284 Bacteria 51625
109 Ga0209130_1000385 3300025284 Bacteria 49275
110 Ga0209675_1000701 3300025291 Bacteria 23100
111 Ga0209675_1001529 3300025291 Bacteria 13205
112 Ga0209675_1017963 3300025291 Bacteria 1996
113 Ga0209675_1021867 3300025291 Bacteria 1695
114 Ga0209676_1000542 3300025292 Bacteria 58278
115 Ga0209676_1000748 3300025292 Bacteria 44052
116 Ga0209676_1001700 3300025292 Bacteria 19042
117 Ga0209676_1007569 3300025292 Bacteria 5057
118 Ga0209025_1000021 3300025294 Bacteria 593083
119 Ga0209025_1000942 3300025294 Bacteria 44278
120 Ga0209025_1001442 3300025294 Bacteria 31264
121 Ga0209025_1009399 3300025294 Bacteria 6817
122 Ga0209025_1020095 3300025294 Bacteria 3671
123 Ga0209025_1023324 3300025294 Bacteria 3237
124 Ga0209564_1000026 3300025295 Bacteria 519154
125 Ga0209564_1000414 3300025295 Bacteria 75224
126 Ga0209564_1000613 3300025295 Bacteria 55031
127 Ga0209564_1020754 3300025295 Bacteria 2393
128 Ga0209758_1000184 3300025297 Bacteria 140021
129 Ga0209758_1023869 3300025297 Bacteria 2748
130 Ga0209050_1000836 3300025298 Bacteria 42507
131 Ga0209050_1027488 3300025298 Bacteria 1874
132 Ga0209050_1027569 3300025298 Bacteria 1869
133 Ga0209256_1000156 3300025299 Bacteria 144277
134 Ga0209256_1000239 3300025299 Bacteria 97580
135 Ga0207426_1000049 3300025302 Bacteria 401954
136 Ga0207426_1000086 3300025302 Bacteria 292089
137 Ga0207426_1050532 3300025302 Bacteria 1239
138 Ga0209051_1000349 3300025303 Bacteria 68709
139 Ga0209051_1009746 3300025303 Bacteria 4922
140 Ga0209257_1000411 3300025304 Bacteria 83024
141 Ga0209257_1000719 3300025304 Bacteria 50884
142 Ga0209257_1002613 3300025304 Bacteria 17420
143 Ga0207655_1055337 3300025728 Bacteria 1571
144 Ga0207655_1067840 3300025728 Bacteria 1341
145 Ga0207655_1070644 3300025728 Bacteria 1299
146 Ga0207713_1011043 3300025735 Bacteria 4947
147 Ga0207680_10357764 3300025903 Bacteria 1026
148 Ga0207695_10028597 3300025913 Bacteria 6175
149 Ga0207660_10083548 3300025917 Bacteria 2352
150 Ga0207690_10207871 3300025932 Bacteria 1491
151 Ga0207706_10004266 3300025933 Bacteria 13451
152 Ga0207709_10000351 3300025935 Bacteria 47249
153 Ga0207709_10001488 3300025935 Bacteria 16178
154 Ga0207709_10103915 3300025935 Bacteria 1884
155 Ga0207689_10205588 3300025942 Bacteria 1626
156 Ga0207679_10013094 3300025945 Bacteria 5430
157 Ga0207667_10060311 3300025949 Bacteria 3971
158 Ga0207667_10387268 3300025949 Bacteria 1424
159 Ga0207678_10403424 3300026067 Bacteria 1184
160 Ga0207674_10130004 3300026116 Bacteria 2482
161 Ga0207674_10187143 3300026116 Bacteria 2021
162 Ga0207683_10168806 3300026121 Bacteria 1981
163 Ga0207683_10203815 3300026121 Bacteria 1799
164 Ga0268266_10728695 3300028379 Bacteria 956
165 Ga0307515_10087173 3300028794 Bacteria 3967
166 Ga0316177_1114200 3300030731 Bacteria 2074
167 Ga0314311_1045908 3300030733 Bacteria 1940
168 Ga0316178_1102817 3300030735 Bacteria 2114
169 Ga0316180_1178586 3300030736 Bacteria 1258
170 Ga0316183_1017432 3300030742 Bacteria 13923
171 Ga0307509_10015769 3300031507 Bacteria 8790
172 Ga0307408_100062382 3300031548 Bacteria 2723
173 Ga0265314_10050252 3300031711 Bacteria 2914
174 Ga0307405_10034244 3300031731 Bacteria 3020
175 Ga0307405_10623271 3300031731 Bacteria 883
176 Ga0307412_10034834 3300031911 Bacteria 3211
177 Ga0307409_100108890 3300031995 Bacteria 2318
178 Ga0307411_10010441 3300032005 Bacteria 4951
179 Ga0395899_0002089 3300037312 Bacteria 16385
180 Ga0395900_0034162 3300037418 Bacteria 5235
181 Ga0395905_0155671 3300037471 Bacteria 2149
182 Ga0439447_007340 3300041407 Bacteria 3510
183 Ga0439463_000482 3300042016 Bacteria 11114
184 Ga0439463_001749 3300042016 Bacteria 5650
185 Ga0466958_0018825 3300045836 Bacteria 4012
186 Ga0495617_000061 3300046452 Bacteria 96850
187 Ga0495627_002823 3300046453 Bacteria 8047
188 Ga0495591_000128 3300046458 Bacteria 82830
189 Ga0495591_003754 3300046458 Bacteria 7676
190 Ga0495638_0001147 3300046460 Bacteria 25579
191 Ga0495638_0037483 3300046460 Bacteria 3084
192 Ga0495650_0000472 3300046471 Bacteria 62014
193 Ga0495650_0011461 3300046471 Bacteria 4853
194 Ga0495650_0040920 3300046471 Bacteria 1985
195 Ga0495605_0000254 3300046474 Bacteria 63277
196 Ga0495584_0000006 3300046491 Bacteria 301775
197 Ga0495584_0074614 3300046491 Bacteria 1705
198 Ga0495585_0003240 3300046492 Bacteria 11096
199 Ga0495596_0001281 3300046500 Bacteria 14537
200 Ga0495607_0000004 3300046501 Bacteria 317271
201 Ga0495607_0000186 3300046501 Bacteria 66578
202 Ga0495607_0000223 3300046501 Bacteria 60292
203 Ga0495607_0016762 3300046501 Bacteria 4724
204 Ga0495607_0045132 3300046501 Bacteria 2594
205 Ga0495583_0001004 3300046506 Bacteria 32303
206 Ga0495583_0001562 3300046506 Bacteria 22647
207 Ga0495583_0139334 3300046506 Bacteria 1011
208 Ga0495606_0000328 3300046507 Bacteria 81999
209 Ga0495606_0004103 3300046507 Bacteria 14792
210 Ga0495606_0018421 3300046507 Bacteria 5235
211 Ga0495606_0128016 3300046507 Bacteria 1512
212 Ga0495606_0258965 3300046507 Bacteria 961
213 Ga0495610_0000021 3300046512 Bacteria 336300
214 Ga0495610_0004116 3300046512 Bacteria 10882
215 Ga0495610_0017910 3300046512 Bacteria 4020
216 Ga0495616_0000097 3300046513 Bacteria 74443
217 Ga0495616_0003028 3300046513 Bacteria 10897
218 Ga0495620_0055936 3300046515 Bacteria 1661
219 Ga0495620_0128503 3300046515 Bacteria 995
220 Ga0495631_0000404 3300046518 Bacteria 29812
221 Ga0495637_0009486 3300046520 Bacteria 4743
222 Ga0495637_0018700 3300046520 Bacteria 3210
223 Ga0495637_0024603 3300046520 Bacteria 2724
224 Ga0495637_0032237 3300046520 Bacteria 2310
225 Ga0495637_0038299 3300046520 Bacteria 2077
226 Ga0495643_0000498 3300046522 Bacteria 49557
227 Ga0495643_0014072 3300046522 Bacteria 4770
228 Ga0495648_0002704 3300046524 Bacteria 16023
229 Ga0495648_0005785 3300046524 Bacteria 10198
230 Ga0495663_0001896 3300046525 Bacteria 6436
231 Ga0495663_0014713 3300046525 Bacteria 2196
232 Ga0495654_0012401 3300046530 Bacteria 4580
233 Ga0495587_0213631 3300046536 Bacteria 1089
234 Ga0495609_0005596 3300046538 Bacteria 6553
235 Ga0495622_0068753 3300046557 Bacteria 1636
236 Ga0495668_0000619 3300046616 Bacteria 42997
237 Ga0495668_0002319 3300046616 Bacteria 15918
238 Ga0495668_0002378 3300046616 Bacteria 15614
239 Ga0495668_0016349 3300046616 Bacteria 4312
240 Ga0495611_0193020 3300046648 Bacteria 950
241 Ga0495625_0021679 3300046660 Bacteria 4942
242 Ga0495625_0234407 3300046660 Bacteria 1198
243 Ga0495625_0244632 3300046660 Bacteria 1166
244 Ga0495661_0016581 3300046665 Bacteria 4879
245 Ga0495661_0018886 3300046665 Bacteria 4525
246 Ga0495661_0025997 3300046665 Bacteria 3773
247 Ga0495661_0206215 3300046665 Bacteria 1026
248 Ga0495588_0000077 3300046674 Bacteria 215338
249 Ga0495670_0001513 3300046691 Bacteria 11342
250 Ga0495671_0000024 3300046692 Bacteria 246812
251 Ga0495671_0013308 3300046692 Bacteria 4459
252 Ga0495671_0054735 3300046692 Bacteria 1977
253 Ga0495660_0001829 3300046810 Bacteria 13969
254 Ga0495660_0002049 3300046810 Bacteria 13106
255 Ga0495676_0062280 3300047321 Bacteria 2913
256 Ga0495676_0213337 3300047321 Bacteria 1334
257 Ga0495683_0028656 3300047323 Bacteria 2846
258 Ga0495683_0044414 3300047323 Bacteria 2235
259 Ga0495679_002281 3300047446 Bacteria 9897
260 Ga0495679_015386 3300047446 Bacteria 2799
261 Ga0495673_0000120 3300047469 Bacteria 144972
262 Ga0495673_0004158 3300047469 Bacteria 9152
263 Ga0495673_0011315 3300047469 Bacteria 4807
264 Ga0495686_0244175 3300047472 Bacteria 1011
265 Ga0495593_0046231 3300047673 Bacteria 2320
266 Ga0495614_0024480 3300048089 Bacteria 2606
267 Ga0495626_0000574 3300048091 Bacteria 36427
268 Ga0496102_0281779 3300048905 Bacteria 1567
269 Ga0496103_0315330 3300048906 Bacteria 1006
270 Ga0496104_0232270 3300048907 Bacteria 1756
271 Ga0496116_0047039 3300048919 Bacteria 2907
272 Ga0496116_0082400 3300048919 Bacteria 1990
273 Ga0496117_0002092 3300048920 Bacteria 26276
274 Ga0496117_0011289 3300048920 Bacteria 8010
275 Ga0496117_0197048 3300048920 Bacteria 1141
276 Ga0496118_0000108 3300048921 Bacteria 153902
277 Ga0496118_0017280 3300048921 Bacteria 6578
278 Ga0496118_0048075 3300048921 Bacteria 3300
279 Ga0496118_0136353 3300048921 Bacteria 1565
280 Ga0496119_0000587 3300048922 Bacteria 49190
281 Ga0496120_0001074 3300048923 Bacteria 36034
282 Ga0496121_0005005 3300048924 Bacteria 17346
283 Ga0496121_0012841 3300048924 Bacteria 9064
284 Ga0496121_0070040 3300048924 Bacteria 2827
285 Ga0496121_0164533 3300048924 Bacteria 1618
286 Ga0496122_0009107 3300048925 Bacteria 10524
287 Ga0496122_0015440 3300048925 Bacteria 7301
288 Ga0496122_0069978 3300048925 Bacteria 2510
289 Ga0496122_0076806 3300048925 Bacteria 2348
290 Ga0496122_0195788 3300048925 Bacteria 1187
291 Ga0496123_0005058 3300048926 Bacteria 13473
292 Ga0496123_0005518 3300048926 Bacteria 12698
293 Ga0496123_0014041 3300048926 Bacteria 6666
294 Ga0496124_0000586 3300048927 Bacteria 61341
295 Ga0496124_0004904 3300048927 Bacteria 15378
296 Ga0496124_0005734 3300048927 Bacteria 13827
297 Ga0496124_0028527 3300048927 Bacteria 4991
298 Ga0496124_0053097 3300048927 Bacteria 3438
299 Ga0496124_0128271 3300048927 Bacteria 2019
300 Ga0496124_0200228 3300048927 Bacteria 1519
301 Ga0496125_0003002 3300048928 Bacteria 21117
302 Ga0496125_0137646 3300048928 Bacteria 1704
303 Ga0496126_0001975 3300048929 Bacteria 29049
304 Ga0495678_008568 3300049459 Bacteria 5144
305 Ga0495682_0000027 3300049460 Bacteria 143927
306 Ga0495682_0000386 3300049460 Bacteria 31914
307 Ga0501067_0001716 3300049583 Bacteria 12039
308 Ga0501249_012317 3300049679 Bacteria 1806
309 Ga0501225_0013060 3300049705 Bacteria 2327
310 Ga0501083_0001367 3300049744 Bacteria 16542
311 Ga0501262_000026 3300049759 Bacteria 20810
312 nmdc:mga00v17_115563_c1 3300050491 Bacteria 1705
313 nmdc:mga00v17_42758_c2 3300050491 Bacteria 1739
314 nmdc:mga0yw44_10846_c1 3300050492 Bacteria 4671
315 nmdc:mga07m45_5667_c1 3300050496 Bacteria 6243
316 Ga0500610_0000663 3300053079 Bacteria 10605
317 Ga0500610_0010714 3300053079 Bacteria 4138
318 Ga0500610_0035811 3300053079 Bacteria 2548
319 Ga0500643_003991 3300053087 Bacteria 6824
320 Ga0500651_0069721 3300053093 Bacteria 2188
321 Ga0500562_017323 3300053108 Bacteria 1857
322 Ga0500571_000034 3300053110 Bacteria 44157
323 Ga0500593_000364 3300053117 Bacteria 18228
324 Ga0500594_0094378 3300053118 Bacteria 912
325 Ga0500607_001372 3300053121 Bacteria 22112
326 Ga0500608_027640 3300053122 Bacteria 2674
327 Ga0500626_117142 3300053128 Bacteria 1144
328 Ga0500658_0000434 3300053134 Bacteria 17958
329 Ga0500658_0000616 3300053134 Bacteria 14745
330 Ga0500568_0035262 3300053139 Bacteria 2042
331 Ga0500574_024361 3300053141 Bacteria 1566
332 Ga0500586_000405 3300053145 Bacteria 8610
333 Ga0500627_0000530 3300053158 Bacteria 10314
334 Ga0500636_0146308 3300053177 Bacteria 1302
335 Ga0501082_0096692 3300060353 Bacteria 2553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0074614 Ga0495584_0074614_502_1266 254
2 3300025292 Ga0209676_1001700 Ga0209676_10017005 262
3 3300031995 Ga0307409_100108890 Ga0307409_1001088902 262
4 iso_pu_bacteria 2818991441 2819566718 262
5 iso_pu_bacteria 2511231025 2511380102 263
6 iso_pu_bacteria 2576861471 2578456471 263
7 iso_pu_bacteria 2597489887 2597859148 263
8 iso_pu_bacteria 2599185257 2599806254 263
9 iso_pu_bacteria 2599185307 2599972196 263
10 iso_pu_bacteria 2643221593 2643974750 263
11 iso_pu_bacteria 2671180172 2671772682 263
12 iso_pu_bacteria 2738541297 2738825837 263
13 iso_pu_bacteria 2738541357 2739149634 263
14 iso_pu_bacteria 2738543003 2739191553 263
15 iso_pu_bacteria 2738543026 2739318030 263
16 iso_pu_bacteria 2738543029 2739336271 263
17 iso_pu_bacteria 2857564685 2857566238 263
18 iso_pu_bacteria 2941475908 2941479432 263
19 iso_pu_bacteria 2995948881 2995954126 263
20 iso_pu_bacteria 3007419365 3007424157 263
21 iso_pu_bacteria 2643221556 2643802246 264
22 iso_pu_bacteria 2643221684 2644475754 264
23 3300046471 Ga0495650_0011461 Ga0495650_0011461_977_1795 265
24 3300049459 Ga0495678_008568 Ga0495678_008568_1099_1911 265
25 3300005339 Ga0070660_100330811 Ga0070660_1003308112 266
26 3300005563 Ga0068855_100219029 Ga0068855_1002190291 266
27 3300010375 Ga0105239_10248570 Ga0105239_102485701 266
28 3300017792 Ga0163161_10000409 Ga0163161_1000040924 266
29 3300025256 Ga0209759_1004485 Ga0209759_10044852 266
30 3300025913 Ga0207695_10028597 Ga0207695_100285977 266
31 3300025949 Ga0207667_10387268 Ga0207667_103872682 266
32 3300046506 Ga0495583_0001562 Ga0495583_0001562_12239_13039 266
33 3300046520 Ga0495637_0018700 Ga0495637_0018700_2341_3141 266
34 3300046520 Ga0495637_0032237 Ga0495637_0032237_1456_2256 266
35 3300046522 Ga0495643_0000498 Ga0495643_0000498_7928_8728 266
36 3300046538 Ga0495609_0005596 Ga0495609_0005596_2590_3390 266
37 3300046665 Ga0495661_0206215 Ga0495661_0206215_153_953 266
38 3300048091 Ga0495626_0000574 Ga0495626_0000574_5228_6028 266
39 3300049583 Ga0501067_0001716 Ga0501067_0001716_6827_7645 266
40 iso_pu_bacteria 2738543012 2739241988 266
41 iso_pu_bacteria 2818991446 2819602043 266
42 iso_pu_bacteria 2899924645 2899927199 266
43 iso_pu_bacteria 2904479285 2904482764 266
44 iso_pu_bacteria 2928037797 2928044039 266
45 iso_pu_bacteria 2928044640 2928048687 266
46 3300003187 JGI25151J46595_10000324 JGI25151J46595_1000032441 267
47 3300003771 Ga0055526_1000052 Ga0055526_100005260 267
48 3300005288 Ga0065714_10077000 Ga0065714_100770001 267
49 3300005335 Ga0070666_10184780 Ga0070666_101847802 267
50 3300005367 Ga0070667_100062302 Ga0070667_1000623022 267
51 3300005843 Ga0068860_100244400 Ga0068860_1002444002 267
52 3300006051 Ga0075364_10263531 Ga0075364_102635311 267
53 3300009011 Ga0105251_10003726 Ga0105251_100037263 267
54 3300009036 Ga0105244_10005378 Ga0105244_100053788 267
55 3300009036 Ga0105244_10027904 Ga0105244_100279042 267
56 3300009036 Ga0105244_10148511 Ga0105244_101485111 267
57 3300013100 Ga0157373_10219405 Ga0157373_102194051 267
58 3300013102 Ga0157371_10000158 Ga0157371_1000015850 267
59 3300013104 Ga0157370_10008069 Ga0157370_100080699 267
60 3300013306 Ga0163162_10213565 Ga0163162_102135652 267
61 3300014497 Ga0182008_10000063 Ga0182008_1000006321 267
62 3300014497 Ga0182008_10031760 Ga0182008_100317602 267
63 3300014497 Ga0182008_10042928 Ga0182008_100429283 267
64 3300015262 Ga0182007_10000019 Ga0182007_1000001967 267
65 3300015265 Ga0182005_1000088 Ga0182005_10000882 267
66 3300015689 Ga0183360_10004 Ga0183360_1000430 267
67 3300017792 Ga0163161_10001836 Ga0163161_100018362 267
68 3300025245 Ga0207425_1000872 Ga0207425_100087211 267
69 3300025263 Ga0209565_1003813 Ga0209565_10038133 267
70 3300025294 Ga0209025_1000021 Ga0209025_1000021158 267
71 3300025295 Ga0209564_1000026 Ga0209564_1000026306 267
72 3300025297 Ga0209758_1023869 Ga0209758_10238692 267
73 3300025728 Ga0207655_1055337 Ga0207655_10553372 267
74 3300025728 Ga0207655_1070644 Ga0207655_10706441 267
75 3300025735 Ga0207713_1011043 Ga0207713_10110432 267
76 3300025903 Ga0207680_10357764 Ga0207680_103577642 267
77 3300031711 Ga0265314_10050252 Ga0265314_100502522 267
78 3300041407 Ga0439447_007340 Ga0439447_007340_466_1269 267
79 3300042016 Ga0439463_000482 Ga0439463_000482_7518_8321 267
80 3300046452 Ga0495617_000061 Ga0495617_000061_72551_73354 267
81 3300046458 Ga0495591_000128 Ga0495591_000128_76549_77352 267
82 3300046458 Ga0495591_003754 Ga0495591_003754_1251_2054 267
83 3300046460 Ga0495638_0001147 Ga0495638_0001147_5752_6555 267
84 3300046471 Ga0495650_0000472 Ga0495650_0000472_14289_15092 267
85 3300046471 Ga0495650_0040920 Ga0495650_0040920_523_1326 267
86 3300046491 Ga0495584_0000006 Ga0495584_0000006_84548_85351 267
87 3300046492 Ga0495585_0003240 Ga0495585_0003240_3983_4786 267
88 3300046500 Ga0495596_0001281 Ga0495596_0001281_12139_12942 267
89 3300046501 Ga0495607_0000186 Ga0495607_0000186_26644_27447 267
90 3300046501 Ga0495607_0016762 Ga0495607_0016762_2535_3338 267
91 3300046507 Ga0495606_0018421 Ga0495606_0018421_906_1709 267
92 3300046507 Ga0495606_0258965 Ga0495606_0258965_13_816 267
93 3300046512 Ga0495610_0000021 Ga0495610_0000021_194225_195028 267
94 3300046512 Ga0495610_0004116 Ga0495610_0004116_6290_7093 267
95 3300046520 Ga0495637_0009486 Ga0495637_0009486_2576_3379 267
96 3300046524 Ga0495648_0002704 Ga0495648_0002704_14439_15242 267
97 3300046524 Ga0495648_0005785 Ga0495648_0005785_8351_9154 267
98 3300046525 Ga0495663_0001896 Ga0495663_0001896_32_835 267
99 3300046525 Ga0495663_0014713 Ga0495663_0014713_1181_1984 267
100 3300046557 Ga0495622_0068753 Ga0495622_0068753_683_1486 267
101 3300046616 Ga0495668_0000619 Ga0495668_0000619_2039_2842 267
102 3300046616 Ga0495668_0002319 Ga0495668_0002319_8859_9662 267
103 3300046616 Ga0495668_0002378 Ga0495668_0002378_6699_7502 267
104 3300046648 Ga0495611_0193020 Ga0495611_0193020_98_901 267
105 3300046660 Ga0495625_0234407 Ga0495625_0234407_302_1105 267
106 3300046665 Ga0495661_0025997 Ga0495661_0025997_2709_3512 267
107 3300046691 Ga0495670_0001513 Ga0495670_0001513_4199_5002 267
108 3300046692 Ga0495671_0000024 Ga0495671_0000024_67519_68322 267
109 3300046692 Ga0495671_0013308 Ga0495671_0013308_3317_4120 267
110 3300046810 Ga0495660_0001829 Ga0495660_0001829_4705_5508 267
111 3300046810 Ga0495660_0002049 Ga0495660_0002049_6638_7441 267
112 3300047323 Ga0495683_0028656 Ga0495683_0028656_742_1545 267
113 3300047323 Ga0495683_0044414 Ga0495683_0044414_1002_1805 267
114 3300047446 Ga0495679_002281 Ga0495679_002281_6279_7082 267
115 3300047446 Ga0495679_015386 Ga0495679_015386_428_1231 267
116 3300047469 Ga0495673_0000120 Ga0495673_0000120_72117_72920 267
117 3300047472 Ga0495686_0244175 Ga0495686_0244175_78_881 267
118 3300048907 Ga0496104_0232270 Ga0496104_0232270_846_1649 267
119 3300048919 Ga0496116_0047039 Ga0496116_0047039_1189_1992 267
120 3300048920 Ga0496117_0002092 Ga0496117_0002092_19311_20114 267
121 3300048921 Ga0496118_0000108 Ga0496118_0000108_11155_11958 267
122 3300048921 Ga0496118_0048075 Ga0496118_0048075_38_841 267
123 3300048921 Ga0496118_0136353 Ga0496118_0136353_533_1336 267
124 3300048922 Ga0496119_0000587 Ga0496119_0000587_15417_16220 267
125 3300048923 Ga0496120_0001074 Ga0496120_0001074_2440_3243 267
126 3300048924 Ga0496121_0005005 Ga0496121_0005005_14052_14855 267
127 3300048924 Ga0496121_0070040 Ga0496121_0070040_311_1114 267
128 3300048924 Ga0496121_0164533 Ga0496121_0164533_804_1607 267
129 3300048925 Ga0496122_0009107 Ga0496122_0009107_8835_9638 267
130 3300048925 Ga0496122_0069978 Ga0496122_0069978_351_1154 267
131 3300048925 Ga0496122_0076806 Ga0496122_0076806_731_1534 267
132 3300048926 Ga0496123_0005058 Ga0496123_0005058_12287_13090 267
133 3300048926 Ga0496123_0005518 Ga0496123_0005518_9966_10769 267
134 3300048927 Ga0496124_0000586 Ga0496124_0000586_21502_22305 267
135 3300048927 Ga0496124_0005734 Ga0496124_0005734_12293_13096 267
136 3300048927 Ga0496124_0028527 Ga0496124_0028527_3632_4435 267
137 3300048927 Ga0496124_0053097 Ga0496124_0053097_2223_3026 267
138 3300048927 Ga0496124_0128271 Ga0496124_0128271_722_1525 267
139 3300048927 Ga0496124_0200228 Ga0496124_0200228_530_1333 267
140 3300048928 Ga0496125_0003002 Ga0496125_0003002_15193_15996 267
141 3300048928 Ga0496125_0137646 Ga0496125_0137646_568_1371 267
142 3300048929 Ga0496126_0001975 Ga0496126_0001975_15279_16082 267
143 3300049460 Ga0495682_0000027 Ga0495682_0000027_132794_133597 267
144 3300050491 nmdc:mga00v17_115563_c1 nmdc:mga00v17_115563_c1_558_1361 267
145 3300050492 nmdc:mga0yw44_10846_c1 nmdc:mga0yw44_10846_c1_3296_4099 267
146 3300053145 Ga0500586_000405 Ga0500586_000405_4341_5144 267
147 iso_pu_bacteria 2738541307 2738882354 267
148 iso_pu_bacteria 2838054893 2838055109 267
149 iso_pu_bacteria 2842677519 2842681600 267
150 iso_pu_bacteria 2919462493 2919465372 267
151 iso_pu_bacteria 2928064002 2928068447 267
152 3300005336 Ga0070680_100093306 Ga0070680_1000933062 268
153 3300013307 Ga0157372_10233036 Ga0157372_102330362 268
154 3300025230 Ga0209563_100007 Ga0209563_100007673 268
155 3300025917 Ga0207660_10083548 Ga0207660_100835482 268
156 3300037312 Ga0395899_0002089 Ga0395899_0002089_11351_12157 268
157 3300037418 Ga0395900_0034162 Ga0395900_0034162_4229_5035 268
158 3300037471 Ga0395905_0155671 Ga0395905_0155671_710_1516 268
159 3300045836 Ga0466958_0018825 Ga0466958_0018825_265_1071 268
160 3300046501 Ga0495607_0045132 Ga0495607_0045132_373_1227 268
161 3300046507 Ga0495606_0128016 Ga0495606_0128016_601_1407 268
162 3300046522 Ga0495643_0014072 Ga0495643_0014072_964_1818 268
163 3300046665 Ga0495661_0016581 Ga0495661_0016581_1960_2766 268
164 3300046674 Ga0495588_0000077 Ga0495588_0000077_38211_39017 268
165 3300048927 Ga0496124_0004904 Ga0496124_0004904_8907_9713 268
166 iso_pu_bacteria 2513020051 2513228767 268
167 iso_pu_bacteria 2908446538 2908448942 268
168 iso_pu_bacteria 2928084124 2928089640 268
169 3300025942 Ga0207689_10205588 Ga0207689_102055882 269
170 3300026116 Ga0207674_10130004 Ga0207674_101300042 269
171 3300028794 Ga0307515_10087173 Ga0307515_100871733 269
172 3300046513 Ga0495616_0000097 Ga0495616_0000097_17504_18325 269
173 3300049744 Ga0501083_0001367 Ga0501083_0001367_9637_10476 269
174 3300053108 Ga0500562_017323 Ga0500562_017323_372_1181 269
175 3300060353 Ga0501082_0096692 Ga0501082_0096692_18_857 269
176 iso_pu_bacteria 2643221658 2644326132 269
177 iso_pu_bacteria 2643221672 2644400798 269
178 iso_pu_bacteria 2643221683 2644466035 269
179 iso_pu_bacteria 2945984333 2945990358 269
180 3300003761 Ga0055535_1000108 Ga0055535_100010837 270
181 3300003762 Ga0055542_1000051 Ga0055542_100005153 270
182 3300005456 Ga0070678_100410753 Ga0070678_1004107531 270
183 3300005577 Ga0068857_100334238 Ga0068857_1003342382 270
184 3300013306 Ga0163162_10500353 Ga0163162_105003531 270
185 3300013307 Ga0157372_10138429 Ga0157372_101384293 270
186 3300025228 Ga0209672_100305 Ga0209672_10030523 270
187 3300025229 Ga0209147_100738 Ga0209147_10073818 270
188 3300025242 Ga0209258_100132 Ga0209258_10013254 270
189 3300025254 Ga0209148_1000007 Ga0209148_10000071293 270
190 3300026116 Ga0207674_10187143 Ga0207674_101871432 270
191 3300026121 Ga0207683_10168806 Ga0207683_101688062 270
192 3300026121 Ga0207683_10203815 Ga0207683_102038152 270
193 3300031507 Ga0307509_10015769 Ga0307509_100157698 270
194 iso_pu_bacteria 2599185214 2599620919 270
195 iso_pu_bacteria 2599185226 2599674275 270
196 iso_pu_bacteria 2599185227 2599678465 270
197 iso_pu_bacteria 2599185229 2599690430 270
198 iso_pu_bacteria 2857576091 2857580874 270
199 iso_pu_bacteria 2885198086 2885201895 270
200 iso_pu_bacteria 2885211737 2885215395 270
201 iso_pu_bacteria 2928051484 2928055013 270
202 iso_pu_bacteria 2928070936 2928073650 270
203 iso_pu_bacteria 2945909444 2945914259 270
204 3300002773 JGI25152J39213_1006909 JGI25152J39213_10069093 271
205 3300002773 JGI25152J39213_1010078 JGI25152J39213_10100783 271
206 3300002774 JGI25150J39212_1001279 JGI25150J39212_10012792 271
207 3300002774 JGI25150J39212_1001363 JGI25150J39212_10013632 271
208 3300002987 JGI25159J45721_1001762 JGI25159J45721_10017629 271
209 3300003187 JGI25151J46595_10001164 JGI25151J46595_1000116410 271
210 3300003187 JGI25151J46595_10035670 JGI25151J46595_100356702 271
211 3300003215 JGI25153J46596_10029434 JGI25153J46596_100294342 271
212 3300003354 JGI25160J50197_1002414 JGI25160J50197_10024149 271
213 3300003374 JGI25161J50226_1001167 JGI25161J50226_10011679 271
214 3300003374 JGI25161J50226_1001715 JGI25161J50226_10017158 271
215 3300003771 Ga0055526_1004231 Ga0055526_10042319 271
216 3300003771 Ga0055526_1004926 Ga0055526_10049262 271
217 3300003773 Ga0055537_1001568 Ga0055537_10015689 271
218 3300003773 Ga0055537_1015607 Ga0055537_10156072 271
219 3300003775 Ga0055524_1002826 Ga0055524_10028269 271
220 3300003775 Ga0055524_1018080 Ga0055524_10180802 271
221 3300003781 Ga0055536_1008124 Ga0055536_10081241 271
222 3300003784 Ga0055534_1002084 Ga0055534_10020842 271
223 3300003784 Ga0055534_1016513 Ga0055534_10165132 271
224 3300003790 Ga0055528_1003003 Ga0055528_10030039 271
225 3300003790 Ga0055528_1032621 Ga0055528_10326212 271
226 3300003791 Ga0055530_10058226 Ga0055530_100582261 271
227 3300003794 Ga0055531_10024330 Ga0055531_100243302 271
228 3300004625 Ga0055543_1001589 Ga0055543_10015899 271
229 3300005262 Ga0065165_1004420 Ga0065165_10044209 271
230 3300005262 Ga0065165_1036022 Ga0065165_10360222 271
231 3300005262 Ga0065165_1042691 Ga0065165_10426912 271
232 3300006353 Ga0075370_10001484 Ga0075370_100014849 271
233 3300025208 Ga0209436_101415 Ga0209436_1014153 271
234 3300025208 Ga0209436_102196 Ga0209436_1021968 271
235 3300025245 Ga0207425_1000719 Ga0207425_10007193 271
236 3300025258 Ga0209129_1000084 Ga0209129_100008473 271
237 3300025258 Ga0209129_1001133 Ga0209129_10011337 271
238 3300025258 Ga0209129_1002047 Ga0209129_10020478 271
239 3300025263 Ga0209565_1000499 Ga0209565_10004992 271
240 3300025263 Ga0209565_1003482 Ga0209565_10034827 271
241 3300025273 Ga0209673_1000753 Ga0209673_100075317 271
242 3300025273 Ga0209673_1001028 Ga0209673_10010282 271
243 3300025273 Ga0209673_1001819 Ga0209673_100181915 271
244 3300025284 Ga0209130_1000362 Ga0209130_100036223 271
245 3300025284 Ga0209130_1000385 Ga0209130_100038540 271
246 3300025291 Ga0209675_1000701 Ga0209675_100070122 271
247 3300025291 Ga0209675_1021867 Ga0209675_10218672 271
248 3300025292 Ga0209676_1007569 Ga0209676_10075695 271
249 3300025294 Ga0209025_1000942 Ga0209025_100094245 271
250 3300025294 Ga0209025_1001442 Ga0209025_100144222 271
251 3300025294 Ga0209025_1009399 Ga0209025_10093992 271
252 3300025294 Ga0209025_1020095 Ga0209025_10200953 271
253 3300025294 Ga0209025_1023324 Ga0209025_10233246 271
254 3300025295 Ga0209564_1000414 Ga0209564_100041441 271
255 3300025295 Ga0209564_1000613 Ga0209564_100061353 271
256 3300025297 Ga0209758_1000184 Ga0209758_100018435 271
257 3300025298 Ga0209050_1027488 Ga0209050_10274882 271
258 3300025299 Ga0209256_1000156 Ga0209256_100015627 271
259 3300025299 Ga0209256_1000239 Ga0209256_100023984 271
260 3300025302 Ga0207426_1000049 Ga0207426_1000049111 271
261 3300025302 Ga0207426_1000086 Ga0207426_100008685 271
262 3300025302 Ga0207426_1050532 Ga0207426_10505321 271
263 3300025304 Ga0209257_1002613 Ga0209257_100261316 271
264 3300025935 Ga0207709_10103915 Ga0207709_101039152 271
265 3300028379 Ga0268266_10728695 Ga0268266_107286951 271
266 3300030731 Ga0316177_1114200 Ga0316177_11142002 271
267 3300030733 Ga0314311_1045908 Ga0314311_10459082 271
268 3300030735 Ga0316178_1102817 Ga0316178_11028172 271
269 3300030736 Ga0316180_1178586 Ga0316180_11785862 271
270 3300030742 Ga0316183_1017432 Ga0316183_101743213 271
271 3300031548 Ga0307408_100062382 Ga0307408_1000623822 271
272 3300031731 Ga0307405_10623271 Ga0307405_106232711 271
273 3300042016 Ga0439463_001749 Ga0439463_001749_990_1805 271
274 3300046474 Ga0495605_0000254 Ga0495605_0000254_58383_59198 271
275 3300046501 Ga0495607_0000223 Ga0495607_0000223_55958_56773 271
276 3300046506 Ga0495583_0001004 Ga0495583_0001004_25247_26062 271
277 3300046506 Ga0495583_0139334 Ga0495583_0139334_182_997 271
278 3300046507 Ga0495606_0000328 Ga0495606_0000328_6246_7061 271
279 3300046616 Ga0495668_0016349 Ga0495668_0016349_3325_4140 271
280 3300046660 Ga0495625_0021679 Ga0495625_0021679_878_1693 271
281 3300046665 Ga0495661_0018886 Ga0495661_0018886_3008_3823 271
282 3300047321 Ga0495676_0213337 Ga0495676_0213337_467_1282 271
283 3300047469 Ga0495673_0004158 Ga0495673_0004158_4787_5602 271
284 3300047469 Ga0495673_0011315 Ga0495673_0011315_54_869 271
285 3300048089 Ga0495614_0024480 Ga0495614_0024480_937_1752 271
286 3300048906 Ga0496103_0315330 Ga0496103_0315330_66_881 271
287 3300048925 Ga0496122_0015440 Ga0496122_0015440_4770_5585 271
288 3300048925 Ga0496122_0195788 Ga0496122_0195788_319_1134 271
289 3300048926 Ga0496123_0014041 Ga0496123_0014041_680_1495 271
290 3300049460 Ga0495682_0000386 Ga0495682_0000386_5952_6767 271
291 3300049679 Ga0501249_012317 Ga0501249_012317_186_1001 271
292 3300049705 Ga0501225_0013060 Ga0501225_0013060_936_1751 271
293 3300049759 Ga0501262_000026 Ga0501262_000026_19810_20625 271
294 3300050496 nmdc:mga07m45_5667_c1 nmdc:mga07m45_5667_c1_699_1514 271
295 3300053087 Ga0500643_003991 Ga0500643_003991_5457_6272 271
296 3300053122 Ga0500608_027640 Ga0500608_027640_573_1388 271
297 3300053128 Ga0500626_117142 Ga0500626_117142_73_888 271
298 3300053134 Ga0500658_0000434 Ga0500658_0000434_16881_17696 271
299 3300053134 Ga0500658_0000616 Ga0500658_0000616_13669_14484 271
300 3300001979 JGI24740J21852_10011997 JGI24740J21852_100119972 272
301 3300001989 JGI24739J22299_10079591 JGI24739J22299_100795911 272
302 3300003773 Ga0055537_1015488 Ga0055537_10154882 272
303 3300003781 Ga0055536_1004226 Ga0055536_100422610 272
304 3300003781 Ga0055536_1004235 Ga0055536_10042358 272
305 3300003784 Ga0055534_1003214 Ga0055534_10032142 272
306 3300003790 Ga0055528_1032434 Ga0055528_10324342 272
307 3300003791 Ga0055530_10016430 Ga0055530_100164302 272
308 3300003792 Ga0055540_1002243 Ga0055540_10022432 272
309 3300003792 Ga0055540_1003134 Ga0055540_100313410 272
310 3300003794 Ga0055531_10000506 Ga0055531_1000050610 272
311 3300005339 Ga0070660_100043420 Ga0070660_1000434204 272
312 3300005457 Ga0070662_100017603 Ga0070662_1000176038 272
313 3300005539 Ga0068853_100056550 Ga0068853_1000565505 272
314 3300005564 Ga0070664_100007670 Ga0070664_1000076702 272
315 3300006051 Ga0075364_10118251 Ga0075364_101182512 272
316 3300009148 Ga0105243_10036676 Ga0105243_100366765 272
317 3300009148 Ga0105243_10180298 Ga0105243_101802982 272
318 3300009176 Ga0105242_10173078 Ga0105242_101730783 272
319 3300009545 Ga0105237_10632694 Ga0105237_106326941 272
320 3300009551 Ga0105238_10019143 Ga0105238_100191431 272
321 3300013100 Ga0157373_10034174 Ga0157373_100341742 272
322 3300013104 Ga0157370_10003826 Ga0157370_100038266 272
323 3300015262 Ga0182007_10002877 Ga0182007_100028779 272
324 3300025263 Ga0209565_1002618 Ga0209565_10026187 272
325 3300025291 Ga0209675_1001529 Ga0209675_10015297 272
326 3300025291 Ga0209675_1017963 Ga0209675_10179632 272
327 3300025292 Ga0209676_1000542 Ga0209676_100054223 272
328 3300025292 Ga0209676_1000748 Ga0209676_100074821 272
329 3300025295 Ga0209564_1020754 Ga0209564_10207542 272
330 3300025298 Ga0209050_1000836 Ga0209050_100083622 272
331 3300025298 Ga0209050_1027569 Ga0209050_10275692 272
332 3300025303 Ga0209051_1000349 Ga0209051_100034943 272
333 3300025303 Ga0209051_1009746 Ga0209051_10097462 272
334 3300025304 Ga0209257_1000411 Ga0209257_10004112 272
335 3300025304 Ga0209257_1000719 Ga0209257_10007196 272
336 3300025728 Ga0207655_1067840 Ga0207655_10678402 272
337 3300025932 Ga0207690_10207871 Ga0207690_102078712 272
338 3300025933 Ga0207706_10004266 Ga0207706_100042669 272
339 3300025935 Ga0207709_10000351 Ga0207709_1000035127 272
340 3300025935 Ga0207709_10001488 Ga0207709_100014887 272
341 3300025945 Ga0207679_10013094 Ga0207679_100130948 272
342 3300025949 Ga0207667_10060311 Ga0207667_100603115 272
343 3300026067 Ga0207678_10403424 Ga0207678_104034242 272
344 3300031731 Ga0307405_10034244 Ga0307405_100342442 272
345 3300031911 Ga0307412_10034834 Ga0307412_100348343 272
346 3300032005 Ga0307411_10010441 Ga0307411_100104413 272
347 3300046453 Ga0495627_002823 Ga0495627_002823_6901_7722 272
348 3300046460 Ga0495638_0037483 Ga0495638_0037483_682_1500 272
349 3300046501 Ga0495607_0000004 Ga0495607_0000004_42186_43010 272
350 3300046507 Ga0495606_0004103 Ga0495606_0004103_5909_6727 272
351 3300046512 Ga0495610_0017910 Ga0495610_0017910_2441_3259 272
352 3300046513 Ga0495616_0003028 Ga0495616_0003028_1950_2768 272
353 3300046515 Ga0495620_0055936 Ga0495620_0055936_560_1378 272
354 3300046515 Ga0495620_0128503 Ga0495620_0128503_20_841 272
355 3300046518 Ga0495631_0000404 Ga0495631_0000404_23728_24546 272
356 3300046520 Ga0495637_0024603 Ga0495637_0024603_1653_2474 272
357 3300046520 Ga0495637_0038299 Ga0495637_0038299_915_1733 272
358 3300046530 Ga0495654_0012401 Ga0495654_0012401_3708_4526 272
359 3300046536 Ga0495587_0213631 Ga0495587_0213631_53_871 272
360 3300046660 Ga0495625_0244632 Ga0495625_0244632_114_932 272
361 3300046692 Ga0495671_0054735 Ga0495671_0054735_174_995 272
362 3300047321 Ga0495676_0062280 Ga0495676_0062280_1251_2069 272
363 3300047673 Ga0495593_0046231 Ga0495593_0046231_1231_2049 272
364 3300048905 Ga0496102_0281779 Ga0496102_0281779_560_1378 272
365 3300048919 Ga0496116_0082400 Ga0496116_0082400_1103_1921 272
366 3300048920 Ga0496117_0011289 Ga0496117_0011289_53_871 272
367 3300048920 Ga0496117_0197048 Ga0496117_0197048_153_971 272
368 3300048921 Ga0496118_0017280 Ga0496118_0017280_5570_6388 272
369 3300048924 Ga0496121_0012841 Ga0496121_0012841_7577_8395 272
370 3300050491 nmdc:mga00v17_42758_c2 nmdc:mga00v17_42758_c2_391_1212 272
371 3300053079 Ga0500610_0000663 Ga0500610_0000663_568_1389 272
372 3300053079 Ga0500610_0010714 Ga0500610_0010714_3130_3951 272
373 3300053079 Ga0500610_0035811 Ga0500610_0035811_745_1566 272
374 3300053093 Ga0500651_0069721 Ga0500651_0069721_817_1635 272
375 3300053110 Ga0500571_000034 Ga0500571_000034_33317_34135 272
376 3300053117 Ga0500593_000364 Ga0500593_000364_16500_17321 272
377 3300053118 Ga0500594_0094378 Ga0500594_0094378_83_901 272
378 3300053121 Ga0500607_001372 Ga0500607_001372_15010_15828 272
379 3300053139 Ga0500568_0035262 Ga0500568_0035262_211_1029 272
380 3300053141 Ga0500574_024361 Ga0500574_024361_639_1457 272
381 3300053158 Ga0500627_0000530 Ga0500627_0000530_8707_9528 272
382 3300053177 Ga0500636_0146308 Ga0500636_0146308_271_1089 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

53

300

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4otk-assembly1.cif.gz_A a structural characterization of the isoniazid mycobacterium tuberculosis drug target, rv2971, in its unliganded form 0.9658 8 260
4g5d-assembly2.cif.gz_B x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph 0.9587 8 260
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.9585 8 260
1m9h-assembly1.cif.gz_A corynebacterium 2,5-dkgr a and phe 22 replaced with tyr (f22y), lys 232 replaced with gly (k232g), arg 238 replaced with his (r238h)and ala 272 replaced with gly (a272g)in presence of nadh cofactor 0.9584 8 260
1a80-assembly1.cif.gz_A native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph 0.9573 8 260
ID Description Score Start End Superfamily
af_P30863_1_265_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9987 8 267 3.20.20.100
af_P30863_1_265_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9762 8 267 3.20.20.100
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9658 8 260 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9575 8 260 3.20.20.100
af_Q9VTL0_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9544 8 257 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4U6M0S1-F1-model_v4 2,5-didehydrogluconate reductase DkgB (EC 1.1.1.346) 0.9983 8 269 GO:0004033
GO:0019853
GO:0051596
GO:1990002
AF-A0A6I5AJR0-F1-model_v4 2,5-didehydrogluconate reductase DkgB (EC 1.1.1.346) 0.9973 8 269 GO:0004033
GO:0019853
GO:0051596
GO:1990002
AF-A0A6C8GS15-F1-model_v4 Methylglyoxal reductase 0.9973 86 269 GO:0004033
GO:0019853
GO:0051596
GO:1990002
AF-F4MZR4-F1-model_v4 2,5-diketo-D-gluconic acid reductase B (EC 1.1.1.21, EC 1.1.1.274) 0.9971 8 267 GO:0004032
GO:0019853
GO:0050580
GO:0051596
GO:1990002
AF-A0A3S4DER2-F1-model_v4 2,5-diketo-D-gluconic acid reductase B (EC 1.1.1.274) 0.9968 8 269 GO:0004033
GO:0019853
GO:0050580
GO:0051596
GO:1990002

Feature Viewer

pLDDT pTM Quality
95.95 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map