F429251

General Info

Members Datasets Scaffolds Average Seq Length
382 158 764 178

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10839297|Ga0105240_108392972
Length 197
Sequence MGVEINSLTPMDRIPFQATTAGALYDHIRQLPVAVLLDNVRSLYNVGSFFRTGDAAGIEKLYLCGITGRPPKGAITKTALGAEESVPWEHTWEPEPLVGDLRARGYEIAAVETSVHAVDLFDWTPRFPVCIVFGHEVDGIRPELSALCDTHVRIPMLGAKHSLNVATAGGVLIYELLRKYRGLHVGQPPSPSRAGES

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 20.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10839297 3300009093 Bacteria 993
2 Ga0070683_100000008 3300005329 Bacteria 329206
3 Ga0070683_100049520 3300005329 Bacteria 3886
4 Ga0070683_100135467 3300005329 Bacteria 2332
5 Ga0070683_100427945 3300005329 Bacteria 1263
6 Ga0070683_101508478 3300005329 Bacteria 646
7 Ga0068868_100004598 3300005338 Bacteria 9685
8 Ga0068868_100011066 3300005338 Bacteria 6561
9 Ga0070660_100013171 3300005339 Bacteria 5926
10 Ga0070660_100078982 3300005339 Bacteria 2581
11 Ga0070689_100080027 3300005340 Bacteria 2564
12 Ga0070661_100041748 3300005344 Bacteria 3347
13 Ga0070674_101242897 3300005356 Bacteria 662
14 Ga0070673_101560412 3300005364 Unclassified 623
15 Ga0070688_100033043 3300005365 Bacteria 3125
16 Ga0070688_100698778 3300005365 Unclassified 785
17 Ga0070667_100068923 3300005367 Bacteria 3010
18 Ga0070667_100080176 3300005367 Unclassified 2791
19 Ga0070667_100135659 3300005367 Bacteria 2151
20 Ga0070667_100375672 3300005367 Unclassified 1290
21 Ga0070667_100834051 3300005367 Unclassified 857
22 Ga0070714_100033603 3300005435 Unclassified 4289
23 Ga0070713_100001719 3300005436 Bacteria 14094
24 Ga0070713_100043584 3300005436 Bacteria 3669
25 Ga0070710_10581303 3300005437 Bacteria 777
26 Ga0070711_100008903 3300005439 Bacteria 6160
27 Ga0070711_100349975 3300005439 Bacteria 1188
28 Ga0070681_10048578 3300005458 Bacteria 4240
29 Ga0068867_100462448 3300005459 Bacteria 1083
30 Ga0070679_100087649 3300005530 Bacteria 3100
31 Ga0070679_100297729 3300005530 Bacteria 1564
32 Ga0070684_100000002 3300005535 Bacteria 257669
33 Ga0070684_100056534 3300005535 Bacteria 3425
34 Ga0070684_100347880 3300005535 Bacteria 1363
35 Ga0070684_100425003 3300005535 Unclassified 1227
36 Ga0068853_100227160 3300005539 Bacteria 1706
37 Ga0068853_100245192 3300005539 Bacteria 1643
38 Ga0068853_100781804 3300005539 Bacteria 913
39 Ga0070665_100012639 3300005548 Bacteria 8501
40 Ga0070665_100125316 3300005548 Bacteria 2571
41 Ga0068855_100027905 3300005563 Bacteria 6752
42 Ga0068855_100173687 3300005563 Bacteria 2439
43 Ga0068855_100314853 3300005563 Bacteria 1731
44 Ga0068857_100039937 3300005577 Unclassified 4159
45 Ga0068857_100043536 3300005577 Bacteria 3982
46 Ga0068856_100007183 3300005614 Bacteria 10862
47 Ga0068856_100467919 3300005614 Bacteria 1281
48 Ga0068856_100779831 3300005614 Bacteria 976
49 Ga0068852_100004418 3300005616 Bacteria 9935
50 Ga0068852_100143973 3300005616 Bacteria 2209
51 Ga0068859_100175029 3300005617 Bacteria 2228
52 Ga0068864_100833243 3300005618 Unclassified 908
53 Ga0068866_10049836 3300005718 Bacteria 2124
54 Ga0068863_100333224 3300005841 Bacteria 1475
55 Ga0068858_100009986 3300005842 Bacteria 9016
56 Ga0068858_100063092 3300005842 Bacteria 3428
57 Ga0068858_100482435 3300005842 Bacteria 1197
58 Ga0068858_100506195 3300005842 Unclassified 1167
59 Ga0068858_101359525 3300005842 Bacteria 699
60 Ga0068860_100030892 3300005843 Bacteria 5150
61 Ga0068860_100202921 3300005843 Bacteria 1922
62 Ga0068860_101219458 3300005843 Bacteria 773
63 Ga0070717_10010814 3300006028 Bacteria 6905
64 Ga0070717_10082537 3300006028 Bacteria 2701
65 Ga0070712_100513218 3300006175 Bacteria 1006
66 Ga0097621_100002831 3300006237 Bacteria 11896
67 Ga0097621_100040582 3300006237 Unclassified 3742
68 Ga0097621_100050688 3300006237 Bacteria 3376
69 Ga0097621_100307942 3300006237 Unclassified 1400
70 Ga0097621_100390941 3300006237 Bacteria 1244
71 Ga0097621_101067533 3300006237 Bacteria 757
72 Ga0068871_100006833 3300006358 Bacteria 8118
73 Ga0068871_100658157 3300006358 Unclassified 957
74 Ga0075434_100641645 3300006871 Unclassified 1080
75 Ga0068865_100008074 3300006881 Bacteria 6498
76 Ga0097620_100175041 3300006931 Bacteria 2228
77 Ga0105240_10000408 3300009093 Bacteria 79917
78 Ga0105240_10007286 3300009093 Bacteria 16104
79 Ga0105240_10141822 3300009093 Bacteria 2872
80 Ga0105240_10285140 3300009093 Bacteria 1896
81 Ga0105240_10477469 3300009093 Bacteria 1390
82 Ga0105240_10531660 3300009093 Bacteria 1303
83 Ga0111539_10293168 3300009094 Unclassified 1893
84 Ga0105245_10004649 3300009098 Bacteria 12129
85 Ga0105245_10006539 3300009098 Bacteria 10230
86 Ga0105245_10030058 3300009098 Bacteria 4803
87 Ga0105245_10103408 3300009098 Unclassified 2639
88 Ga0105245_10145639 3300009098 Bacteria 2235
89 Ga0105245_10174845 3300009098 Bacteria 2047
90 Ga0105245_10658488 3300009098 Viruses 1078
91 Ga0105245_10802044 3300009098 Bacteria 980
92 Ga0105247_10064324 3300009101 Bacteria 2278
93 Ga0114129_10983147 3300009147 Bacteria 1064
94 Ga0105241_10013883 3300009174 Bacteria 5902
95 Ga0105241_10037421 3300009174 Unclassified 3655
96 Ga0105241_10088292 3300009174 Bacteria 2441
97 Ga0105241_10428754 3300009174 Bacteria 1165
98 Ga0105241_11260391 3300009174 Unclassified 702
99 Ga0105242_10006034 3300009176 Bacteria 9342
100 Ga0105242_10017600 3300009176 Bacteria 5574
101 Ga0105242_10103528 3300009176 Unclassified 2415
102 Ga0105242_10113692 3300009176 Bacteria 2312
103 Ga0105242_10192398 3300009176 Unclassified 1807
104 Ga0105242_10431128 3300009176 Bacteria 1238
105 Ga0105242_10601181 3300009176 Bacteria 1062
106 Ga0105248_10008614 3300009177 Bacteria 11203
107 Ga0105248_10081646 3300009177 Unclassified 3634
108 Ga0105248_10229646 3300009177 Bacteria 2089
109 Ga0105248_10379462 3300009177 Bacteria 1591
110 Ga0105237_10029191 3300009545 Bacteria 5610
111 Ga0105237_10043971 3300009545 Bacteria 4498
112 Ga0105237_10118111 3300009545 Unclassified 2646
113 Ga0105237_10182765 3300009545 Unclassified 2097
114 Ga0105237_10189141 3300009545 Bacteria 2059
115 Ga0105237_10433605 3300009545 Bacteria 1320
116 Ga0105237_10558675 3300009545 Bacteria 1151
117 Ga0105238_10029343 3300009551 Bacteria 5603
118 Ga0105238_10061156 3300009551 Bacteria 3769
119 Ga0105238_10092491 3300009551 Unclassified 3012
120 Ga0105238_10104853 3300009551 Bacteria 2808
121 Ga0105238_10212122 3300009551 Bacteria 1912
122 Ga0105238_10273138 3300009551 Unclassified 1671
123 Ga0105238_10291544 3300009551 Bacteria 1614
124 Ga0105238_10296633 3300009551 Unclassified 1600
125 Ga0105238_11075071 3300009551 Unclassified 827
126 Ga0105249_11162824 3300009553 Unclassified 842
127 Ga0105239_10020605 3300010375 Bacteria 7275
128 Ga0105239_10051277 3300010375 Bacteria 4524
129 Ga0105239_10308535 3300010375 Bacteria 1783
130 Ga0105239_10394063 3300010375 Unclassified 1567
131 Ga0105246_10251408 3300011119 Bacteria 1403
132 Ga0157370_10008684 3300013104 Bacteria 10932
133 Ga0157370_10690007 3300013104 Unclassified 932
134 Ga0157369_10049902 3300013105 Bacteria 4534
135 Ga0157369_10070948 3300013105 Bacteria 3741
136 Ga0157369_10095148 3300013105 Bacteria 3179
137 Ga0157369_10163440 3300013105 Bacteria 2349
138 Ga0157374_10024327 3300013296 Bacteria 5429
139 Ga0157374_10184586 3300013296 Unclassified 2039
140 Ga0157378_10010108 3300013297 Bacteria 8227
141 Ga0157378_10051994 3300013297 Bacteria 3645
142 Ga0163162_10005937 3300013306 Bacteria 11818
143 Ga0163162_10008837 3300013306 Bacteria 9796
144 Ga0163162_10188616 3300013306 Bacteria 2189
145 Ga0163162_10881603 3300013306 Unclassified 1009
146 Ga0163162_11059989 3300013306 Unclassified 918
147 Ga0157372_10114936 3300013307 Bacteria 3085
148 Ga0157372_10284775 3300013307 Bacteria 1922
149 Ga0157372_10307104 3300013307 Bacteria 1846
150 Ga0157372_10585265 3300013307 Bacteria 1301
151 Ga0157375_10380791 3300013308 Bacteria 1577
152 Ga0157375_11173192 3300013308 Unclassified 900
153 Ga0157375_11297907 3300013308 Viruses 856
154 Ga0157375_12271936 3300013308 Bacteria 646
155 Ga0163163_10096977 3300014325 Unclassified 2969
156 Ga0163163_10098606 3300014325 Bacteria 2943
157 Ga0163163_10103191 3300014325 Unclassified 2876
158 Ga0163163_10282077 3300014325 Bacteria 1713
159 Ga0163163_10331457 3300014325 Unclassified 1576
160 Ga0163163_10428392 3300014325 Unclassified 1382
161 Ga0163163_10474609 3300014325 Bacteria 1312
162 Ga0157380_10426062 3300014326 Bacteria 1267
163 Ga0157379_10095588 3300014968 Bacteria 2666
164 Ga0157379_10118533 3300014968 Unclassified 2381
165 Ga0157376_10022024 3300014969 Bacteria 4958
166 Ga0157376_10366792 3300014969 Bacteria 1383
167 Ga0157376_10803640 3300014969 Bacteria 953
168 Ga0207642_10174472 3300025899 Bacteria 1166
169 Ga0207680_10669741 3300025903 Bacteria 743
170 Ga0207699_10363202 3300025906 Bacteria 1024
171 Ga0207705_10030236 3300025909 Bacteria 3864
172 Ga0207654_10015987 3300025911 Unclassified 3901
173 Ga0207654_10192445 3300025911 Bacteria 1338
174 Ga0207654_10259941 3300025911 Bacteria 1167
175 Ga0207654_10386417 3300025911 Unclassified 970
176 Ga0207707_10237219 3300025912 Bacteria 1586
177 Ga0207695_10013480 3300025913 Bacteria 9747
178 Ga0207695_10017855 3300025913 Bacteria 8223
179 Ga0207695_10039736 3300025913 Bacteria 5053
180 Ga0207695_10098103 3300025913 Unclassified 2930
181 Ga0207695_10126496 3300025913 Bacteria 2517
182 Ga0207695_10820773 3300025913 Bacteria 810
183 Ga0207671_10081113 3300025914 Unclassified 2433
184 Ga0207671_10095660 3300025914 Bacteria 2243
185 Ga0207671_10305421 3300025914 Bacteria 1257
186 Ga0207671_10495388 3300025914 Bacteria 974
187 Ga0207663_10611932 3300025916 Bacteria 857
188 Ga0207660_10469165 3300025917 Unclassified 1019
189 Ga0207657_10006013 3300025919 Bacteria 12626
190 Ga0207657_10189618 3300025919 Bacteria 1659
191 Ga0207649_10050889 3300025920 Bacteria 2564
192 Ga0207652_10027219 3300025921 Bacteria 4763
193 Ga0207652_11023940 3300025921 Bacteria 725
194 Ga0207694_10014970 3300025924 Bacteria 5849
195 Ga0207694_10022349 3300025924 Unclassified 4798
196 Ga0207694_10087004 3300025924 Bacteria 2461
197 Ga0207694_10093337 3300025924 Bacteria 2377
198 Ga0207694_10134212 3300025924 Unclassified 1986
199 Ga0207687_10004718 3300025927 Bacteria 9067
200 Ga0207687_10005939 3300025927 Bacteria 8074
201 Ga0207687_10013268 3300025927 Bacteria 5379
202 Ga0207687_10636893 3300025927 Bacteria 901
203 Ga0207700_10004352 3300025928 Bacteria 8335
204 Ga0207700_10032008 3300025928 Bacteria 3745
205 Ga0207700_10116060 3300025928 Unclassified 2163
206 Ga0207664_10037363 3300025929 Bacteria 3758
207 Ga0207644_10060637 3300025931 Bacteria 2738
208 Ga0207690_10088205 3300025932 Bacteria 2185
209 Ga0207686_10006802 3300025934 Bacteria 6158
210 Ga0207686_10013004 3300025934 Unclassified 4594
211 Ga0207686_10044243 3300025934 Unclassified 2733
212 Ga0207686_10082660 3300025934 Bacteria 2100
213 Ga0207686_10103091 3300025934 Bacteria 1908
214 Ga0207686_10151148 3300025934 Bacteria 1616
215 Ga0207670_10034045 3300025936 Bacteria 3288
216 Ga0207670_10311934 3300025936 Bacteria 1235
217 Ga0207669_11153269 3300025937 Bacteria 655
218 Ga0207704_10004051 3300025938 Bacteria 6678
219 Ga0207711_10103695 3300025941 Unclassified 2519
220 Ga0207711_10134618 3300025941 Bacteria 2219
221 Ga0207711_10202041 3300025941 Bacteria 1814
222 Ga0207711_10288047 3300025941 Bacteria 1513
223 Ga0207711_10526374 3300025941 Bacteria 1102
224 Ga0207661_10000008 3300025944 Bacteria 451211
225 Ga0207661_10075492 3300025944 Bacteria 2766
226 Ga0207661_10150377 3300025944 Bacteria 2012
227 Ga0207661_10252671 3300025944 Bacteria 1568
228 Ga0207661_10521469 3300025944 Bacteria 1087
229 Ga0207661_10845327 3300025944 Bacteria 843
230 Ga0207661_11078203 3300025944 Bacteria 740
231 Ga0207679_10231439 3300025945 Bacteria 1560
232 Ga0207667_10011557 3300025949 Bacteria 10254
233 Ga0207667_10115142 3300025949 Unclassified 2771
234 Ga0207667_10120907 3300025949 Bacteria 2699
235 Ga0207667_10184764 3300025949 Bacteria 2140
236 Ga0207667_10527362 3300025949 Bacteria 1196
237 Ga0207651_10475932 3300025960 Bacteria 1076
238 Ga0207712_11144119 3300025961 Bacteria 693
239 Ga0207658_10034018 3300025986 Unclassified 3639
240 Ga0207658_10310373 3300025986 Bacteria 1362
241 Ga0207658_10336862 3300025986 Unclassified 1310
242 Ga0207677_10003348 3300026023 Bacteria 8492
243 Ga0207677_10006047 3300026023 Bacteria 6602
244 Ga0207703_10027559 3300026035 Bacteria 4473
245 Ga0207703_10381512 3300026035 Unclassified 1304
246 Ga0207639_10033243 3300026041 Bacteria 3803
247 Ga0207639_10279035 3300026041 Bacteria 1469
248 Ga0207639_10590951 3300026041 Bacteria 1023
249 Ga0207702_10056200 3300026078 Bacteria 3341
250 Ga0207641_10172333 3300026088 Bacteria 1976
251 Ga0207641_10213739 3300026088 Bacteria 1785
252 Ga0207648_10076257 3300026089 Bacteria 2922
253 Ga0207676_10092887 3300026095 Bacteria 2483
254 Ga0207674_10006472 3300026116 Bacteria 13769
255 Ga0207674_10011285 3300026116 Bacteria 10042
256 Ga0207674_10017423 3300026116 Bacteria 7838
257 Ga0207683_11265826 3300026121 Bacteria 683
258 Ga0207698_10005359 3300026142 Bacteria 7914
259 Ga0207698_10470229 3300026142 Bacteria 1217
260 Ga0268266_10035668 3300028379 Bacteria 4230
261 Ga0268266_10087439 3300028379 Unclassified 2726
262 Ga0268266_10108375 3300028379 Bacteria 2458
263 Ga0268264_10403877 3300028381 Unclassified 1314
264 Ga0268264_11561870 3300028381 Bacteria 670
265 Ga0265331_10200362 3300031250 Bacteria 899
266 Ga0265316_10007365 3300031344 Bacteria 10369
267 Ga0265316_10058355 3300031344 Bacteria 3006
268 Ga0265316_10575121 3300031344 Bacteria 800
269 Ga0265314_10019814 3300031711 Bacteria 5202
270 Ga0265342_10033188 3300031712 Bacteria 3176
271 Ga0373934_0105889 3300035086 Unclassified 1139
272 Ga0373954_0119069 3300035118 Bacteria 1281
273 Ga0373954_0163832 3300035118 Bacteria 1088
274 Ga0373954_0480006 3300035118 Unclassified 616
275 Ga0373943_0459290 3300035170 Bacteria 741
276 Ga0373955_0014243 3300035172 Bacteria 3864
277 Ga0373955_0449143 3300035172 Unclassified 786
278 Ga0373924_0150616 3300035410 Bacteria 1018
279 Ga0373935_1033256 3300035692 Bacteria 611
280 Ga0373927_0002753 3300035695 Bacteria 12827
281 Ga0373927_0085400 3300035695 Bacteria 2048
282 Ga0373927_0268408 3300035695 Bacteria 1122
283 Ga0373927_0508544 3300035695 Unclassified 796
284 Ga0373933_0475539 3300035724 Unclassified 818
285 Ga0373947_0049111 3300035725 Bacteria 2533
286 Ga0373947_0322261 3300035725 Bacteria 1034
287 Ga0373937_0090716 3300036401 Unclassified 2830
288 Ga0373937_0401651 3300036401 Bacteria 1300
289 Ga0373937_0491587 3300036401 Bacteria 1166
290 Ga0373937_0549196 3300036401 Bacteria 1097
291 Ga0373937_0917310 3300036401 Unclassified 825
292 Ga0373925_0029324 3300037068 Bacteria 4037
293 Ga0373925_0171347 3300037068 Bacteria 1714
294 Ga0373925_0265482 3300037068 Bacteria 1380
295 Ga0373925_0323970 3300037068 Bacteria 1247
296 Ga0373925_0328808 3300037068 Bacteria 1238
297 Ga0373925_0405025 3300037068 Bacteria 1113
298 Ga0436364_0507365 3300037853 Bacteria 6078
299 Ga0436363_0721129 3300039450 Bacteria 682
300 Ga0439448_0123833 3300042005 Bacteria 888
301 Ga0453684_0680296 3300044712 Bacteria 1120
302 Ga0451576_0084491 3300045051 Bacteria 3302
303 Ga0451576_0172042 3300045051 Bacteria 2261
304 Ga0451576_0436627 3300045051 Bacteria 1374
305 Ga0495592_0057811 3300046454 Bacteria 2862
306 Ga0495592_0156145 3300046454 Bacteria 1574
307 Ga0495629_0196053 3300046459 Unclassified 1397
308 Ga0495651_0026110 3300046462 Bacteria 4548
309 Ga0495651_0049042 3300046462 Bacteria 3260
310 Ga0495651_0056814 3300046462 Bacteria 3005
311 Ga0495653_0268694 3300046463 Unclassified 1124
312 Ga0495580_0001987 3300046472 Bacteria 17988
313 Ga0495580_0007010 3300046472 Bacteria 9087
314 Ga0495580_0101724 3300046472 Bacteria 1998
315 Ga0495580_0282204 3300046472 Bacteria 1133
316 Ga0495580_0551527 3300046472 Bacteria 765
317 Ga0495582_0118577 3300046473 Bacteria 1490
318 Ga0495582_0423532 3300046473 Unclassified 768
319 Ga0495664_0019141 3300046477 Bacteria 3932
320 Ga0495664_0050811 3300046477 Bacteria 2462
321 Ga0495664_0108983 3300046477 Unclassified 1671
322 Ga0495594_0150125 3300046499 Unclassified 1323
323 Ga0495608_0024301 3300046511 Bacteria 4146
324 Ga0495608_0322093 3300046511 Unclassified 955
325 Ga0495618_0027011 3300046514 Bacteria 3573
326 Ga0495628_0041585 3300046516 Bacteria 3669
327 Ga0495628_0637852 3300046516 Unclassified 757
328 Ga0495630_0102178 3300046517 Bacteria 2168
329 Ga0495630_0458845 3300046517 Bacteria 976
330 Ga0495652_0019657 3300046529 Bacteria 6013
331 Ga0495652_0547216 3300046529 Bacteria 796
332 Ga0495665_0461231 3300046531 Unclassified 642
333 Ga0495640_0024978 3300046533 Bacteria 4341
334 Ga0495586_0138135 3300046535 Bacteria 1367
335 Ga0495587_0097285 3300046536 Bacteria 1697
336 Ga0495587_0113887 3300046536 Bacteria 1552
337 Ga0495587_0119700 3300046536 Bacteria 1508
338 Ga0495645_0008909 3300046543 Bacteria 7009
339 Ga0495645_0075955 3300046543 Bacteria 2418
340 Ga0495645_0075992 3300046543 Bacteria 2418
341 Ga0495645_0114247 3300046543 Bacteria 1908
342 Ga0495667_0129860 3300046559 Bacteria 1626
343 Ga0495667_0166411 3300046559 Bacteria 1417
344 Ga0495634_0013101 3300046642 Bacteria 5995
345 Ga0495635_0078281 3300046663 Bacteria 2263
346 Ga0495635_0136430 3300046663 Bacteria 1672
347 Ga0495635_0192826 3300046663 Bacteria 1383
348 Ga0495657_0275182 3300046675 Bacteria 1009
349 Ga0495599_0077633 3300046678 Bacteria 2073
350 Ga0495599_0090457 3300046678 Bacteria 1910
351 Ga0495599_0143128 3300046678 Bacteria 1483
352 Ga0495599_0406349 3300046678 Bacteria 810
353 Ga0495623_0068000 3300046679 Bacteria 2222
354 Ga0495623_0298551 3300046679 Unclassified 891
355 Ga0495613_0025114 3300046689 Bacteria 4440
356 Ga0495613_0123692 3300046689 Bacteria 1856
357 Ga0495613_0305686 3300046689 Bacteria 1100
358 Ga0495604_0033869 3300047317 Bacteria 4043
359 Ga0495604_0074123 3300047317 Bacteria 2566
360 Ga0495604_0214293 3300047317 Unclassified 1329
361 Ga0495674_0006906 3300047319 Bacteria 10859
362 Ga0495674_0089023 3300047319 Bacteria 2639
363 Ga0495674_0304686 3300047319 Unclassified 1301
364 Ga0495674_0892907 3300047319 Unclassified 686
365 Ga0495674_1187778 3300047319 Unclassified 577
366 Ga0495680_0064442 3300047322 Bacteria 2810
367 Ga0495680_0090012 3300047322 Bacteria 2303
368 Ga0495680_0710023 3300047322 Unclassified 663
369 Ga0495675_0009681 3300047444 Bacteria 6007
370 Ga0495675_0217226 3300047444 Bacteria 1158
371 Ga0495684_0007550 3300047471 Bacteria 8417
372 Ga0495684_0051837 3300047471 Bacteria 3131
373 Ga0495684_0562953 3300047471 Bacteria 774
374 Ga0495684_0759511 3300047471 Bacteria 637
375 Ga0495593_0479399 3300047673 Unclassified 623
376 Ga0495602_0017815 3300048088 Bacteria 7112
377 Ga0496112_0650535 3300048915 Bacteria 984
378 Ga0496112_0716915 3300048915 Bacteria 928
379 Ga0495601_0401598 3300053077 Unclassified 889
380 Ga0495601_0842311 3300053077 Bacteria 581
381 Ga0495619_0293573 3300053085 Bacteria 1126
382 Ga0501082_0000380 3300060353 Bacteria 39465
383 Ga0105240_10839297
384 Ga0070683_100000008
385 Ga0070683_100049520
386 Ga0070683_100135467
387 Ga0070683_100427945
388 Ga0070683_101508478
389 Ga0068868_100004598
390 Ga0068868_100011066
391 Ga0070660_100013171
392 Ga0070660_100078982
393 Ga0070689_100080027
394 Ga0070661_100041748
395 Ga0070674_101242897
396 Ga0070673_101560412
397 Ga0070688_100033043
398 Ga0070688_100698778
399 Ga0070667_100068923
400 Ga0070667_100080176
401 Ga0070667_100135659
402 Ga0070667_100375672
403 Ga0070667_100834051
404 Ga0070714_100033603
405 Ga0070713_100001719
406 Ga0070713_100043584
407 Ga0070710_10581303
408 Ga0070711_100008903
409 Ga0070711_100349975
410 Ga0070681_10048578
411 Ga0068867_100462448
412 Ga0070679_100087649
413 Ga0070679_100297729
414 Ga0070684_100000002
415 Ga0070684_100056534
416 Ga0070684_100347880
417 Ga0070684_100425003
418 Ga0068853_100227160
419 Ga0068853_100245192
420 Ga0068853_100781804
421 Ga0070665_100012639
422 Ga0070665_100125316
423 Ga0068855_100027905
424 Ga0068855_100173687
425 Ga0068855_100314853
426 Ga0068857_100039937
427 Ga0068857_100043536
428 Ga0068856_100007183
429 Ga0068856_100467919
430 Ga0068856_100779831
431 Ga0068852_100004418
432 Ga0068852_100143973
433 Ga0068859_100175029
434 Ga0068864_100833243
435 Ga0068866_10049836
436 Ga0068863_100333224
437 Ga0068858_100009986
438 Ga0068858_100063092
439 Ga0068858_100482435
440 Ga0068858_100506195
441 Ga0068858_101359525
442 Ga0068860_100030892
443 Ga0068860_100202921
444 Ga0068860_101219458
445 Ga0070717_10010814
446 Ga0070717_10082537
447 Ga0070712_100513218
448 Ga0097621_100002831
449 Ga0097621_100040582
450 Ga0097621_100050688
451 Ga0097621_100307942
452 Ga0097621_100390941
453 Ga0097621_101067533
454 Ga0068871_100006833
455 Ga0068871_100658157
456 Ga0075434_100641645
457 Ga0068865_100008074
458 Ga0097620_100175041
459 Ga0105240_10000408
460 Ga0105240_10007286
461 Ga0105240_10141822
462 Ga0105240_10285140
463 Ga0105240_10477469
464 Ga0105240_10531660
465 Ga0111539_10293168
466 Ga0105245_10004649
467 Ga0105245_10006539
468 Ga0105245_10030058
469 Ga0105245_10103408
470 Ga0105245_10145639
471 Ga0105245_10174845
472 Ga0105245_10658488
473 Ga0105245_10802044
474 Ga0105247_10064324
475 Ga0114129_10983147
476 Ga0105241_10013883
477 Ga0105241_10037421
478 Ga0105241_10088292
479 Ga0105241_10428754
480 Ga0105241_11260391
481 Ga0105242_10006034
482 Ga0105242_10017600
483 Ga0105242_10103528
484 Ga0105242_10113692
485 Ga0105242_10192398
486 Ga0105242_10431128
487 Ga0105242_10601181
488 Ga0105248_10008614
489 Ga0105248_10081646
490 Ga0105248_10229646
491 Ga0105248_10379462
492 Ga0105237_10029191
493 Ga0105237_10043971
494 Ga0105237_10118111
495 Ga0105237_10182765
496 Ga0105237_10189141
497 Ga0105237_10433605
498 Ga0105237_10558675
499 Ga0105238_10029343
500 Ga0105238_10061156
501 Ga0105238_10092491
502 Ga0105238_10104853
503 Ga0105238_10212122
504 Ga0105238_10273138
505 Ga0105238_10291544
506 Ga0105238_10296633
507 Ga0105238_11075071
508 Ga0105249_11162824
509 Ga0105239_10020605
510 Ga0105239_10051277
511 Ga0105239_10308535
512 Ga0105239_10394063
513 Ga0105246_10251408
514 Ga0157370_10008684
515 Ga0157370_10690007
516 Ga0157369_10049902
517 Ga0157369_10070948
518 Ga0157369_10095148
519 Ga0157369_10163440
520 Ga0157374_10024327
521 Ga0157374_10184586
522 Ga0157378_10010108
523 Ga0157378_10051994
524 Ga0163162_10005937
525 Ga0163162_10008837
526 Ga0163162_10188616
527 Ga0163162_10881603
528 Ga0163162_11059989
529 Ga0157372_10114936
530 Ga0157372_10284775
531 Ga0157372_10307104
532 Ga0157372_10585265
533 Ga0157375_10380791
534 Ga0157375_11173192
535 Ga0157375_11297907
536 Ga0157375_12271936
537 Ga0163163_10096977
538 Ga0163163_10098606
539 Ga0163163_10103191
540 Ga0163163_10282077
541 Ga0163163_10331457
542 Ga0163163_10428392
543 Ga0163163_10474609
544 Ga0157380_10426062
545 Ga0157379_10095588
546 Ga0157379_10118533
547 Ga0157376_10022024
548 Ga0157376_10366792
549 Ga0157376_10803640
550 Ga0207642_10174472
551 Ga0207680_10669741
552 Ga0207699_10363202
553 Ga0207705_10030236
554 Ga0207654_10015987
555 Ga0207654_10192445
556 Ga0207654_10259941
557 Ga0207654_10386417
558 Ga0207707_10237219
559 Ga0207695_10013480
560 Ga0207695_10017855
561 Ga0207695_10039736
562 Ga0207695_10098103
563 Ga0207695_10126496
564 Ga0207695_10820773
565 Ga0207671_10081113
566 Ga0207671_10095660
567 Ga0207671_10305421
568 Ga0207671_10495388
569 Ga0207663_10611932
570 Ga0207660_10469165
571 Ga0207657_10006013
572 Ga0207657_10189618
573 Ga0207649_10050889
574 Ga0207652_10027219
575 Ga0207652_11023940
576 Ga0207694_10014970
577 Ga0207694_10022349
578 Ga0207694_10087004
579 Ga0207694_10093337
580 Ga0207694_10134212
581 Ga0207687_10004718
582 Ga0207687_10005939
583 Ga0207687_10013268
584 Ga0207687_10636893
585 Ga0207700_10004352
586 Ga0207700_10032008
587 Ga0207700_10116060
588 Ga0207664_10037363
589 Ga0207644_10060637
590 Ga0207690_10088205
591 Ga0207686_10006802
592 Ga0207686_10013004
593 Ga0207686_10044243
594 Ga0207686_10082660
595 Ga0207686_10103091
596 Ga0207686_10151148
597 Ga0207670_10034045
598 Ga0207670_10311934
599 Ga0207669_11153269
600 Ga0207704_10004051
601 Ga0207711_10103695
602 Ga0207711_10134618
603 Ga0207711_10202041
604 Ga0207711_10288047
605 Ga0207711_10526374
606 Ga0207661_10000008
607 Ga0207661_10075492
608 Ga0207661_10150377
609 Ga0207661_10252671
610 Ga0207661_10521469
611 Ga0207661_10845327
612 Ga0207661_11078203
613 Ga0207679_10231439
614 Ga0207667_10011557
615 Ga0207667_10115142
616 Ga0207667_10120907
617 Ga0207667_10184764
618 Ga0207667_10527362
619 Ga0207651_10475932
620 Ga0207712_11144119
621 Ga0207658_10034018
622 Ga0207658_10310373
623 Ga0207658_10336862
624 Ga0207677_10003348
625 Ga0207677_10006047
626 Ga0207703_10027559
627 Ga0207703_10381512
628 Ga0207639_10033243
629 Ga0207639_10279035
630 Ga0207639_10590951
631 Ga0207702_10056200
632 Ga0207641_10172333
633 Ga0207641_10213739
634 Ga0207648_10076257
635 Ga0207676_10092887
636 Ga0207674_10006472
637 Ga0207674_10011285
638 Ga0207674_10017423
639 Ga0207683_11265826
640 Ga0207698_10005359
641 Ga0207698_10470229
642 Ga0268266_10035668
643 Ga0268266_10087439
644 Ga0268266_10108375
645 Ga0268264_10403877
646 Ga0268264_11561870
647 Ga0265331_10200362
648 Ga0265316_10007365
649 Ga0265316_10058355
650 Ga0265316_10575121
651 Ga0265314_10019814
652 Ga0265342_10033188
653 Ga0373934_0105889
654 Ga0373954_0119069
655 Ga0373954_0163832
656 Ga0373954_0480006
657 Ga0373943_0459290
658 Ga0373955_0014243
659 Ga0373955_0449143
660 Ga0373924_0150616
661 Ga0373935_1033256
662 Ga0373927_0002753
663 Ga0373927_0085400
664 Ga0373927_0268408
665 Ga0373927_0508544
666 Ga0373933_0475539
667 Ga0373947_0049111
668 Ga0373947_0322261
669 Ga0373937_0090716
670 Ga0373937_0401651
671 Ga0373937_0491587
672 Ga0373937_0549196
673 Ga0373937_0917310
674 Ga0373925_0029324
675 Ga0373925_0171347
676 Ga0373925_0265482
677 Ga0373925_0323970
678 Ga0373925_0328808
679 Ga0373925_0405025
680 Ga0436364_0507365
681 Ga0436363_0721129
682 Ga0439448_0123833
683 Ga0453684_0680296
684 Ga0451576_0084491
685 Ga0451576_0172042
686 Ga0451576_0436627
687 Ga0495592_0057811
688 Ga0495592_0156145
689 Ga0495629_0196053
690 Ga0495651_0026110
691 Ga0495651_0049042
692 Ga0495651_0056814
693 Ga0495653_0268694
694 Ga0495580_0001987
695 Ga0495580_0007010
696 Ga0495580_0101724
697 Ga0495580_0282204
698 Ga0495580_0551527
699 Ga0495582_0118577
700 Ga0495582_0423532
701 Ga0495664_0019141
702 Ga0495664_0050811
703 Ga0495664_0108983
704 Ga0495594_0150125
705 Ga0495608_0024301
706 Ga0495608_0322093
707 Ga0495618_0027011
708 Ga0495628_0041585
709 Ga0495628_0637852
710 Ga0495630_0102178
711 Ga0495630_0458845
712 Ga0495652_0019657
713 Ga0495652_0547216
714 Ga0495665_0461231
715 Ga0495640_0024978
716 Ga0495586_0138135
717 Ga0495587_0097285
718 Ga0495587_0113887
719 Ga0495587_0119700
720 Ga0495645_0008909
721 Ga0495645_0075955
722 Ga0495645_0075992
723 Ga0495645_0114247
724 Ga0495667_0129860
725 Ga0495667_0166411
726 Ga0495634_0013101
727 Ga0495635_0078281
728 Ga0495635_0136430
729 Ga0495635_0192826
730 Ga0495657_0275182
731 Ga0495599_0077633
732 Ga0495599_0090457
733 Ga0495599_0143128
734 Ga0495599_0406349
735 Ga0495623_0068000
736 Ga0495623_0298551
737 Ga0495613_0025114
738 Ga0495613_0123692
739 Ga0495613_0305686
740 Ga0495604_0033869
741 Ga0495604_0074123
742 Ga0495604_0214293
743 Ga0495674_0006906
744 Ga0495674_0089023
745 Ga0495674_0304686
746 Ga0495674_0892907
747 Ga0495674_1187778
748 Ga0495680_0064442
749 Ga0495680_0090012
750 Ga0495680_0710023
751 Ga0495675_0009681
752 Ga0495675_0217226
753 Ga0495684_0007550
754 Ga0495684_0051837
755 Ga0495684_0562953
756 Ga0495684_0759511
757 Ga0495593_0479399
758 Ga0495602_0017815
759 Ga0496112_0650535
760 Ga0496112_0716915
761 Ga0495601_0401598
762 Ga0495601_0842311
763 Ga0495619_0293573
764 Ga0501082_0000380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

32

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.9225 23 168
2i6d-assembly1.cif.gz_A the structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis. 0.8967 23 169
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.8961 21 167
1ipa-assembly1.cif.gz_A crystal structure of rna 2'-o ribose methyltransferase 0.8952 24 170
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8925 21 169
ID Description Score Start End Superfamily
af_Q557D9_138_303_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9369 23 139 3.40.1280.10
af_Q54XF8_1505_1680_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9205 20 178 3.40.1280.10
5l0zB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9202 23 168 3.40.1280.10
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9193 21 169 3.40.1280.10
af_A0A0G2JYA7_1418_1569_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9136 24 170 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A7V5YT47-F1-model_v4 TrmH family RNA methyltransferase 0.9818 20 176 GO:0000049
GO:0002938
GO:0008173
AF-A0A7S7NNS8-F1-model_v4 RNA methyltransferase 0.9778 20 173 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A2H0C4Z2-F1-model_v4 RNA methyltransferase 0.9776 23 167 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7R8B0H9-F1-model_v4 deleted 0.9761 21 172
AF-A0A554K734-F1-model_v4 tRNA/rRNA methyltransferase SpoU 0.9743 23 170 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Map