F429212

General Info

Members Datasets Scaffolds Average Seq Length
382 202 764 154

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100105822|Ga0070665_1001058222
Length 179
Sequence MSATATPESRVRRAARTVPVVRFTVKGQVRTDDDASPARAPAYGSPARAYTVVYDGACRICQGLVRRLGKWDRRGMLEIVPSQAPGVHARFPWIPTRAYAQSVQLIRRDGHTWQGAAAIEQIIDQLPKGRLVTWVFSIPFVRPLADRFYRWFARNRYRLGCGEHCQFRELDLDFAESGD

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
183 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.4
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 30.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100105822 3300005548 Bacteria 2815
2 JGI25406J46586_10009360 3300003203 Bacteria 4388
3 rootH1_10254968 3300003323 Unclassified 2068
4 Ga0065712_10149074 3300005290 Bacteria 1384
5 Ga0070658_10004994 3300005327 Bacteria 10804
6 Ga0070658_10088054 3300005327 Bacteria 2556
7 Ga0070658_10150505 3300005327 Unclassified 1948
8 Ga0070658_10326988 3300005327 Unclassified 1310
9 Ga0070658_10547067 3300005327 Bacteria 1002
10 Ga0070676_10475983 3300005328 Bacteria 882
11 Ga0070676_10985541 3300005328 Unclassified 632
12 Ga0070683_100001094 3300005329 Bacteria 20423
13 Ga0070683_100004479 3300005329 Bacteria 11524
14 Ga0070683_100006228 3300005329 Bacteria 10007
15 Ga0070683_100009072 3300005329 Bacteria 8488
16 Ga0070683_100014790 3300005329 Bacteria 6838
17 Ga0070683_100026254 3300005329 Bacteria 5241
18 Ga0070683_100035141 3300005329 Bacteria 4581
19 Ga0070683_100747172 3300005329 Bacteria 937
20 Ga0070683_101152677 3300005329 Bacteria 745
21 Ga0070683_101658429 3300005329 Bacteria 615
22 Ga0070670_100002779 3300005331 Bacteria 14467
23 Ga0070670_100352173 3300005331 Unclassified 1294
24 Ga0070670_100505525 3300005331 Bacteria 1075
25 Ga0070677_10232391 3300005333 Unclassified 906
26 Ga0068869_100000961 3300005334 Bacteria 16757
27 Ga0070680_100002054 3300005336 Bacteria 14852
28 Ga0070680_101433540 3300005336 Unclassified 598
29 Ga0070682_100008999 3300005337 Bacteria 5643
30 Ga0070682_100303724 3300005337 Bacteria 1172
31 Ga0070682_100412842 3300005337 Bacteria 1024
32 Ga0068868_100017007 3300005338 Bacteria 5411
33 Ga0070660_100051751 3300005339 Bacteria 3164
34 Ga0070660_100107170 3300005339 Bacteria 2220
35 Ga0070660_100260154 3300005339 Bacteria 1417
36 Ga0070660_100636082 3300005339 Bacteria 893
37 Ga0070689_100021537 3300005340 Bacteria 4801
38 Ga0070689_100036374 3300005340 Bacteria 3766
39 Ga0070689_100162202 3300005340 Unclassified 1807
40 Ga0070691_10037657 3300005341 Unclassified 2283
41 Ga0070687_100091174 3300005343 Bacteria 1686
42 Ga0070661_100001954 3300005344 Bacteria 14265
43 Ga0070661_100053986 3300005344 Bacteria 2943
44 Ga0070661_100395491 3300005344 Unclassified 1092
45 Ga0070661_100475030 3300005344 Bacteria 998
46 Ga0070661_101189296 3300005344 Unclassified 637
47 Ga0070692_10009822 3300005345 Bacteria 4333
48 Ga0070668_100155108 3300005347 Unclassified 1854
49 Ga0070675_100010014 3300005354 Bacteria 7393
50 Ga0070671_100231221 3300005355 Bacteria 1569
51 Ga0070674_100489755 3300005356 Unclassified 1022
52 Ga0070673_100017604 3300005364 Bacteria 5087
53 Ga0070673_100110371 3300005364 Bacteria 2280
54 Ga0070688_100317235 3300005365 Unclassified 1131
55 Ga0070659_100010689 3300005366 Bacteria 6762
56 Ga0070659_100031452 3300005366 Bacteria 4110
57 Ga0070659_100085822 3300005366 Bacteria 2518
58 Ga0070659_100310974 3300005366 Unclassified 1316
59 Ga0070667_100021468 3300005367 Bacteria 5360
60 Ga0070709_10002570 3300005434 Bacteria 9821
61 Ga0070709_10004592 3300005434 Bacteria 7458
62 Ga0070709_10257721 3300005434 Bacteria 1259
63 Ga0070714_100003742 3300005435 Bacteria 11407
64 Ga0070714_100059294 3300005435 Unclassified 3282
65 Ga0070714_100405818 3300005435 Bacteria 1289
66 Ga0070713_100008335 3300005436 Bacteria 7351
67 Ga0070713_100540368 3300005436 Unclassified 1103
68 Ga0070710_10126022 3300005437 Bacteria 1556
69 Ga0070711_100291307 3300005439 Bacteria 1295
70 Ga0070705_100291925 3300005440 Unclassified 1164
71 Ga0070663_100024860 3300005455 Unclassified 4037
72 Ga0070678_100175777 3300005456 Bacteria 1748
73 Ga0070678_100477969 3300005456 Bacteria 1096
74 Ga0070662_100003924 3300005457 Bacteria 9329
75 Ga0070662_100363777 3300005457 Unclassified 1187
76 Ga0070681_10003042 3300005458 Bacteria 15549
77 Ga0070681_10005879 3300005458 Bacteria 11880
78 Ga0070681_10013073 3300005458 Bacteria 8244
79 Ga0070681_10216682 3300005458 Unclassified 1830
80 Ga0068867_101042701 3300005459 Unclassified 744
81 Ga0070679_100011044 3300005530 Bacteria 8589
82 Ga0070679_100181188 3300005530 Bacteria 2079
83 Ga0070679_100221522 3300005530 Unclassified 1853
84 Ga0070679_100892937 3300005530 Bacteria 832
85 Ga0070684_100009753 3300005535 Bacteria 7580
86 Ga0070684_100012725 3300005535 Bacteria 6754
87 Ga0070684_100014339 3300005535 Bacteria 6416
88 Ga0070684_100019599 3300005535 Bacteria 5598
89 Ga0070684_100157580 3300005535 Bacteria 2059
90 Ga0070684_100522984 3300005535 Bacteria 1100
91 Ga0070684_100555737 3300005535 Bacteria 1065
92 Ga0070684_101164451 3300005535 Unclassified 725
93 Ga0068853_100078530 3300005539 Bacteria 2885
94 Ga0068853_100137781 3300005539 Bacteria 2189
95 Ga0070672_100162886 3300005543 Unclassified 1852
96 Ga0070672_100263427 3300005543 Bacteria 1454
97 Ga0070686_100161731 3300005544 Unclassified 1577
98 Ga0070695_100014834 3300005545 Bacteria 4701
99 Ga0070695_100642993 3300005545 Unclassified 837
100 Ga0070693_100002135 3300005547 Bacteria 9061
101 Ga0070693_100672953 3300005547 Bacteria 755
102 Ga0068855_100010378 3300005563 Bacteria 11236
103 Ga0068855_100021618 3300005563 Bacteria 7717
104 Ga0068855_100084105 3300005563 Bacteria 3685
105 Ga0068855_101405520 3300005563 Bacteria 719
106 Ga0070664_100002709 3300005564 Bacteria 14299
107 Ga0070664_100003304 3300005564 Bacteria 13026
108 Ga0070664_100011465 3300005564 Bacteria 7194
109 Ga0070664_100114651 3300005564 Bacteria 2355
110 Ga0070664_100163083 3300005564 Unclassified 1973
111 Ga0070664_100193097 3300005564 Bacteria 1814
112 Ga0070664_100564931 3300005564 Bacteria 1053
113 Ga0070664_100734094 3300005564 Unclassified 921
114 Ga0068857_100016685 3300005577 Bacteria 6434
115 Ga0068854_100852036 3300005578 Unclassified 798
116 Ga0068856_100373780 3300005614 Bacteria 1444
117 Ga0068856_101659847 3300005614 Unclassified 652
118 Ga0070702_100004395 3300005615 Bacteria 6431
119 Ga0068852_100068471 3300005616 Bacteria 3107
120 Ga0068852_100465329 3300005616 Unclassified 1254
121 Ga0068852_100573336 3300005616 Unclassified 1131
122 Ga0068852_100728610 3300005616 Bacteria 1003
123 Ga0068859_100006580 3300005617 Bacteria 11793
124 Ga0068859_100365874 3300005617 Unclassified 1537
125 Ga0068864_100003631 3300005618 Bacteria 12755
126 Ga0068864_100133979 3300005618 Bacteria 2229
127 Ga0068866_10088443 3300005718 Bacteria 1681
128 Ga0068870_10079582 3300005840 Bacteria 1808
129 Ga0068863_100017571 3300005841 Bacteria 6852
130 Ga0068863_100130108 3300005841 Bacteria 2403
131 Ga0068863_100622977 3300005841 Unclassified 1069
132 Ga0068858_100102820 3300005842 Bacteria 2665
133 Ga0068858_100365492 3300005842 Unclassified 1383
134 Ga0068860_100014539 3300005843 Bacteria 7702
135 Ga0068860_100093179 3300005843 Bacteria 2871
136 Ga0081539_10000087 3300005985 Bacteria 214031
137 Ga0070716_100673604 3300006173 Bacteria 787
138 Ga0070712_100041070 3300006175 Unclassified 3174
139 Ga0097621_100057113 3300006237 Bacteria 3190
140 Ga0068871_100005316 3300006358 Bacteria 9020
141 Ga0075428_100026675 3300006844 Bacteria 6397
142 Ga0075428_100462645 3300006844 Unclassified 1358
143 Ga0075430_100032588 3300006846 Bacteria 4423
144 Ga0075430_100776342 3300006846 Unclassified 790
145 Ga0075431_100007737 3300006847 Bacteria 10707
146 Ga0075431_100028919 3300006847 Bacteria 5699
147 Ga0075431_100155933 3300006847 Unclassified 2349
148 Ga0068865_100028407 3300006881 Bacteria 3702
149 Ga0075436_100223255 3300006914 Bacteria 1337
150 Ga0097620_100006581 3300006931 Bacteria 11793
151 Ga0097620_100365897 3300006931 Unclassified 1537
152 Ga0105240_10183371 3300009093 Unclassified 2468
153 Ga0105245_10006381 3300009098 Bacteria 10374
154 Ga0105247_10222283 3300009101 Unclassified 1279
155 Ga0105247_10494581 3300009101 Unclassified 890
156 Ga0114129_11565976 3300009147 Unclassified 808
157 Ga0105243_10027804 3300009148 Bacteria 4337
158 Ga0105241_10053231 3300009174 Bacteria 3094
159 Ga0105241_10103228 3300009174 Bacteria 2270
160 Ga0105241_10109949 3300009174 Unclassified 2205
161 Ga0105241_10774696 3300009174 Unclassified 882
162 Ga0105242_10020687 3300009176 Bacteria 5162
163 Ga0105242_10253239 3300009176 Unclassified 1587
164 Ga0105248_10007987 3300009177 Bacteria 11621
165 Ga0105248_10185113 3300009177 Bacteria 2347
166 Ga0105237_10124913 3300009545 Bacteria 2568
167 Ga0105237_10193723 3300009545 Bacteria 2032
168 Ga0105237_10743465 3300009545 Unclassified 987
169 Ga0105238_10212605 3300009551 Bacteria 1910
170 Ga0105239_10033425 3300010375 Bacteria 5648
171 Ga0105239_11014717 3300010375 Bacteria 954
172 Ga0105239_12516712 3300010375 Unclassified 600
173 Ga0105246_10001693 3300011119 Bacteria 13148
174 Ga0105246_10553814 3300011119 Bacteria 986
175 Ga0157373_10010260 3300013100 Bacteria 6901
176 Ga0157373_10086850 3300013100 Bacteria 2204
177 Ga0157373_10196764 3300013100 Bacteria 1421
178 Ga0157371_10005881 3300013102 Bacteria 10245
179 Ga0157371_10021861 3300013102 Bacteria 4694
180 Ga0157371_10239524 3300013102 Unclassified 1305
181 Ga0157371_10402315 3300013102 Unclassified 1002
182 Ga0157370_10025405 3300013104 Bacteria 5862
183 Ga0157370_10165992 3300013104 Bacteria 2053
184 Ga0157369_10038341 3300013105 Bacteria 5241
185 Ga0157369_10111580 3300013105 Bacteria 2906
186 Ga0157369_10180364 3300013105 Bacteria 2222
187 Ga0157369_10181404 3300013105 Bacteria 2215
188 Ga0157369_10868617 3300013105 Unclassified 926
189 Ga0157369_10896245 3300013105 Unclassified 910
190 Ga0157374_10024877 3300013296 Bacteria 5371
191 Ga0157374_11053652 3300013296 Unclassified 833
192 Ga0163162_10117929 3300013306 Unclassified 2756
193 Ga0157372_10002831 3300013307 Bacteria 18748
194 Ga0157372_10006293 3300013307 Bacteria 12624
195 Ga0157372_10010062 3300013307 Bacteria 10055
196 Ga0157372_10015503 3300013307 Bacteria 8171
197 Ga0157372_10061666 3300013307 Bacteria 4200
198 Ga0157372_10272852 3300013307 Bacteria 1966
199 Ga0157372_10712010 3300013307 Unclassified 1168
200 Ga0157372_10835339 3300013307 Unclassified 1070
201 Ga0157372_10983180 3300013307 Bacteria 978
202 Ga0157375_10793535 3300013308 Bacteria 1096
203 Ga0163163_10010997 3300014325 Bacteria 8183
204 Ga0163163_10220143 3300014325 Bacteria 1947
205 Ga0163163_10732170 3300014325 Bacteria 1052
206 Ga0157377_10004405 3300014745 Bacteria 6478
207 Ga0157377_10025799 3300014745 Bacteria 3138
208 Ga0157379_11991561 3300014968 Bacteria 574
209 Ga0157376_10019383 3300014969 Bacteria 5243
210 Ga0157376_10503869 3300014969 Unclassified 1190
211 Ga0182007_10381953 3300015262 Unclassified 534
212 Ga0206352_11050760 3300020078 Unclassified 1278
213 Ga0213876_10119166 3300021384 Unclassified 1401
214 Ga0207647_10387167 3300025904 Bacteria 789
215 Ga0207699_10648052 3300025906 Bacteria 771
216 Ga0207699_10720882 3300025906 Bacteria 731
217 Ga0207645_10217459 3300025907 Unclassified 1259
218 Ga0207645_10225274 3300025907 Unclassified 1236
219 Ga0207643_10085132 3300025908 Unclassified 1836
220 Ga0207705_10005008 3300025909 Bacteria 9941
221 Ga0207705_10022134 3300025909 Bacteria 4534
222 Ga0207705_10202279 3300025909 Bacteria 1505
223 Ga0207705_10274376 3300025909 Unclassified 1290
224 Ga0207705_10528873 3300025909 Unclassified 916
225 Ga0207654_10055714 3300025911 Bacteria 2290
226 Ga0207654_10216378 3300025911 Unclassified 1268
227 Ga0207654_10444291 3300025911 Bacteria 908
228 Ga0207707_10006972 3300025912 Bacteria 9855
229 Ga0207707_10007893 3300025912 Bacteria 9254
230 Ga0207695_10013098 3300025913 Bacteria 9900
231 Ga0207693_10026945 3300025915 Unclassified 4546
232 Ga0207693_10097554 3300025915 Bacteria 2304
233 Ga0207660_10007169 3300025917 Bacteria 7217
234 Ga0207662_10015739 3300025918 Bacteria 4259
235 Ga0207657_10022095 3300025919 Bacteria 5970
236 Ga0207657_10033970 3300025919 Bacteria 4592
237 Ga0207657_10902024 3300025919 Bacteria 681
238 Ga0207649_10027028 3300025920 Bacteria 3363
239 Ga0207649_10052676 3300025920 Bacteria 2525
240 Ga0207652_10002505 3300025921 Bacteria 15440
241 Ga0207652_10113174 3300025921 Bacteria 2409
242 Ga0207652_10239162 3300025921 Unclassified 1637
243 Ga0207652_10486872 3300025921 Unclassified 1111
244 Ga0207652_10751701 3300025921 Unclassified 868
245 Ga0207650_10011324 3300025925 Bacteria 6137
246 Ga0207659_10009282 3300025926 Bacteria 6141
247 Ga0207687_10004553 3300025927 Bacteria 9225
248 Ga0207700_10447011 3300025928 Unclassified 1139
249 Ga0207700_10504718 3300025928 Bacteria 1071
250 Ga0207700_10563198 3300025928 Bacteria 1012
251 Ga0207664_10033067 3300025929 Bacteria 3970
252 Ga0207644_10051924 3300025931 Bacteria 2945
253 Ga0207690_10012093 3300025932 Bacteria 5161
254 Ga0207690_10023328 3300025932 Bacteria 3860
255 Ga0207690_10467946 3300025932 Bacteria 1015
256 Ga0207706_10008000 3300025933 Bacteria 9759
257 Ga0207706_10227497 3300025933 Unclassified 1632
258 Ga0207706_10656241 3300025933 Bacteria 898
259 Ga0207709_10612197 3300025935 Unclassified 863
260 Ga0207669_10420043 3300025937 Unclassified 1052
261 Ga0207704_10066680 3300025938 Unclassified 2260
262 Ga0207691_10018713 3300025940 Bacteria 6561
263 Ga0207691_10026234 3300025940 Bacteria 5468
264 Ga0207691_10080799 3300025940 Unclassified 2923
265 Ga0207689_10003210 3300025942 Bacteria 14973
266 Ga0207661_10002375 3300025944 Bacteria 12953
267 Ga0207661_10013267 3300025944 Bacteria 6016
268 Ga0207661_10014888 3300025944 Bacteria 5707
269 Ga0207661_10047137 3300025944 Unclassified 3420
270 Ga0207661_10055560 3300025944 Bacteria 3176
271 Ga0207661_10064535 3300025944 Unclassified 2969
272 Ga0207661_10370695 3300025944 Bacteria 1294
273 Ga0207661_10492442 3300025944 Bacteria 1120
274 Ga0207661_11638329 3300025944 Bacteria 588
275 Ga0207679_10000922 3300025945 Bacteria 18751
276 Ga0207679_10002506 3300025945 Bacteria 11307
277 Ga0207679_10142222 3300025945 Bacteria 1941
278 Ga0207679_10351240 3300025945 Unclassified 1285
279 Ga0207679_11632714 3300025945 Unclassified 590
280 Ga0207667_10019566 3300025949 Bacteria 7553
281 Ga0207667_10055954 3300025949 Bacteria 4146
282 Ga0207667_10098557 3300025949 Bacteria 3016
283 Ga0207667_11393272 3300025949 Bacteria 675
284 Ga0207651_10022896 3300025960 Unclassified 3832
285 Ga0207668_10226224 3300025972 Bacteria 1505
286 Ga0207640_10247487 3300025981 Bacteria 1381
287 Ga0207658_10176230 3300025986 Unclassified 1766
288 Ga0207703_10100159 3300026035 Bacteria 2454
289 Ga0207703_10909422 3300026035 Unclassified 843
290 Ga0207639_10170266 3300026041 Bacteria 1844
291 Ga0207678_10062377 3300026067 Bacteria 3204
292 Ga0207702_10010138 3300026078 Bacteria 7890
293 Ga0207702_11101299 3300026078 Bacteria 788
294 Ga0207641_10007171 3300026088 Bacteria 9298
295 Ga0207648_10031036 3300026089 Bacteria 4727
296 Ga0207676_10001423 3300026095 Bacteria 17788
297 Ga0207676_11194436 3300026095 Bacteria 754
298 Ga0207674_10000285 3300026116 Bacteria 64094
299 Ga0207674_10004051 3300026116 Bacteria 17774
300 Ga0207674_10069664 3300026116 Bacteria 3537
301 Ga0207683_11298082 3300026121 Unclassified 674
302 Ga0207698_10009251 3300026142 Bacteria 6270
303 Ga0207698_10349673 3300026142 Unclassified 1396
304 Ga0207698_10405876 3300026142 Bacteria 1303
305 Ga0268264_10042732 3300028381 Bacteria 3752
306 Ga0268264_11155647 3300028381 Unclassified 783
307 Ga0307413_10224926 3300031824 Unclassified 1373
308 Ga0307407_10362836 3300031903 Bacteria 1029
309 Ga0307409_100167046 3300031995 Bacteria 1932
310 Ga0307416_100584096 3300032002 Bacteria 1195
311 Ga0373930_0040466 3300034816 Unclassified 991
312 Ga0373952_0069855 3300035092 Unclassified 876
313 Ga0373931_0001173 3300035691 Bacteria 11170
314 Ga0373931_0010569 3300035691 Bacteria 4438
315 Ga0373947_0131117 3300035725 Bacteria 1600
316 Ga0373937_0114964 3300036401 Unclassified 2505
317 Ga0436364_1376169 3300037853 Bacteria 1517
318 Ga0436365_0445679 3300039437 Bacteria 5183
319 Ga0436365_1032368 3300039437 Unclassified 2037
320 Ga0466966_0020849 3300044684 Bacteria 4309
321 Ga0466957_0508638 3300044842 Bacteria 836
322 Ga0451576_0702160 3300045051 Bacteria 1063
323 Ga0466958_0297424 3300045836 Bacteria 1036
324 Ga0466967_0059278 3300045976 Bacteria 3388
325 Ga0466967_0062327 3300045976 Unclassified 3310
326 Ga0495629_0003842 3300046459 Bacteria 11332
327 Ga0495582_0025148 3300046473 Bacteria 3261
328 Ga0495664_0109596 3300046477 Unclassified 1666
329 Ga0495628_0319554 3300046516 Unclassified 1146
330 Ga0495663_0090827 3300046525 Bacteria 995
331 Ga0495587_0187079 3300046536 Bacteria 1173
332 Ga0495621_0173001 3300046539 Bacteria 859
333 Ga0495645_0123561 3300046543 Bacteria 1820
334 Ga0495667_0316963 3300046559 Bacteria 987
335 Ga0495623_0469576 3300046679 Unclassified 667
336 Ga0495658_0259447 3300046683 Bacteria 1094
337 Ga0495613_0104588 3300046689 Bacteria 2044
338 Ga0495581_0061131 3300047315 Bacteria 2177
339 Ga0495581_0429088 3300047315 Bacteria 770
340 Ga0495604_0086774 3300047317 Bacteria 2332
341 Ga0496100_0508592 3300048903 Unclassified 929
342 Ga0496101_0149255 3300048904 Bacteria 1787
343 Ga0496106_0279196 3300048909 Unclassified 1338
344 Ga0496108_0043054 3300048911 Bacteria 3771
345 Ga0496108_0567515 3300048911 Unclassified 989
346 Ga0496109_0019509 3300048912 Bacteria 5983
347 Ga0496109_0236415 3300048912 Bacteria 1719
348 Ga0496112_0006346 3300048915 Bacteria 10376
349 Ga0496112_0982053 3300048915 Bacteria 765
350 Ga0496112_1589818 3300048915 Bacteria 567
351 Ga0496113_0004082 3300048916 Bacteria 8895
352 Ga0496114_0166902 3300048917 Bacteria 1917
353 Ga0496115_0324488 3300048918 Bacteria 1259
354 Ga0501291_108029 3300049514 Bacteria 589
355 Ga0501296_076537 3300049519 Unclassified 525
356 Ga0501031_0198292 3300049568 Unclassified 1310
357 Ga0501033_0429667 3300049570 Unclassified 919
358 Ga0501040_0005958 3300049576 Bacteria 7885
359 Ga0501041_0088055 3300049577 Bacteria 1916
360 Ga0501041_0108206 3300049577 Unclassified 1724
361 Ga0501043_0321914 3300049579 Unclassified 1179
362 Ga0501046_0066360 3300049580 Unclassified 2813
363 Ga0501048_0147643 3300049582 Archaea 1663
364 Ga0501048_0218308 3300049582 Unclassified 1352
365 Ga0501075_0169818 3300049591 Unclassified 1664
366 Ga0501076_0113644 3300049592 Unclassified 2190
367 Ga0501079_0012682 3300049741 Bacteria 6438
368 Ga0501079_0371442 3300049741 Unclassified 1121
369 Ga0501081_0315959 3300049743 Unclassified 1147
370 Ga0501045_0005308 3300049824 Bacteria 8929
371 nmdc:mga09592_112006_c1 3300050508 Bacteria 2341
372 nmdc:mga09592_412468_c1 3300050508 Unclassified 1167
373 nmdc:mga0qj67_421008_c1 3300050509 Bacteria 1077
374 nmdc:mga06r32_111835_c1 3300050510 Bacteria 2688
375 nmdc:mga06r32_467654_c1 3300050510 Bacteria 1240
376 nmdc:mga06r32_58996_c1 3300050510 Unclassified 3689
377 nmdc:mga08x19_209806_c1 3300050514 Bacteria 1337
378 Ga0495601_0262909 3300053077 Unclassified 1126
379 Ga0501084_0087119 3300054114 Unclassified 2622
380 Ga0501084_0097699 3300054114 Unclassified 2466
381 Ga0501082_0046367 3300060353 Bacteria 3747
382 Ga0501082_1836165 3300060353 Unclassified 529
383 Ga0070665_100105822
384 JGI25406J46586_10009360
385 rootH1_10254968
386 Ga0065712_10149074
387 Ga0070658_10004994
388 Ga0070658_10088054
389 Ga0070658_10150505
390 Ga0070658_10326988
391 Ga0070658_10547067
392 Ga0070676_10475983
393 Ga0070676_10985541
394 Ga0070683_100001094
395 Ga0070683_100004479
396 Ga0070683_100006228
397 Ga0070683_100009072
398 Ga0070683_100014790
399 Ga0070683_100026254
400 Ga0070683_100035141
401 Ga0070683_100747172
402 Ga0070683_101152677
403 Ga0070683_101658429
404 Ga0070670_100002779
405 Ga0070670_100352173
406 Ga0070670_100505525
407 Ga0070677_10232391
408 Ga0068869_100000961
409 Ga0070680_100002054
410 Ga0070680_101433540
411 Ga0070682_100008999
412 Ga0070682_100303724
413 Ga0070682_100412842
414 Ga0068868_100017007
415 Ga0070660_100051751
416 Ga0070660_100107170
417 Ga0070660_100260154
418 Ga0070660_100636082
419 Ga0070689_100021537
420 Ga0070689_100036374
421 Ga0070689_100162202
422 Ga0070691_10037657
423 Ga0070687_100091174
424 Ga0070661_100001954
425 Ga0070661_100053986
426 Ga0070661_100395491
427 Ga0070661_100475030
428 Ga0070661_101189296
429 Ga0070692_10009822
430 Ga0070668_100155108
431 Ga0070675_100010014
432 Ga0070671_100231221
433 Ga0070674_100489755
434 Ga0070673_100017604
435 Ga0070673_100110371
436 Ga0070688_100317235
437 Ga0070659_100010689
438 Ga0070659_100031452
439 Ga0070659_100085822
440 Ga0070659_100310974
441 Ga0070667_100021468
442 Ga0070709_10002570
443 Ga0070709_10004592
444 Ga0070709_10257721
445 Ga0070714_100003742
446 Ga0070714_100059294
447 Ga0070714_100405818
448 Ga0070713_100008335
449 Ga0070713_100540368
450 Ga0070710_10126022
451 Ga0070711_100291307
452 Ga0070705_100291925
453 Ga0070663_100024860
454 Ga0070678_100175777
455 Ga0070678_100477969
456 Ga0070662_100003924
457 Ga0070662_100363777
458 Ga0070681_10003042
459 Ga0070681_10005879
460 Ga0070681_10013073
461 Ga0070681_10216682
462 Ga0068867_101042701
463 Ga0070679_100011044
464 Ga0070679_100181188
465 Ga0070679_100221522
466 Ga0070679_100892937
467 Ga0070684_100009753
468 Ga0070684_100012725
469 Ga0070684_100014339
470 Ga0070684_100019599
471 Ga0070684_100157580
472 Ga0070684_100522984
473 Ga0070684_100555737
474 Ga0070684_101164451
475 Ga0068853_100078530
476 Ga0068853_100137781
477 Ga0070672_100162886
478 Ga0070672_100263427
479 Ga0070686_100161731
480 Ga0070695_100014834
481 Ga0070695_100642993
482 Ga0070693_100002135
483 Ga0070693_100672953
484 Ga0068855_100010378
485 Ga0068855_100021618
486 Ga0068855_100084105
487 Ga0068855_101405520
488 Ga0070664_100002709
489 Ga0070664_100003304
490 Ga0070664_100011465
491 Ga0070664_100114651
492 Ga0070664_100163083
493 Ga0070664_100193097
494 Ga0070664_100564931
495 Ga0070664_100734094
496 Ga0068857_100016685
497 Ga0068854_100852036
498 Ga0068856_100373780
499 Ga0068856_101659847
500 Ga0070702_100004395
501 Ga0068852_100068471
502 Ga0068852_100465329
503 Ga0068852_100573336
504 Ga0068852_100728610
505 Ga0068859_100006580
506 Ga0068859_100365874
507 Ga0068864_100003631
508 Ga0068864_100133979
509 Ga0068866_10088443
510 Ga0068870_10079582
511 Ga0068863_100017571
512 Ga0068863_100130108
513 Ga0068863_100622977
514 Ga0068858_100102820
515 Ga0068858_100365492
516 Ga0068860_100014539
517 Ga0068860_100093179
518 Ga0081539_10000087
519 Ga0070716_100673604
520 Ga0070712_100041070
521 Ga0097621_100057113
522 Ga0068871_100005316
523 Ga0075428_100026675
524 Ga0075428_100462645
525 Ga0075430_100032588
526 Ga0075430_100776342
527 Ga0075431_100007737
528 Ga0075431_100028919
529 Ga0075431_100155933
530 Ga0068865_100028407
531 Ga0075436_100223255
532 Ga0097620_100006581
533 Ga0097620_100365897
534 Ga0105240_10183371
535 Ga0105245_10006381
536 Ga0105247_10222283
537 Ga0105247_10494581
538 Ga0114129_11565976
539 Ga0105243_10027804
540 Ga0105241_10053231
541 Ga0105241_10103228
542 Ga0105241_10109949
543 Ga0105241_10774696
544 Ga0105242_10020687
545 Ga0105242_10253239
546 Ga0105248_10007987
547 Ga0105248_10185113
548 Ga0105237_10124913
549 Ga0105237_10193723
550 Ga0105237_10743465
551 Ga0105238_10212605
552 Ga0105239_10033425
553 Ga0105239_11014717
554 Ga0105239_12516712
555 Ga0105246_10001693
556 Ga0105246_10553814
557 Ga0157373_10010260
558 Ga0157373_10086850
559 Ga0157373_10196764
560 Ga0157371_10005881
561 Ga0157371_10021861
562 Ga0157371_10239524
563 Ga0157371_10402315
564 Ga0157370_10025405
565 Ga0157370_10165992
566 Ga0157369_10038341
567 Ga0157369_10111580
568 Ga0157369_10180364
569 Ga0157369_10181404
570 Ga0157369_10868617
571 Ga0157369_10896245
572 Ga0157374_10024877
573 Ga0157374_11053652
574 Ga0163162_10117929
575 Ga0157372_10002831
576 Ga0157372_10006293
577 Ga0157372_10010062
578 Ga0157372_10015503
579 Ga0157372_10061666
580 Ga0157372_10272852
581 Ga0157372_10712010
582 Ga0157372_10835339
583 Ga0157372_10983180
584 Ga0157375_10793535
585 Ga0163163_10010997
586 Ga0163163_10220143
587 Ga0163163_10732170
588 Ga0157377_10004405
589 Ga0157377_10025799
590 Ga0157379_11991561
591 Ga0157376_10019383
592 Ga0157376_10503869
593 Ga0182007_10381953
594 Ga0206352_11050760
595 Ga0213876_10119166
596 Ga0207647_10387167
597 Ga0207699_10648052
598 Ga0207699_10720882
599 Ga0207645_10217459
600 Ga0207645_10225274
601 Ga0207643_10085132
602 Ga0207705_10005008
603 Ga0207705_10022134
604 Ga0207705_10202279
605 Ga0207705_10274376
606 Ga0207705_10528873
607 Ga0207654_10055714
608 Ga0207654_10216378
609 Ga0207654_10444291
610 Ga0207707_10006972
611 Ga0207707_10007893
612 Ga0207695_10013098
613 Ga0207693_10026945
614 Ga0207693_10097554
615 Ga0207660_10007169
616 Ga0207662_10015739
617 Ga0207657_10022095
618 Ga0207657_10033970
619 Ga0207657_10902024
620 Ga0207649_10027028
621 Ga0207649_10052676
622 Ga0207652_10002505
623 Ga0207652_10113174
624 Ga0207652_10239162
625 Ga0207652_10486872
626 Ga0207652_10751701
627 Ga0207650_10011324
628 Ga0207659_10009282
629 Ga0207687_10004553
630 Ga0207700_10447011
631 Ga0207700_10504718
632 Ga0207700_10563198
633 Ga0207664_10033067
634 Ga0207644_10051924
635 Ga0207690_10012093
636 Ga0207690_10023328
637 Ga0207690_10467946
638 Ga0207706_10008000
639 Ga0207706_10227497
640 Ga0207706_10656241
641 Ga0207709_10612197
642 Ga0207669_10420043
643 Ga0207704_10066680
644 Ga0207691_10018713
645 Ga0207691_10026234
646 Ga0207691_10080799
647 Ga0207689_10003210
648 Ga0207661_10002375
649 Ga0207661_10013267
650 Ga0207661_10014888
651 Ga0207661_10047137
652 Ga0207661_10055560
653 Ga0207661_10064535
654 Ga0207661_10370695
655 Ga0207661_10492442
656 Ga0207661_11638329
657 Ga0207679_10000922
658 Ga0207679_10002506
659 Ga0207679_10142222
660 Ga0207679_10351240
661 Ga0207679_11632714
662 Ga0207667_10019566
663 Ga0207667_10055954
664 Ga0207667_10098557
665 Ga0207667_11393272
666 Ga0207651_10022896
667 Ga0207668_10226224
668 Ga0207640_10247487
669 Ga0207658_10176230
670 Ga0207703_10100159
671 Ga0207703_10909422
672 Ga0207639_10170266
673 Ga0207678_10062377
674 Ga0207702_10010138
675 Ga0207702_11101299
676 Ga0207641_10007171
677 Ga0207648_10031036
678 Ga0207676_10001423
679 Ga0207676_11194436
680 Ga0207674_10000285
681 Ga0207674_10004051
682 Ga0207674_10069664
683 Ga0207683_11298082
684 Ga0207698_10009251
685 Ga0207698_10349673
686 Ga0207698_10405876
687 Ga0268264_10042732
688 Ga0268264_11155647
689 Ga0307413_10224926
690 Ga0307407_10362836
691 Ga0307409_100167046
692 Ga0307416_100584096
693 Ga0373930_0040466
694 Ga0373952_0069855
695 Ga0373931_0001173
696 Ga0373931_0010569
697 Ga0373947_0131117
698 Ga0373937_0114964
699 Ga0436364_1376169
700 Ga0436365_0445679
701 Ga0436365_1032368
702 Ga0466966_0020849
703 Ga0466957_0508638
704 Ga0451576_0702160
705 Ga0466958_0297424
706 Ga0466967_0059278
707 Ga0466967_0062327
708 Ga0495629_0003842
709 Ga0495582_0025148
710 Ga0495664_0109596
711 Ga0495628_0319554
712 Ga0495663_0090827
713 Ga0495587_0187079
714 Ga0495621_0173001
715 Ga0495645_0123561
716 Ga0495667_0316963
717 Ga0495623_0469576
718 Ga0495658_0259447
719 Ga0495613_0104588
720 Ga0495581_0061131
721 Ga0495581_0429088
722 Ga0495604_0086774
723 Ga0496100_0508592
724 Ga0496101_0149255
725 Ga0496106_0279196
726 Ga0496108_0043054
727 Ga0496108_0567515
728 Ga0496109_0019509
729 Ga0496109_0236415
730 Ga0496112_0006346
731 Ga0496112_0982053
732 Ga0496112_1589818
733 Ga0496113_0004082
734 Ga0496114_0166902
735 Ga0496115_0324488
736 Ga0501291_108029
737 Ga0501296_076537
738 Ga0501031_0198292
739 Ga0501033_0429667
740 Ga0501040_0005958
741 Ga0501041_0088055
742 Ga0501041_0108206
743 Ga0501043_0321914
744 Ga0501046_0066360
745 Ga0501048_0147643
746 Ga0501048_0218308
747 Ga0501075_0169818
748 Ga0501076_0113644
749 Ga0501079_0012682
750 Ga0501079_0371442
751 Ga0501081_0315959
752 Ga0501045_0005308
753 nmdc:mga09592_112006_c1
754 nmdc:mga09592_412468_c1
755 nmdc:mga0qj67_421008_c1
756 nmdc:mga06r32_111835_c1
757 nmdc:mga06r32_467654_c1
758 nmdc:mga06r32_58996_c1
759 nmdc:mga08x19_209806_c1
760 Ga0495601_0262909
761 Ga0501084_0087119
762 Ga0501084_0097699
763 Ga0501082_0046367
764 Ga0501082_1836165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

52

162

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aun-assembly1.cif.gz_A crystal structure, recombinant expression and mutagenesis studies of the bifunctional catalase-phenol oxidase from scytalidium thermophilum 0.6708 28 56
4aun-assembly2.cif.gz_E crystal structure, recombinant expression and mutagenesis studies of the bifunctional catalase-phenol oxidase from scytalidium thermophilum 0.6649 28 56
4b31-assembly1.cif.gz_C probing the active center of catalase-phenol oxidase from scytalidium thermophilum 0.664 28 56
4b5k-assembly1.cif.gz_C probing the active center of catalase-phenol oxidase from scytalidium thermophilum 0.6629 28 56
5xy4-assembly1.cif.gz_D catpo mutant - v536w 0.6619 28 56
ID Description Score Start End Superfamily
af_A0A0P0UZC5_94_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7154 29 124 3.40.30.10
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6987 28 133 3.40.30.10
af_A0A0P0UZC5_94_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6806 29 124 3.40.30.10
af_Q4DYR6_645_690_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.6635 75 90 2.20.110.10
5xy4A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6621 28 56 3.40.50.880
ID Description Score Start End GO Terms
AF-X1CI43-F1-model_v4 Thiol-disulfide oxidoreductase DCC 0.9392 22 102 GO:0015035
AF-A0A7Y2P9C9-F1-model_v4 DUF393 domain-containing protein 0.9388 25 98 GO:0015035
AF-A0A537VKX5-F1-model_v4 DUF393 domain-containing protein 0.9171 24 103 GO:0015035
AF-A0A539ECC7-F1-model_v4 DUF393 domain-containing protein 0.9146 22 102 GO:0015035
AF-A0A7Y2P9C9-F1-model_v4 DUF393 domain-containing protein 0.8826 25 98 GO:0015035

Map