F428735
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 154 | 380 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0971888|Ga0436360_0971888_32_529 |
| Length | 165 |
| Sequence | MKRHIEGLNQTREAGGTSVPDGLFLVRVDRAQYRWHAQKPFYLLRLSVLEPQEFAGRTISGRVYCTSKALWKLGWFLRDFLYDPESLGREEVDEKALTGLRGVVKISHSTVKGNSLLNFDGFAPASQWEELSCTYKRSSGVASCRTALPKLRSTSPAPDVIDIAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 134 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 135 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.05 |
| Rhizosphere | 93.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10029818 | 3300002459 | Unclassified | 1132 |
| 2 | Ga0065712_10093442 | 3300005290 | Unclassified | 2292 |
| 3 | Ga0065712_10572179 | 3300005290 | Unclassified | 606 |
| 4 | Ga0065715_10563036 | 3300005293 | Unclassified | 732 |
| 5 | Ga0070683_100002123 | 3300005329 | Bacteria | 15651 |
| 6 | Ga0070683_100030202 | 3300005329 | Bacteria | 4915 |
| 7 | Ga0070670_100016220 | 3300005331 | Bacteria | 6396 |
| 8 | Ga0070670_100082408 | 3300005331 | Unclassified | 2764 |
| 9 | Ga0070670_100412425 | 3300005331 | Bacteria | 1193 |
| 10 | Ga0070677_10508390 | 3300005333 | Unclassified | 654 |
| 11 | Ga0068869_100000409 | 3300005334 | Bacteria | 23378 |
| 12 | Ga0068869_100002923 | 3300005334 | Bacteria | 10365 |
| 13 | Ga0068869_100189148 | 3300005334 | Bacteria | 1618 |
| 14 | Ga0068869_100215844 | 3300005334 | Bacteria | 1518 |
| 15 | Ga0068869_100763411 | 3300005334 | Unclassified | 829 |
| 16 | Ga0070666_10033227 | 3300005335 | Bacteria | 3412 |
| 17 | Ga0070666_10069427 | 3300005335 | Bacteria | 2396 |
| 18 | Ga0070682_101463440 | 3300005337 | Unclassified | 586 |
| 19 | Ga0068868_100157638 | 3300005338 | Viruses | 1873 |
| 20 | Ga0070660_100062066 | 3300005339 | Unclassified | 2902 |
| 21 | Ga0070660_100633898 | 3300005339 | Bacteria | 895 |
| 22 | Ga0070660_100995331 | 3300005339 | Unclassified | 708 |
| 23 | Ga0070689_100006429 | 3300005340 | Bacteria | 8129 |
| 24 | Ga0070689_100040215 | 3300005340 | Bacteria | 3584 |
| 25 | Ga0070689_100188786 | 3300005340 | Bacteria | 1677 |
| 26 | Ga0070687_100010174 | 3300005343 | Bacteria | 4056 |
| 27 | Ga0070661_100001327 | 3300005344 | Bacteria | 17332 |
| 28 | Ga0070661_100005018 | 3300005344 | Bacteria | 9120 |
| 29 | Ga0070669_100011144 | 3300005353 | Bacteria | 6381 |
| 30 | Ga0070669_100318175 | 3300005353 | Bacteria | 1256 |
| 31 | Ga0070675_100025351 | 3300005354 | Bacteria | 4754 |
| 32 | Ga0070675_100120243 | 3300005354 | Unclassified | 2231 |
| 33 | Ga0070675_100432706 | 3300005354 | Bacteria | 1178 |
| 34 | Ga0070675_100685082 | 3300005354 | Unclassified | 933 |
| 35 | Ga0070671_100007177 | 3300005355 | Bacteria | 8906 |
| 36 | Ga0070671_100017553 | 3300005355 | Bacteria | 5799 |
| 37 | Ga0070671_100277818 | 3300005355 | Bacteria | 1424 |
| 38 | Ga0070671_101029449 | 3300005355 | Unclassified | 722 |
| 39 | Ga0070671_101543199 | 3300005355 | Unclassified | 588 |
| 40 | Ga0070673_100000589 | 3300005364 | Bacteria | 19744 |
| 41 | Ga0070673_100052363 | 3300005364 | Unclassified | 3202 |
| 42 | Ga0070673_101380307 | 3300005364 | Unclassified | 663 |
| 43 | Ga0070688_100002679 | 3300005365 | Bacteria | 9041 |
| 44 | Ga0070659_100223092 | 3300005366 | Bacteria | 1556 |
| 45 | Ga0070659_100689654 | 3300005366 | Unclassified | 882 |
| 46 | Ga0070667_100013226 | 3300005367 | Bacteria | 6819 |
| 47 | Ga0070667_100020313 | 3300005367 | Bacteria | 5513 |
| 48 | Ga0070667_100439257 | 3300005367 | Bacteria | 1191 |
| 49 | Ga0070667_101756514 | 3300005367 | Unclassified | 584 |
| 50 | Ga0070713_101016703 | 3300005436 | Unclassified | 800 |
| 51 | Ga0070713_101924137 | 3300005436 | Bacteria | 574 |
| 52 | Ga0070701_10101954 | 3300005438 | Unclassified | 1591 |
| 53 | Ga0070711_100614880 | 3300005439 | Bacteria | 908 |
| 54 | Ga0070711_101174598 | 3300005439 | Bacteria | 663 |
| 55 | Ga0070711_101825231 | 3300005439 | Unclassified | 534 |
| 56 | Ga0070708_100459365 | 3300005445 | Unclassified | 1201 |
| 57 | Ga0070708_100731770 | 3300005445 | Unclassified | 930 |
| 58 | Ga0070708_101115838 | 3300005445 | Bacteria | 739 |
| 59 | Ga0070663_100001276 | 3300005455 | Bacteria | 13788 |
| 60 | Ga0070663_100006247 | 3300005455 | Bacteria | 7143 |
| 61 | Ga0070663_100104315 | 3300005455 | Bacteria | 2120 |
| 62 | Ga0070663_100106632 | 3300005455 | Bacteria | 2099 |
| 63 | Ga0070678_100039990 | 3300005456 | Unclassified | 3314 |
| 64 | Ga0070678_100082809 | 3300005456 | Unclassified | 2437 |
| 65 | Ga0070678_100137565 | 3300005456 | Unclassified | 1950 |
| 66 | Ga0070678_100534094 | 3300005456 | Bacteria | 1039 |
| 67 | Ga0070678_100826398 | 3300005456 | Unclassified | 843 |
| 68 | Ga0070678_101143584 | 3300005456 | Unclassified | 720 |
| 69 | Ga0070678_101216981 | 3300005456 | Bacteria | 699 |
| 70 | Ga0070678_101527019 | 3300005456 | Bacteria | 626 |
| 71 | Ga0070662_100153755 | 3300005457 | Bacteria | 1794 |
| 72 | Ga0070662_101173372 | 3300005457 | Unclassified | 660 |
| 73 | Ga0070685_10003008 | 3300005466 | Bacteria | 8595 |
| 74 | Ga0070706_101321617 | 3300005467 | Unclassified | 661 |
| 75 | Ga0070706_101377493 | 3300005467 | Unclassified | 646 |
| 76 | Ga0070707_100313841 | 3300005468 | Bacteria | 1524 |
| 77 | Ga0070707_100333620 | 3300005468 | Unclassified | 1473 |
| 78 | Ga0070707_100606167 | 3300005468 | Unclassified | 1057 |
| 79 | Ga0070707_100827794 | 3300005468 | Bacteria | 890 |
| 80 | Ga0070699_100071496 | 3300005518 | Bacteria | 3017 |
| 81 | Ga0070699_100110719 | 3300005518 | Unclassified | 2411 |
| 82 | Ga0070699_100816350 | 3300005518 | Bacteria | 853 |
| 83 | Ga0070684_100000936 | 3300005535 | Bacteria | 20753 |
| 84 | Ga0070684_100011359 | 3300005535 | Bacteria | 7092 |
| 85 | Ga0070684_100051695 | 3300005535 | Bacteria | 3571 |
| 86 | Ga0070697_100037401 | 3300005536 | Bacteria | 3921 |
| 87 | Ga0070697_100357835 | 3300005536 | Unclassified | 1262 |
| 88 | Ga0070697_100843605 | 3300005536 | Unclassified | 812 |
| 89 | Ga0068853_100152117 | 3300005539 | Unclassified | 2083 |
| 90 | Ga0068853_100413700 | 3300005539 | Bacteria | 1264 |
| 91 | Ga0068853_100864201 | 3300005539 | Unclassified | 868 |
| 92 | Ga0068853_101728320 | 3300005539 | Unclassified | 606 |
| 93 | Ga0070672_100000364 | 3300005543 | Bacteria | 26086 |
| 94 | Ga0070672_100053169 | 3300005543 | Bacteria | 3165 |
| 95 | Ga0070672_100237810 | 3300005543 | Bacteria | 1531 |
| 96 | Ga0070665_100010125 | 3300005548 | Bacteria | 9536 |
| 97 | Ga0070665_100027710 | 3300005548 | Bacteria | 5704 |
| 98 | Ga0070665_100313192 | 3300005548 | Bacteria | 1573 |
| 99 | Ga0070665_100341015 | 3300005548 | Unclassified | 1503 |
| 100 | Ga0070665_100528433 | 3300005548 | Bacteria | 1191 |
| 101 | Ga0068855_100634745 | 3300005563 | Unclassified | 1149 |
| 102 | Ga0068855_100952528 | 3300005563 | Unclassified | 904 |
| 103 | Ga0068855_101152603 | 3300005563 | Unclassified | 808 |
| 104 | Ga0070664_100002544 | 3300005564 | Bacteria | 14706 |
| 105 | Ga0070664_100088765 | 3300005564 | Bacteria | 2673 |
| 106 | Ga0070664_100202403 | 3300005564 | Bacteria | 1772 |
| 107 | Ga0070664_100441041 | 3300005564 | Bacteria | 1194 |
| 108 | Ga0070664_100751011 | 3300005564 | Bacteria | 910 |
| 109 | Ga0068857_100001315 | 3300005577 | Bacteria | 19544 |
| 110 | Ga0068857_100039101 | 3300005577 | Bacteria | 4201 |
| 111 | Ga0068857_100177156 | 3300005577 | Viruses | 1940 |
| 112 | Ga0068856_100455902 | 3300005614 | Unclassified | 1299 |
| 113 | Ga0068856_100466041 | 3300005614 | Unclassified | 1284 |
| 114 | Ga0068859_100003313 | 3300005617 | Bacteria | 16365 |
| 115 | Ga0068859_100027742 | 3300005617 | Bacteria | 5679 |
| 116 | Ga0068859_101165852 | 3300005617 | Unclassified | 848 |
| 117 | Ga0068864_100000879 | 3300005618 | Bacteria | 25306 |
| 118 | Ga0068864_100001704 | 3300005618 | Bacteria | 18071 |
| 119 | Ga0068864_100023451 | 3300005618 | Bacteria | 5182 |
| 120 | Ga0068851_10064091 | 3300005834 | Bacteria | 1888 |
| 121 | Ga0068851_10146762 | 3300005834 | Bacteria | 1287 |
| 122 | Ga0068851_10757081 | 3300005834 | Unclassified | 601 |
| 123 | Ga0068863_100001146 | 3300005841 | Bacteria | 26467 |
| 124 | Ga0068863_100002863 | 3300005841 | Bacteria | 17081 |
| 125 | Ga0068863_100006619 | 3300005841 | Bacteria | 11374 |
| 126 | Ga0068863_100028502 | 3300005841 | Bacteria | 5332 |
| 127 | Ga0068858_100008599 | 3300005842 | Bacteria | 9805 |
| 128 | Ga0068858_100035570 | 3300005842 | Bacteria | 4620 |
| 129 | Ga0068858_100129986 | 3300005842 | Bacteria | 2361 |
| 130 | Ga0068860_100014700 | 3300005843 | Bacteria | 7656 |
| 131 | Ga0068860_100262525 | 3300005843 | Bacteria | 1684 |
| 132 | Ga0068860_100263516 | 3300005843 | Bacteria | 1680 |
| 133 | Ga0068862_100003035 | 3300005844 | Bacteria | 14617 |
| 134 | Ga0068862_100012726 | 3300005844 | Bacteria | 6965 |
| 135 | Ga0068862_100490190 | 3300005844 | Bacteria | 1165 |
| 136 | Ga0068862_101532115 | 3300005844 | Unclassified | 672 |
| 137 | Ga0070717_10204280 | 3300006028 | Unclassified | 1732 |
| 138 | Ga0070716_100061546 | 3300006173 | Bacteria | 2173 |
| 139 | Ga0070716_100092249 | 3300006173 | Bacteria | 1836 |
| 140 | Ga0070712_100413765 | 3300006175 | Bacteria | 1116 |
| 141 | Ga0070712_100847440 | 3300006175 | Unclassified | 786 |
| 142 | Ga0070712_100990530 | 3300006175 | Unclassified | 727 |
| 143 | Ga0070712_101229031 | 3300006175 | Bacteria | 652 |
| 144 | Ga0097621_100008738 | 3300006237 | Bacteria | 7318 |
| 145 | Ga0097621_100107277 | 3300006237 | Unclassified | 2356 |
| 146 | Ga0097621_100457443 | 3300006237 | Unclassified | 1151 |
| 147 | Ga0097621_100471820 | 3300006237 | Unclassified | 1133 |
| 148 | Ga0097621_100777067 | 3300006237 | Unclassified | 886 |
| 149 | Ga0068871_100009017 | 3300006358 | Bacteria | 7205 |
| 150 | Ga0068871_100040381 | 3300006358 | Unclassified | 3737 |
| 151 | Ga0068871_100575988 | 3300006358 | Unclassified | 1022 |
| 152 | Ga0068871_100747598 | 3300006358 | Bacteria | 899 |
| 153 | Ga0068871_101627521 | 3300006358 | Unclassified | 612 |
| 154 | Ga0068871_101886123 | 3300006358 | Unclassified | 568 |
| 155 | Ga0068865_100293889 | 3300006881 | Bacteria | 1298 |
| 156 | Ga0097620_100003313 | 3300006931 | Bacteria | 16365 |
| 157 | Ga0097620_100027739 | 3300006931 | Bacteria | 5679 |
| 158 | Ga0097620_101165790 | 3300006931 | Unclassified | 848 |
| 159 | Ga0105240_10059547 | 3300009093 | Bacteria | 4765 |
| 160 | Ga0105240_10515449 | 3300009093 | Unclassified | 1328 |
| 161 | Ga0105240_11454005 | 3300009093 | Bacteria | 719 |
| 162 | Ga0105245_10787245 | 3300009098 | Bacteria | 988 |
| 163 | Ga0105247_10061835 | 3300009101 | Unclassified | 2322 |
| 164 | Ga0105247_10262437 | 3300009101 | Bacteria | 1185 |
| 165 | Ga0105241_10623777 | 3300009174 | Bacteria | 976 |
| 166 | Ga0105248_10012614 | 3300009177 | Bacteria | 9325 |
| 167 | Ga0105248_10053886 | 3300009177 | Bacteria | 4512 |
| 168 | Ga0105237_10208570 | 3300009545 | Unclassified | 1954 |
| 169 | Ga0105237_10521327 | 3300009545 | Bacteria | 1195 |
| 170 | Ga0105238_10138229 | 3300009551 | Unclassified | 2414 |
| 171 | Ga0105238_11230387 | 3300009551 | Bacteria | 774 |
| 172 | Ga0105249_10149244 | 3300009553 | Bacteria | 2249 |
| 173 | Ga0105239_11214318 | 3300010375 | Unclassified | 869 |
| 174 | Ga0105239_11254655 | 3300010375 | Unclassified | 854 |
| 175 | Ga0105239_11513281 | 3300010375 | Unclassified | 775 |
| 176 | Ga0105246_10001222 | 3300011119 | Bacteria | 15046 |
| 177 | Ga0157371_10139666 | 3300013102 | Unclassified | 1726 |
| 178 | Ga0157369_10042779 | 3300013105 | Unclassified | 4942 |
| 179 | Ga0157369_10410550 | 3300013105 | Unclassified | 1404 |
| 180 | Ga0157369_10535810 | 3300013105 | Unclassified | 1210 |
| 181 | Ga0157369_12217555 | 3300013105 | Unclassified | 557 |
| 182 | Ga0157374_10000388 | 3300013296 | Bacteria | 40353 |
| 183 | Ga0157374_10013013 | 3300013296 | Bacteria | 7255 |
| 184 | Ga0157374_10026180 | 3300013296 | Bacteria | 5246 |
| 185 | Ga0157374_10264758 | 3300013296 | Bacteria | 1694 |
| 186 | Ga0157374_10320207 | 3300013296 | Bacteria | 1537 |
| 187 | Ga0157374_11097825 | 3300013296 | Bacteria | 816 |
| 188 | Ga0157374_11560319 | 3300013296 | Unclassified | 684 |
| 189 | Ga0157378_10028929 | 3300013297 | Unclassified | 4891 |
| 190 | Ga0157378_10146694 | 3300013297 | Bacteria | 2195 |
| 191 | Ga0157378_10958216 | 3300013297 | Bacteria | 888 |
| 192 | Ga0157378_11725898 | 3300013297 | Unclassified | 673 |
| 193 | Ga0157378_11764267 | 3300013297 | Unclassified | 667 |
| 194 | Ga0163162_10077349 | 3300013306 | Bacteria | 3391 |
| 195 | Ga0163162_10217306 | 3300013306 | Bacteria | 2042 |
| 196 | Ga0157375_10010780 | 3300013308 | Bacteria | 8052 |
| 197 | Ga0157375_11462829 | 3300013308 | Unclassified | 806 |
| 198 | Ga0163163_10041481 | 3300014325 | Unclassified | 4500 |
| 199 | Ga0163163_10504597 | 3300014325 | Unclassified | 1272 |
| 200 | Ga0163163_10955916 | 3300014325 | Unclassified | 920 |
| 201 | Ga0182008_10014395 | 3300014497 | Plasmid | 4142 |
| 202 | Ga0182008_10080614 | 3300014497 | Bacteria | 1601 |
| 203 | Ga0182008_10441774 | 3300014497 | Unclassified | 706 |
| 204 | Ga0157377_10010765 | 3300014745 | Bacteria | 4538 |
| 205 | Ga0157377_10327347 | 3300014745 | Bacteria | 1020 |
| 206 | Ga0157377_10675957 | 3300014745 | Unclassified | 746 |
| 207 | Ga0157379_10001205 | 3300014968 | Bacteria | 21029 |
| 208 | Ga0157379_10034047 | 3300014968 | Bacteria | 4540 |
| 209 | Ga0157376_10007265 | 3300014969 | Bacteria | 7890 |
| 210 | Ga0157376_10490788 | 3300014969 | Bacteria | 1205 |
| 211 | Ga0157376_11628929 | 3300014969 | Unclassified | 680 |
| 212 | Ga0157376_11915127 | 3300014969 | Unclassified | 630 |
| 213 | Ga0157376_12244543 | 3300014969 | Unclassified | 585 |
| 214 | Ga0182007_10076635 | 3300015262 | Unclassified | 1096 |
| 215 | Ga0182007_10130477 | 3300015262 | Bacteria | 845 |
| 216 | Ga0182005_1047795 | 3300015265 | Bacteria | 1163 |
| 217 | Ga0207656_10051857 | 3300025321 | Bacteria | 1775 |
| 218 | Ga0207680_10526781 | 3300025903 | Unclassified | 843 |
| 219 | Ga0207647_10011317 | 3300025904 | Bacteria | 6263 |
| 220 | Ga0207647_10086788 | 3300025904 | Bacteria | 1870 |
| 221 | Ga0207645_10027987 | 3300025907 | Bacteria | 3639 |
| 222 | Ga0207645_10032967 | 3300025907 | Bacteria | 3330 |
| 223 | Ga0207684_10828551 | 3300025910 | Unclassified | 781 |
| 224 | Ga0207654_10441478 | 3300025911 | Unclassified | 911 |
| 225 | Ga0207695_10050063 | 3300025913 | Bacteria | 4397 |
| 226 | Ga0207695_10593861 | 3300025913 | Unclassified | 988 |
| 227 | Ga0207693_10542867 | 3300025915 | Unclassified | 907 |
| 228 | Ga0207693_10762321 | 3300025915 | Unclassified | 747 |
| 229 | Ga0207693_10847743 | 3300025915 | Unclassified | 703 |
| 230 | Ga0207693_11077547 | 3300025915 | Bacteria | 611 |
| 231 | Ga0207663_10493225 | 3300025916 | Bacteria | 950 |
| 232 | Ga0207657_10000660 | 3300025919 | Bacteria | 36719 |
| 233 | Ga0207657_10182423 | 3300025919 | Bacteria | 1696 |
| 234 | Ga0207657_10232234 | 3300025919 | Unclassified | 1475 |
| 235 | Ga0207657_10931965 | 3300025919 | Unclassified | 668 |
| 236 | Ga0207649_10000151 | 3300025920 | Bacteria | 56863 |
| 237 | Ga0207649_10000513 | 3300025920 | Bacteria | 27268 |
| 238 | Ga0207649_10193458 | 3300025920 | Bacteria | 1432 |
| 239 | Ga0207646_10172462 | 3300025922 | Unclassified | 1953 |
| 240 | Ga0207646_10304352 | 3300025922 | Unclassified | 1440 |
| 241 | Ga0207646_10377468 | 3300025922 | Unclassified | 1281 |
| 242 | Ga0207681_11020293 | 3300025923 | Unclassified | 694 |
| 243 | Ga0207694_10403406 | 3300025924 | Bacteria | 1137 |
| 244 | Ga0207650_10000024 | 3300025925 | Bacteria | 299184 |
| 245 | Ga0207650_10000059 | 3300025925 | Bacteria | 151427 |
| 246 | Ga0207650_10059278 | 3300025925 | Bacteria | 2853 |
| 247 | Ga0207650_10082396 | 3300025925 | Unclassified | 2442 |
| 248 | Ga0207659_10014083 | 3300025926 | Bacteria | 5149 |
| 249 | Ga0207687_10442082 | 3300025927 | Unclassified | 1077 |
| 250 | Ga0207687_10566587 | 3300025927 | Unclassified | 954 |
| 251 | Ga0207687_11426267 | 3300025927 | Unclassified | 595 |
| 252 | Ga0207700_10127471 | 3300025928 | Unclassified | 2073 |
| 253 | Ga0207700_10134961 | 3300025928 | Unclassified | 2020 |
| 254 | Ga0207700_10703522 | 3300025928 | Bacteria | 902 |
| 255 | Ga0207664_10267751 | 3300025929 | Unclassified | 1496 |
| 256 | Ga0207664_10908540 | 3300025929 | Bacteria | 790 |
| 257 | Ga0207664_11137582 | 3300025929 | Unclassified | 697 |
| 258 | Ga0207644_10036203 | 3300025931 | Bacteria | 3463 |
| 259 | Ga0207644_10228070 | 3300025931 | Unclassified | 1479 |
| 260 | Ga0207644_10334366 | 3300025931 | Unclassified | 1227 |
| 261 | Ga0207644_11194942 | 3300025931 | Unclassified | 639 |
| 262 | Ga0207690_10018279 | 3300025932 | Unclassified | 4298 |
| 263 | Ga0207690_10032963 | 3300025932 | Bacteria | 3328 |
| 264 | Ga0207706_10108976 | 3300025933 | Bacteria | 2437 |
| 265 | Ga0207706_10807475 | 3300025933 | Unclassified | 797 |
| 266 | Ga0207670_10078894 | 3300025936 | Unclassified | 2297 |
| 267 | Ga0207704_10256067 | 3300025938 | Bacteria | 1317 |
| 268 | Ga0207665_10047025 | 3300025939 | Bacteria | 2892 |
| 269 | Ga0207665_10142066 | 3300025939 | Bacteria | 1713 |
| 270 | Ga0207691_10013168 | 3300025940 | Bacteria | 7920 |
| 271 | Ga0207691_10018001 | 3300025940 | Bacteria | 6689 |
| 272 | Ga0207691_10088895 | 3300025940 | Viruses | 2770 |
| 273 | Ga0207711_10005842 | 3300025941 | Bacteria | 10394 |
| 274 | Ga0207711_10007700 | 3300025941 | Bacteria | 9004 |
| 275 | Ga0207689_10000160 | 3300025942 | Bacteria | 57858 |
| 276 | Ga0207689_10017588 | 3300025942 | Bacteria | 6043 |
| 277 | Ga0207689_10110301 | 3300025942 | Bacteria | 2261 |
| 278 | Ga0207689_10145776 | 3300025942 | Viruses | 1951 |
| 279 | Ga0207661_10000324 | 3300025944 | Bacteria | 30399 |
| 280 | Ga0207661_10004533 | 3300025944 | Bacteria | 9733 |
| 281 | Ga0207661_10032116 | 3300025944 | Viruses | 4065 |
| 282 | Ga0207679_10000040 | 3300025945 | Bacteria | 127317 |
| 283 | Ga0207679_10001027 | 3300025945 | Bacteria | 17836 |
| 284 | Ga0207679_10019557 | 3300025945 | Bacteria | 4552 |
| 285 | Ga0207679_10323864 | 3300025945 | Bacteria | 1335 |
| 286 | Ga0207667_10645080 | 3300025949 | Unclassified | 1065 |
| 287 | Ga0207667_11274610 | 3300025949 | Unclassified | 712 |
| 288 | Ga0207651_10003853 | 3300025960 | Bacteria | 7443 |
| 289 | Ga0207651_10023563 | 3300025960 | Bacteria | 3790 |
| 290 | Ga0207651_10199486 | 3300025960 | Bacteria | 1602 |
| 291 | Ga0207658_10041674 | 3300025986 | Bacteria | 3326 |
| 292 | Ga0207658_10311122 | 3300025986 | Bacteria | 1360 |
| 293 | Ga0207677_10026864 | 3300026023 | Bacteria | 3616 |
| 294 | Ga0207677_10043307 | 3300026023 | Viruses | 2992 |
| 295 | Ga0207703_10010559 | 3300026035 | Bacteria | 7219 |
| 296 | Ga0207703_10052024 | 3300026035 | Bacteria | 3323 |
| 297 | Ga0207639_10851495 | 3300026041 | Unclassified | 851 |
| 298 | Ga0207639_11020743 | 3300026041 | Bacteria | 775 |
| 299 | Ga0207639_11082603 | 3300026041 | Unclassified | 751 |
| 300 | Ga0207678_10013492 | 3300026067 | Bacteria | 7174 |
| 301 | Ga0207678_10027779 | 3300026067 | Unclassified | 4940 |
| 302 | Ga0207678_10624656 | 3300026067 | Bacteria | 945 |
| 303 | Ga0207702_10155987 | 3300026078 | Bacteria | 2081 |
| 304 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 305 | Ga0207641_10000030 | 3300026088 | Bacteria | 224468 |
| 306 | Ga0207641_10014807 | 3300026088 | Bacteria | 6393 |
| 307 | Ga0207641_10022146 | 3300026088 | Bacteria | 5229 |
| 308 | Ga0207676_10000134 | 3300026095 | Bacteria | 65594 |
| 309 | Ga0207676_10000160 | 3300026095 | Bacteria | 58979 |
| 310 | Ga0207676_10047292 | 3300026095 | Bacteria | 3333 |
| 311 | Ga0207674_10000069 | 3300026116 | Bacteria | 106470 |
| 312 | Ga0207674_10000162 | 3300026116 | Bacteria | 79631 |
| 313 | Ga0207674_10135891 | 3300026116 | Viruses | 2421 |
| 314 | Ga0207674_11739566 | 3300026116 | Unclassified | 591 |
| 315 | Ga0207683_10041785 | 3300026121 | Unclassified | 4004 |
| 316 | Ga0207683_10171709 | 3300026121 | Unclassified | 1964 |
| 317 | Ga0207683_10302315 | 3300026121 | Bacteria | 1464 |
| 318 | Ga0207683_10830362 | 3300026121 | Unclassified | 858 |
| 319 | Ga0207683_10865263 | 3300026121 | Bacteria | 839 |
| 320 | Ga0207698_10111856 | 3300026142 | Bacteria | 2291 |
| 321 | Ga0207698_11176673 | 3300026142 | Bacteria | 780 |
| 322 | Ga0268266_10001493 | 3300028379 | Bacteria | 27650 |
| 323 | Ga0268266_10002593 | 3300028379 | Bacteria | 19155 |
| 324 | Ga0268266_10004325 | 3300028379 | Bacteria | 13659 |
| 325 | Ga0268266_10091645 | 3300028379 | Viruses | 2665 |
| 326 | Ga0268266_10297539 | 3300028379 | Unclassified | 1504 |
| 327 | Ga0268265_10002498 | 3300028380 | Bacteria | 13798 |
| 328 | Ga0268265_10238480 | 3300028380 | Bacteria | 1603 |
| 329 | Ga0268265_10467797 | 3300028380 | Bacteria | 1181 |
| 330 | Ga0268264_10011195 | 3300028381 | Bacteria | 7410 |
| 331 | Ga0268264_10026196 | 3300028381 | Unclassified | 4762 |
| 332 | Ga0268264_10074643 | 3300028381 | Viruses | 2881 |
| 333 | Ga0268264_10426613 | 3300028381 | Bacteria | 1280 |
| 334 | Ga0265760_10037080 | 3300031090 | Bacteria | 1447 |
| 335 | Ga0265325_10015501 | 3300031241 | Unclassified | 4284 |
| 336 | Ga0265325_10076353 | 3300031241 | Archaea | 1672 |
| 337 | Ga0265325_10314704 | 3300031241 | Bacteria | 696 |
| 338 | Ga0265340_10061514 | 3300031247 | Unclassified | 1796 |
| 339 | Ga0265331_10123567 | 3300031250 | Bacteria | 1183 |
| 340 | Ga0265316_10379923 | 3300031344 | Bacteria | 1019 |
| 341 | Ga0265314_10091401 | 3300031711 | Bacteria | 1981 |
| 342 | Ga0265314_10098120 | 3300031711 | Unclassified | 1891 |
| 343 | Ga0373949_0210400 | 3300035090 | Unclassified | 587 |
| 344 | Ga0373931_0804859 | 3300035691 | Unclassified | 627 |
| 345 | Ga0436360_0971888 | 3300039438 | Unclassified | 927 |
| 346 | Ga0436363_0389171 | 3300039450 | Unclassified | 629 |
| 347 | Ga0451577_0312260 | 3300042876 | Bacteria | 1425 |
| 348 | Ga0453684_1083238 | 3300044712 | Bacteria | 848 |
| 349 | Ga0451576_0571706 | 3300045051 | Unclassified | 1188 |
| 350 | Ga0451576_1228753 | 3300045051 | Unclassified | 782 |
| 351 | Ga0466967_0683707 | 3300045976 | Bacteria | 1016 |
| 352 | Ga0495629_0718467 | 3300046459 | Unclassified | 663 |
| 353 | Ga0495580_0274657 | 3300046472 | Unclassified | 1150 |
| 354 | Ga0495580_0423761 | 3300046472 | Unclassified | 895 |
| 355 | Ga0495580_0476479 | 3300046472 | Unclassified | 835 |
| 356 | Ga0495580_0805390 | 3300046472 | Unclassified | 609 |
| 357 | Ga0495582_0356335 | 3300046473 | Unclassified | 843 |
| 358 | Ga0496100_0289444 | 3300048903 | Bacteria | 1224 |
| 359 | Ga0496102_1013846 | 3300048905 | Bacteria | 751 |
| 360 | Ga0496104_0329011 | 3300048907 | Unclassified | 1441 |
| 361 | Ga0496104_0792653 | 3300048907 | Unclassified | 854 |
| 362 | Ga0496104_0887236 | 3300048907 | Unclassified | 797 |
| 363 | Ga0496105_0294233 | 3300048908 | Unclassified | 1307 |
| 364 | Ga0496105_0710367 | 3300048908 | Unclassified | 771 |
| 365 | Ga0496106_0313535 | 3300048909 | Unclassified | 1259 |
| 366 | Ga0496108_0000203 | 3300048911 | Bacteria | 54921 |
| 367 | Ga0496109_0000099 | 3300048912 | Bacteria | 89901 |
| 368 | Ga0496109_0790679 | 3300048912 | Unclassified | 887 |
| 369 | Ga0496110_0000189 | 3300048913 | Bacteria | 38583 |
| 370 | Ga0496111_0092356 | 3300048914 | Bacteria | 2219 |
| 371 | Ga0496112_0000048 | 3300048915 | Bacteria | 84789 |
| 372 | Ga0496112_0046659 | 3300048915 | Plasmid | 4250 |
| 373 | Ga0496112_0090889 | 3300048915 | Bacteria | 3022 |
| 374 | Ga0496112_0118386 | 3300048915 | Bacteria | 2619 |
| 375 | Ga0496112_0136515 | 3300048915 | Bacteria | 2422 |
| 376 | Ga0496112_0286462 | 3300048915 | Bacteria | 1594 |
| 377 | Ga0496113_0000655 | 3300048916 | Bacteria | 17490 |
| 378 | Ga0496113_0168928 | 3300048916 | Bacteria | 1732 |
| 379 | Ga0496114_1130259 | 3300048917 | Unclassified | 669 |
| 380 | Ga0496115_0174282 | 3300048918 | Bacteria | 1778 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025916 | Ga0207663_10493225 | Ga0207663_104932252 | 133 |
| 2 | 3300042876 | Ga0451577_0312260 | Ga0451577_0312260_662_1072 | 135 |
| 3 | 3300014745 | Ga0157377_10675957 | Ga0157377_106759571 | 140 |
| 4 | 3300045976 | Ga0466967_0683707 | Ga0466967_0683707_289_714 | 140 |
| 5 | 3300006173 | Ga0070716_100092249 | Ga0070716_1000922492 | 141 |
| 6 | 3300025922 | Ga0207646_10377468 | Ga0207646_103774682 | 141 |
| 7 | 3300025939 | Ga0207665_10142066 | Ga0207665_101420662 | 141 |
| 8 | 3300039438 | Ga0436360_0971888 | Ga0436360_0971888_32_529 | 141 |
| 9 | 3300005290 | Ga0065712_10572179 | Ga0065712_105721791 | 142 |
| 10 | 3300005334 | Ga0068869_100763411 | Ga0068869_1007634112 | 142 |
| 11 | 3300005337 | Ga0070682_101463440 | Ga0070682_1014634401 | 142 |
| 12 | 3300005339 | Ga0070660_100633898 | Ga0070660_1006338982 | 142 |
| 13 | 3300005339 | Ga0070660_100995331 | Ga0070660_1009953311 | 142 |
| 14 | 3300005354 | Ga0070675_100432706 | Ga0070675_1004327062 | 142 |
| 15 | 3300005355 | Ga0070671_100277818 | Ga0070671_1002778182 | 142 |
| 16 | 3300005355 | Ga0070671_101543199 | Ga0070671_1015431991 | 142 |
| 17 | 3300005364 | Ga0070673_101380307 | Ga0070673_1013803071 | 142 |
| 18 | 3300005366 | Ga0070659_100223092 | Ga0070659_1002230923 | 142 |
| 19 | 3300005366 | Ga0070659_100689654 | Ga0070659_1006896542 | 142 |
| 20 | 3300005456 | Ga0070678_101216981 | Ga0070678_1012169812 | 142 |
| 21 | 3300005457 | Ga0070662_101173372 | Ga0070662_1011733722 | 142 |
| 22 | 3300005467 | Ga0070706_101377493 | Ga0070706_1013774932 | 142 |
| 23 | 3300005539 | Ga0068853_100413700 | Ga0068853_1004137002 | 142 |
| 24 | 3300005563 | Ga0068855_100634745 | Ga0068855_1006347452 | 142 |
| 25 | 3300005563 | Ga0068855_100952528 | Ga0068855_1009525282 | 142 |
| 26 | 3300005564 | Ga0070664_100751011 | Ga0070664_1007510111 | 142 |
| 27 | 3300005614 | Ga0068856_100455902 | Ga0068856_1004559022 | 142 |
| 28 | 3300005834 | Ga0068851_10146762 | Ga0068851_101467622 | 142 |
| 29 | 3300005834 | Ga0068851_10757081 | Ga0068851_107570812 | 142 |
| 30 | 3300006358 | Ga0068871_101627521 | Ga0068871_1016275212 | 142 |
| 31 | 3300009093 | Ga0105240_10059547 | Ga0105240_100595473 | 142 |
| 32 | 3300009093 | Ga0105240_10515449 | Ga0105240_105154492 | 142 |
| 33 | 3300009093 | Ga0105240_11454005 | Ga0105240_114540052 | 142 |
| 34 | 3300009174 | Ga0105241_10623777 | Ga0105241_106237772 | 142 |
| 35 | 3300009545 | Ga0105237_10521327 | Ga0105237_105213272 | 142 |
| 36 | 3300009551 | Ga0105238_10138229 | Ga0105238_101382294 | 142 |
| 37 | 3300009551 | Ga0105238_11230387 | Ga0105238_112303872 | 142 |
| 38 | 3300010375 | Ga0105239_11214318 | Ga0105239_112143182 | 142 |
| 39 | 3300010375 | Ga0105239_11513281 | Ga0105239_115132811 | 142 |
| 40 | 3300013105 | Ga0157369_12217555 | Ga0157369_122175552 | 142 |
| 41 | 3300013296 | Ga0157374_10026180 | Ga0157374_100261805 | 142 |
| 42 | 3300013296 | Ga0157374_10264758 | Ga0157374_102647583 | 142 |
| 43 | 3300013296 | Ga0157374_11560319 | Ga0157374_115603191 | 142 |
| 44 | 3300013297 | Ga0157378_10146694 | Ga0157378_101466943 | 142 |
| 45 | 3300013297 | Ga0157378_10958216 | Ga0157378_109582162 | 142 |
| 46 | 3300013297 | Ga0157378_11725898 | Ga0157378_117258981 | 142 |
| 47 | 3300014325 | Ga0163163_10955916 | Ga0163163_109559162 | 142 |
| 48 | 3300014497 | Ga0182008_10014395 | Ga0182008_100143956 | 142 |
| 49 | 3300014497 | Ga0182008_10080614 | Ga0182008_100806142 | 142 |
| 50 | 3300014497 | Ga0182008_10441774 | Ga0182008_104417742 | 142 |
| 51 | 3300014969 | Ga0157376_11915127 | Ga0157376_119151272 | 142 |
| 52 | 3300015262 | Ga0182007_10076635 | Ga0182007_100766352 | 142 |
| 53 | 3300015262 | Ga0182007_10130477 | Ga0182007_101304772 | 142 |
| 54 | 3300015265 | Ga0182005_1047795 | Ga0182005_10477952 | 142 |
| 55 | 3300025911 | Ga0207654_10441478 | Ga0207654_104414781 | 142 |
| 56 | 3300025913 | Ga0207695_10050063 | Ga0207695_100500635 | 142 |
| 57 | 3300025913 | Ga0207695_10593861 | Ga0207695_105938612 | 142 |
| 58 | 3300025915 | Ga0207693_10847743 | Ga0207693_108477432 | 142 |
| 59 | 3300025919 | Ga0207657_10232234 | Ga0207657_102322342 | 142 |
| 60 | 3300025919 | Ga0207657_10931965 | Ga0207657_109319652 | 142 |
| 61 | 3300025924 | Ga0207694_10403406 | Ga0207694_104034062 | 142 |
| 62 | 3300025927 | Ga0207687_11426267 | Ga0207687_114262672 | 142 |
| 63 | 3300025931 | Ga0207644_10228070 | Ga0207644_102280702 | 142 |
| 64 | 3300025931 | Ga0207644_11194942 | Ga0207644_111949422 | 142 |
| 65 | 3300025933 | Ga0207706_10807475 | Ga0207706_108074751 | 142 |
| 66 | 3300025949 | Ga0207667_10645080 | Ga0207667_106450802 | 142 |
| 67 | 3300026041 | Ga0207639_10851495 | Ga0207639_108514952 | 142 |
| 68 | 3300026116 | Ga0207674_11739566 | Ga0207674_117395661 | 142 |
| 69 | 3300026142 | Ga0207698_11176673 | Ga0207698_111766732 | 142 |
| 70 | 3300039450 | Ga0436363_0389171 | Ga0436363_0389171_54_488 | 142 |
| 71 | 3300044712 | Ga0453684_1083238 | Ga0453684_1083238_101_529 | 142 |
| 72 | 3300045051 | Ga0451576_0571706 | Ga0451576_0571706_497_928 | 142 |
| 73 | 3300045051 | Ga0451576_1228753 | Ga0451576_1228753_282_710 | 142 |
| 74 | 3300046459 | Ga0495629_0718467 | Ga0495629_0718467_172_612 | 142 |
| 75 | 3300048903 | Ga0496100_0289444 | Ga0496100_0289444_338_766 | 142 |
| 76 | 3300048905 | Ga0496102_1013846 | Ga0496102_1013846_55_483 | 142 |
| 77 | 3300048907 | Ga0496104_0887236 | Ga0496104_0887236_158_586 | 142 |
| 78 | 3300048912 | Ga0496109_0790679 | Ga0496109_0790679_185_616 | 142 |
| 79 | 3300048914 | Ga0496111_0092356 | Ga0496111_0092356_460_888 | 142 |
| 80 | 3300048915 | Ga0496112_0046659 | Ga0496112_0046659_3126_3557 | 142 |
| 81 | 3300048915 | Ga0496112_0090889 | Ga0496112_0090889_1677_2111 | 142 |
| 82 | 3300048915 | Ga0496112_0118386 | Ga0496112_0118386_1059_1487 | 142 |
| 83 | 3300048916 | Ga0496113_0168928 | Ga0496113_0168928_1283_1717 | 142 |
| 84 | 3300005329 | Ga0070683_100002123 | Ga0070683_1000021234 | 143 |
| 85 | 3300005331 | Ga0070670_100082408 | Ga0070670_1000824084 | 143 |
| 86 | 3300005331 | Ga0070670_100412425 | Ga0070670_1004124252 | 143 |
| 87 | 3300005334 | Ga0068869_100002923 | Ga0068869_1000029238 | 143 |
| 88 | 3300005334 | Ga0068869_100189148 | Ga0068869_1001891483 | 143 |
| 89 | 3300005334 | Ga0068869_100215844 | Ga0068869_1002158442 | 143 |
| 90 | 3300005335 | Ga0070666_10033227 | Ga0070666_100332272 | 143 |
| 91 | 3300005338 | Ga0068868_100157638 | Ga0068868_1001576383 | 143 |
| 92 | 3300005339 | Ga0070660_100062066 | Ga0070660_1000620661 | 143 |
| 93 | 3300005340 | Ga0070689_100006429 | Ga0070689_1000064295 | 143 |
| 94 | 3300005340 | Ga0070689_100188786 | Ga0070689_1001887862 | 143 |
| 95 | 3300005343 | Ga0070687_100010174 | Ga0070687_1000101742 | 143 |
| 96 | 3300005344 | Ga0070661_100005018 | Ga0070661_1000050186 | 143 |
| 97 | 3300005353 | Ga0070669_100011144 | Ga0070669_1000111444 | 143 |
| 98 | 3300005354 | Ga0070675_100120243 | Ga0070675_1001202432 | 143 |
| 99 | 3300005354 | Ga0070675_100685082 | Ga0070675_1006850822 | 143 |
| 100 | 3300005355 | Ga0070671_100017553 | Ga0070671_1000175533 | 143 |
| 101 | 3300005355 | Ga0070671_101029449 | Ga0070671_1010294492 | 143 |
| 102 | 3300005364 | Ga0070673_100000589 | Ga0070673_10000058911 | 143 |
| 103 | 3300005365 | Ga0070688_100002679 | Ga0070688_1000026798 | 143 |
| 104 | 3300005367 | Ga0070667_100013226 | Ga0070667_1000132266 | 143 |
| 105 | 3300005367 | Ga0070667_100020313 | Ga0070667_1000203135 | 143 |
| 106 | 3300005367 | Ga0070667_101756514 | Ga0070667_1017565142 | 143 |
| 107 | 3300005436 | Ga0070713_101016703 | Ga0070713_1010167032 | 143 |
| 108 | 3300005436 | Ga0070713_101924137 | Ga0070713_1019241371 | 143 |
| 109 | 3300005438 | Ga0070701_10101954 | Ga0070701_101019542 | 143 |
| 110 | 3300005439 | Ga0070711_100614880 | Ga0070711_1006148801 | 143 |
| 111 | 3300005439 | Ga0070711_101174598 | Ga0070711_1011745982 | 143 |
| 112 | 3300005439 | Ga0070711_101825231 | Ga0070711_1018252311 | 143 |
| 113 | 3300005455 | Ga0070663_100001276 | Ga0070663_1000012764 | 143 |
| 114 | 3300005455 | Ga0070663_100104315 | Ga0070663_1001043153 | 143 |
| 115 | 3300005455 | Ga0070663_100106632 | Ga0070663_1001066323 | 143 |
| 116 | 3300005456 | Ga0070678_100039990 | Ga0070678_1000399903 | 143 |
| 117 | 3300005456 | Ga0070678_100082809 | Ga0070678_1000828093 | 143 |
| 118 | 3300005456 | Ga0070678_100534094 | Ga0070678_1005340941 | 143 |
| 119 | 3300005456 | Ga0070678_100826398 | Ga0070678_1008263982 | 143 |
| 120 | 3300005456 | Ga0070678_101143584 | Ga0070678_1011435841 | 143 |
| 121 | 3300005456 | Ga0070678_101527019 | Ga0070678_1015270192 | 143 |
| 122 | 3300005466 | Ga0070685_10003008 | Ga0070685_100030086 | 143 |
| 123 | 3300005518 | Ga0070699_100110719 | Ga0070699_1001107194 | 143 |
| 124 | 3300005535 | Ga0070684_100000936 | Ga0070684_1000009364 | 143 |
| 125 | 3300005535 | Ga0070684_100051695 | Ga0070684_1000516955 | 143 |
| 126 | 3300005539 | Ga0068853_100152117 | Ga0068853_1001521172 | 143 |
| 127 | 3300005539 | Ga0068853_101728320 | Ga0068853_1017283201 | 143 |
| 128 | 3300005543 | Ga0070672_100000364 | Ga0070672_10000036411 | 143 |
| 129 | 3300005543 | Ga0070672_100237810 | Ga0070672_1002378102 | 143 |
| 130 | 3300005548 | Ga0070665_100010125 | Ga0070665_10001012510 | 143 |
| 131 | 3300005548 | Ga0070665_100027710 | Ga0070665_1000277103 | 143 |
| 132 | 3300005548 | Ga0070665_100313192 | Ga0070665_1003131923 | 143 |
| 133 | 3300005564 | Ga0070664_100002544 | Ga0070664_1000025449 | 143 |
| 134 | 3300005564 | Ga0070664_100202403 | Ga0070664_1002024032 | 143 |
| 135 | 3300005564 | Ga0070664_100441041 | Ga0070664_1004410412 | 143 |
| 136 | 3300005577 | Ga0068857_100001315 | Ga0068857_1000013158 | 143 |
| 137 | 3300005577 | Ga0068857_100177156 | Ga0068857_1001771562 | 143 |
| 138 | 3300005617 | Ga0068859_100003313 | Ga0068859_1000033133 | 143 |
| 139 | 3300005617 | Ga0068859_101165852 | Ga0068859_1011658522 | 143 |
| 140 | 3300005618 | Ga0068864_100001704 | Ga0068864_1000017049 | 143 |
| 141 | 3300005618 | Ga0068864_100023451 | Ga0068864_1000234514 | 143 |
| 142 | 3300005841 | Ga0068863_100002863 | Ga0068863_1000028635 | 143 |
| 143 | 3300005841 | Ga0068863_100006619 | Ga0068863_1000066195 | 143 |
| 144 | 3300005841 | Ga0068863_100028502 | Ga0068863_1000285024 | 143 |
| 145 | 3300005842 | Ga0068858_100008599 | Ga0068858_1000085997 | 143 |
| 146 | 3300005842 | Ga0068858_100035570 | Ga0068858_1000355703 | 143 |
| 147 | 3300005843 | Ga0068860_100014700 | Ga0068860_1000147005 | 143 |
| 148 | 3300005843 | Ga0068860_100262525 | Ga0068860_1002625253 | 143 |
| 149 | 3300005844 | Ga0068862_100003035 | Ga0068862_1000030356 | 143 |
| 150 | 3300005844 | Ga0068862_100490190 | Ga0068862_1004901902 | 143 |
| 151 | 3300005844 | Ga0068862_101532115 | Ga0068862_1015321152 | 143 |
| 152 | 3300006028 | Ga0070717_10204280 | Ga0070717_102042804 | 143 |
| 153 | 3300006173 | Ga0070716_100061546 | Ga0070716_1000615462 | 143 |
| 154 | 3300006175 | Ga0070712_100413765 | Ga0070712_1004137652 | 143 |
| 155 | 3300006175 | Ga0070712_100847440 | Ga0070712_1008474402 | 143 |
| 156 | 3300006175 | Ga0070712_100990530 | Ga0070712_1009905302 | 143 |
| 157 | 3300006175 | Ga0070712_101229031 | Ga0070712_1012290312 | 143 |
| 158 | 3300006237 | Ga0097621_100008738 | Ga0097621_1000087386 | 143 |
| 159 | 3300006237 | Ga0097621_100107277 | Ga0097621_1001072774 | 143 |
| 160 | 3300006237 | Ga0097621_100471820 | Ga0097621_1004718202 | 143 |
| 161 | 3300006237 | Ga0097621_100777067 | Ga0097621_1007770672 | 143 |
| 162 | 3300006358 | Ga0068871_100009017 | Ga0068871_1000090176 | 143 |
| 163 | 3300006358 | Ga0068871_100040381 | Ga0068871_1000403816 | 143 |
| 164 | 3300006358 | Ga0068871_100747598 | Ga0068871_1007475982 | 143 |
| 165 | 3300006358 | Ga0068871_101886123 | Ga0068871_1018861232 | 143 |
| 166 | 3300006881 | Ga0068865_100293889 | Ga0068865_1002938892 | 143 |
| 167 | 3300006931 | Ga0097620_100003313 | Ga0097620_1000033133 | 143 |
| 168 | 3300006931 | Ga0097620_101165790 | Ga0097620_1011657902 | 143 |
| 169 | 3300009098 | Ga0105245_10787245 | Ga0105245_107872452 | 143 |
| 170 | 3300009101 | Ga0105247_10061835 | Ga0105247_100618353 | 143 |
| 171 | 3300009101 | Ga0105247_10262437 | Ga0105247_102624372 | 143 |
| 172 | 3300009177 | Ga0105248_10012614 | Ga0105248_100126145 | 143 |
| 173 | 3300009177 | Ga0105248_10053886 | Ga0105248_100538863 | 143 |
| 174 | 3300009545 | Ga0105237_10208570 | Ga0105237_102085702 | 143 |
| 175 | 3300009553 | Ga0105249_10149244 | Ga0105249_101492442 | 143 |
| 176 | 3300010375 | Ga0105239_11254655 | Ga0105239_112546552 | 143 |
| 177 | 3300011119 | Ga0105246_10001222 | Ga0105246_100012223 | 143 |
| 178 | 3300013102 | Ga0157371_10139666 | Ga0157371_101396663 | 143 |
| 179 | 3300013105 | Ga0157369_10042779 | Ga0157369_100427794 | 143 |
| 180 | 3300013105 | Ga0157369_10410550 | Ga0157369_104105502 | 143 |
| 181 | 3300013105 | Ga0157369_10535810 | Ga0157369_105358102 | 143 |
| 182 | 3300013296 | Ga0157374_10000388 | Ga0157374_1000038818 | 143 |
| 183 | 3300013296 | Ga0157374_10013013 | Ga0157374_100130136 | 143 |
| 184 | 3300013296 | Ga0157374_10320207 | Ga0157374_103202072 | 143 |
| 185 | 3300013296 | Ga0157374_11097825 | Ga0157374_110978252 | 143 |
| 186 | 3300013297 | Ga0157378_10028929 | Ga0157378_100289293 | 143 |
| 187 | 3300013306 | Ga0163162_10077349 | Ga0163162_100773492 | 143 |
| 188 | 3300013306 | Ga0163162_10217306 | Ga0163162_102173062 | 143 |
| 189 | 3300013308 | Ga0157375_10010780 | Ga0157375_100107804 | 143 |
| 190 | 3300013308 | Ga0157375_11462829 | Ga0157375_114628292 | 143 |
| 191 | 3300014325 | Ga0163163_10041481 | Ga0163163_100414815 | 143 |
| 192 | 3300014325 | Ga0163163_10504597 | Ga0163163_105045972 | 143 |
| 193 | 3300014745 | Ga0157377_10010765 | Ga0157377_100107653 | 143 |
| 194 | 3300014745 | Ga0157377_10327347 | Ga0157377_103273472 | 143 |
| 195 | 3300014968 | Ga0157379_10001205 | Ga0157379_1000120511 | 143 |
| 196 | 3300014968 | Ga0157379_10034047 | Ga0157379_100340473 | 143 |
| 197 | 3300014969 | Ga0157376_10007265 | Ga0157376_100072653 | 143 |
| 198 | 3300014969 | Ga0157376_10490788 | Ga0157376_104907882 | 143 |
| 199 | 3300014969 | Ga0157376_11628929 | Ga0157376_116289292 | 143 |
| 200 | 3300014969 | Ga0157376_12244543 | Ga0157376_122445431 | 143 |
| 201 | 3300025904 | Ga0207647_10011317 | Ga0207647_100113176 | 143 |
| 202 | 3300025907 | Ga0207645_10027987 | Ga0207645_100279873 | 143 |
| 203 | 3300025915 | Ga0207693_10542867 | Ga0207693_105428672 | 143 |
| 204 | 3300025915 | Ga0207693_10762321 | Ga0207693_107623212 | 143 |
| 205 | 3300025915 | Ga0207693_11077547 | Ga0207693_110775472 | 143 |
| 206 | 3300025919 | Ga0207657_10000660 | Ga0207657_1000066035 | 143 |
| 207 | 3300025920 | Ga0207649_10000513 | Ga0207649_1000051316 | 143 |
| 208 | 3300025920 | Ga0207649_10193458 | Ga0207649_101934582 | 143 |
| 209 | 3300025923 | Ga0207681_11020293 | Ga0207681_110202932 | 143 |
| 210 | 3300025925 | Ga0207650_10000059 | Ga0207650_1000005951 | 143 |
| 211 | 3300025925 | Ga0207650_10059278 | Ga0207650_100592784 | 143 |
| 212 | 3300025925 | Ga0207650_10082396 | Ga0207650_100823962 | 143 |
| 213 | 3300025927 | Ga0207687_10442082 | Ga0207687_104420822 | 143 |
| 214 | 3300025927 | Ga0207687_10566587 | Ga0207687_105665872 | 143 |
| 215 | 3300025928 | Ga0207700_10127471 | Ga0207700_101274712 | 143 |
| 216 | 3300025928 | Ga0207700_10134961 | Ga0207700_101349613 | 143 |
| 217 | 3300025929 | Ga0207664_10267751 | Ga0207664_102677512 | 143 |
| 218 | 3300025929 | Ga0207664_10908540 | Ga0207664_109085402 | 143 |
| 219 | 3300025932 | Ga0207690_10018279 | Ga0207690_100182795 | 143 |
| 220 | 3300025936 | Ga0207670_10078894 | Ga0207670_100788942 | 143 |
| 221 | 3300025938 | Ga0207704_10256067 | Ga0207704_102560672 | 143 |
| 222 | 3300025939 | Ga0207665_10047025 | Ga0207665_100470252 | 143 |
| 223 | 3300025940 | Ga0207691_10018001 | Ga0207691_100180014 | 143 |
| 224 | 3300025940 | Ga0207691_10088895 | Ga0207691_100888954 | 143 |
| 225 | 3300025941 | Ga0207711_10005842 | Ga0207711_100058422 | 143 |
| 226 | 3300025942 | Ga0207689_10017588 | Ga0207689_100175884 | 143 |
| 227 | 3300025942 | Ga0207689_10110301 | Ga0207689_101103014 | 143 |
| 228 | 3300025942 | Ga0207689_10145776 | Ga0207689_101457763 | 143 |
| 229 | 3300025944 | Ga0207661_10004533 | Ga0207661_100045339 | 143 |
| 230 | 3300025944 | Ga0207661_10032116 | Ga0207661_100321164 | 143 |
| 231 | 3300025945 | Ga0207679_10001027 | Ga0207679_100010278 | 143 |
| 232 | 3300025945 | Ga0207679_10019557 | Ga0207679_100195575 | 143 |
| 233 | 3300025945 | Ga0207679_10323864 | Ga0207679_103238642 | 143 |
| 234 | 3300025960 | Ga0207651_10003853 | Ga0207651_100038536 | 143 |
| 235 | 3300025960 | Ga0207651_10199486 | Ga0207651_101994862 | 143 |
| 236 | 3300025986 | Ga0207658_10311122 | Ga0207658_103111222 | 143 |
| 237 | 3300026023 | Ga0207677_10026864 | Ga0207677_100268643 | 143 |
| 238 | 3300026023 | Ga0207677_10043307 | Ga0207677_100433074 | 143 |
| 239 | 3300026035 | Ga0207703_10010559 | Ga0207703_100105595 | 143 |
| 240 | 3300026035 | Ga0207703_10052024 | Ga0207703_100520245 | 143 |
| 241 | 3300026041 | Ga0207639_11020743 | Ga0207639_110207432 | 143 |
| 242 | 3300026067 | Ga0207678_10013492 | Ga0207678_100134925 | 143 |
| 243 | 3300026067 | Ga0207678_10027779 | Ga0207678_100277794 | 143 |
| 244 | 3300026067 | Ga0207678_10624656 | Ga0207678_106246562 | 143 |
| 245 | 3300026088 | Ga0207641_10000025 | Ga0207641_1000002553 | 143 |
| 246 | 3300026088 | Ga0207641_10014807 | Ga0207641_100148076 | 143 |
| 247 | 3300026088 | Ga0207641_10022146 | Ga0207641_100221465 | 143 |
| 248 | 3300026095 | Ga0207676_10000160 | Ga0207676_1000016041 | 143 |
| 249 | 3300026095 | Ga0207676_10047292 | Ga0207676_100472922 | 143 |
| 250 | 3300026116 | Ga0207674_10000162 | Ga0207674_1000016211 | 143 |
| 251 | 3300026116 | Ga0207674_10135891 | Ga0207674_101358913 | 143 |
| 252 | 3300026121 | Ga0207683_10171709 | Ga0207683_101717093 | 143 |
| 253 | 3300026121 | Ga0207683_10302315 | Ga0207683_103023153 | 143 |
| 254 | 3300026121 | Ga0207683_10830362 | Ga0207683_108303621 | 143 |
| 255 | 3300026121 | Ga0207683_10865263 | Ga0207683_108652632 | 143 |
| 256 | 3300028379 | Ga0268266_10002593 | Ga0268266_1000259314 | 143 |
| 257 | 3300028379 | Ga0268266_10004325 | Ga0268266_100043256 | 143 |
| 258 | 3300028379 | Ga0268266_10091645 | Ga0268266_100916453 | 143 |
| 259 | 3300028380 | Ga0268265_10238480 | Ga0268265_102384802 | 143 |
| 260 | 3300028380 | Ga0268265_10467797 | Ga0268265_104677972 | 143 |
| 261 | 3300028381 | Ga0268264_10026196 | Ga0268264_100261965 | 143 |
| 262 | 3300028381 | Ga0268264_10074643 | Ga0268264_100746432 | 143 |
| 263 | 3300031711 | Ga0265314_10091401 | Ga0265314_100914013 | 143 |
| 264 | 3300035090 | Ga0373949_0210400 | Ga0373949_0210400_74_511 | 143 |
| 265 | 3300035691 | Ga0373931_0804859 | Ga0373931_0804859_120_557 | 143 |
| 266 | 3300046472 | Ga0495580_0274657 | Ga0495580_0274657_172_609 | 143 |
| 267 | 3300046472 | Ga0495580_0476479 | Ga0495580_0476479_76_513 | 143 |
| 268 | 3300048907 | Ga0496104_0329011 | Ga0496104_0329011_624_1055 | 143 |
| 269 | 3300048908 | Ga0496105_0710367 | Ga0496105_0710367_218_649 | 143 |
| 270 | 3300048909 | Ga0496106_0313535 | Ga0496106_0313535_14_445 | 143 |
| 271 | 3300048911 | Ga0496108_0000203 | Ga0496108_0000203_22151_22582 | 143 |
| 272 | 3300048912 | Ga0496109_0000099 | Ga0496109_0000099_11068_11499 | 143 |
| 273 | 3300048913 | Ga0496110_0000189 | Ga0496110_0000189_33891_34322 | 143 |
| 274 | 3300048915 | Ga0496112_0000048 | Ga0496112_0000048_65499_65930 | 143 |
| 275 | 3300048915 | Ga0496112_0136515 | Ga0496112_0136515_901_1332 | 143 |
| 276 | 3300048915 | Ga0496112_0286462 | Ga0496112_0286462_939_1376 | 143 |
| 277 | 3300048916 | Ga0496113_0000655 | Ga0496113_0000655_2274_2705 | 143 |
| 278 | 3300048917 | Ga0496114_1130259 | Ga0496114_1130259_46_492 | 143 |
| 279 | 3300048918 | Ga0496115_0174282 | Ga0496115_0174282_396_830 | 143 |
| 280 | 3300002459 | JGI24751J29686_10029818 | JGI24751J29686_100298182 | 144 |
| 281 | 3300005290 | Ga0065712_10093442 | Ga0065712_100934422 | 144 |
| 282 | 3300005293 | Ga0065715_10563036 | Ga0065715_105630362 | 144 |
| 283 | 3300005329 | Ga0070683_100030202 | Ga0070683_1000302025 | 144 |
| 284 | 3300005331 | Ga0070670_100016220 | Ga0070670_1000162205 | 144 |
| 285 | 3300005333 | Ga0070677_10508390 | Ga0070677_105083901 | 144 |
| 286 | 3300005334 | Ga0068869_100000409 | Ga0068869_10000040919 | 144 |
| 287 | 3300005335 | Ga0070666_10069427 | Ga0070666_100694273 | 144 |
| 288 | 3300005340 | Ga0070689_100040215 | Ga0070689_1000402153 | 144 |
| 289 | 3300005344 | Ga0070661_100001327 | Ga0070661_10000132714 | 144 |
| 290 | 3300005353 | Ga0070669_100318175 | Ga0070669_1003181752 | 144 |
| 291 | 3300005354 | Ga0070675_100025351 | Ga0070675_1000253513 | 144 |
| 292 | 3300005355 | Ga0070671_100007177 | Ga0070671_1000071777 | 144 |
| 293 | 3300005364 | Ga0070673_100052363 | Ga0070673_1000523634 | 144 |
| 294 | 3300005367 | Ga0070667_100439257 | Ga0070667_1004392572 | 144 |
| 295 | 3300005445 | Ga0070708_100459365 | Ga0070708_1004593652 | 144 |
| 296 | 3300005445 | Ga0070708_100731770 | Ga0070708_1007317702 | 144 |
| 297 | 3300005445 | Ga0070708_101115838 | Ga0070708_1011158381 | 144 |
| 298 | 3300005455 | Ga0070663_100006247 | Ga0070663_1000062475 | 144 |
| 299 | 3300005456 | Ga0070678_100137565 | Ga0070678_1001375652 | 144 |
| 300 | 3300005457 | Ga0070662_100153755 | Ga0070662_1001537553 | 144 |
| 301 | 3300005467 | Ga0070706_101321617 | Ga0070706_1013216171 | 144 |
| 302 | 3300005468 | Ga0070707_100313841 | Ga0070707_1003138412 | 144 |
| 303 | 3300005468 | Ga0070707_100333620 | Ga0070707_1003336203 | 144 |
| 304 | 3300005468 | Ga0070707_100606167 | Ga0070707_1006061672 | 144 |
| 305 | 3300005468 | Ga0070707_100827794 | Ga0070707_1008277942 | 144 |
| 306 | 3300005518 | Ga0070699_100071496 | Ga0070699_1000714964 | 144 |
| 307 | 3300005518 | Ga0070699_100816350 | Ga0070699_1008163502 | 144 |
| 308 | 3300005535 | Ga0070684_100011359 | Ga0070684_1000113595 | 144 |
| 309 | 3300005536 | Ga0070697_100037401 | Ga0070697_1000374015 | 144 |
| 310 | 3300005536 | Ga0070697_100357835 | Ga0070697_1003578352 | 144 |
| 311 | 3300005536 | Ga0070697_100843605 | Ga0070697_1008436052 | 144 |
| 312 | 3300005539 | Ga0068853_100864201 | Ga0068853_1008642012 | 144 |
| 313 | 3300005543 | Ga0070672_100053169 | Ga0070672_1000531691 | 144 |
| 314 | 3300005548 | Ga0070665_100341015 | Ga0070665_1003410152 | 144 |
| 315 | 3300005548 | Ga0070665_100528433 | Ga0070665_1005284332 | 144 |
| 316 | 3300005563 | Ga0068855_101152603 | Ga0068855_1011526032 | 144 |
| 317 | 3300005564 | Ga0070664_100088765 | Ga0070664_1000887653 | 144 |
| 318 | 3300005577 | Ga0068857_100039101 | Ga0068857_1000391015 | 144 |
| 319 | 3300005614 | Ga0068856_100466041 | Ga0068856_1004660412 | 144 |
| 320 | 3300005617 | Ga0068859_100027742 | Ga0068859_1000277425 | 144 |
| 321 | 3300005618 | Ga0068864_100000879 | Ga0068864_1000008793 | 144 |
| 322 | 3300005834 | Ga0068851_10064091 | Ga0068851_100640912 | 144 |
| 323 | 3300005841 | Ga0068863_100001146 | Ga0068863_1000011465 | 144 |
| 324 | 3300005842 | Ga0068858_100129986 | Ga0068858_1001299862 | 144 |
| 325 | 3300005843 | Ga0068860_100263516 | Ga0068860_1002635163 | 144 |
| 326 | 3300005844 | Ga0068862_100012726 | Ga0068862_1000127265 | 144 |
| 327 | 3300006237 | Ga0097621_100457443 | Ga0097621_1004574432 | 144 |
| 328 | 3300006358 | Ga0068871_100575988 | Ga0068871_1005759882 | 144 |
| 329 | 3300006931 | Ga0097620_100027739 | Ga0097620_1000277394 | 144 |
| 330 | 3300013297 | Ga0157378_11764267 | Ga0157378_117642672 | 144 |
| 331 | 3300025321 | Ga0207656_10051857 | Ga0207656_100518571 | 144 |
| 332 | 3300025903 | Ga0207680_10526781 | Ga0207680_105267812 | 144 |
| 333 | 3300025904 | Ga0207647_10086788 | Ga0207647_100867882 | 144 |
| 334 | 3300025907 | Ga0207645_10032967 | Ga0207645_100329673 | 144 |
| 335 | 3300025910 | Ga0207684_10828551 | Ga0207684_108285512 | 144 |
| 336 | 3300025919 | Ga0207657_10182423 | Ga0207657_101824232 | 144 |
| 337 | 3300025920 | Ga0207649_10000151 | Ga0207649_1000015145 | 144 |
| 338 | 3300025922 | Ga0207646_10172462 | Ga0207646_101724622 | 144 |
| 339 | 3300025922 | Ga0207646_10304352 | Ga0207646_103043522 | 144 |
| 340 | 3300025925 | Ga0207650_10000024 | Ga0207650_10000024169 | 144 |
| 341 | 3300025926 | Ga0207659_10014083 | Ga0207659_100140835 | 144 |
| 342 | 3300025928 | Ga0207700_10703522 | Ga0207700_107035222 | 144 |
| 343 | 3300025929 | Ga0207664_11137582 | Ga0207664_111375822 | 144 |
| 344 | 3300025931 | Ga0207644_10036203 | Ga0207644_100362031 | 144 |
| 345 | 3300025931 | Ga0207644_10334366 | Ga0207644_103343662 | 144 |
| 346 | 3300025932 | Ga0207690_10032963 | Ga0207690_100329632 | 144 |
| 347 | 3300025933 | Ga0207706_10108976 | Ga0207706_101089762 | 144 |
| 348 | 3300025940 | Ga0207691_10013168 | Ga0207691_100131685 | 144 |
| 349 | 3300025941 | Ga0207711_10007700 | Ga0207711_100077005 | 144 |
| 350 | 3300025942 | Ga0207689_10000160 | Ga0207689_1000016040 | 144 |
| 351 | 3300025944 | Ga0207661_10000324 | Ga0207661_100003244 | 144 |
| 352 | 3300025945 | Ga0207679_10000040 | Ga0207679_1000004030 | 144 |
| 353 | 3300025949 | Ga0207667_11274610 | Ga0207667_112746101 | 144 |
| 354 | 3300025960 | Ga0207651_10023563 | Ga0207651_100235634 | 144 |
| 355 | 3300025986 | Ga0207658_10041674 | Ga0207658_100416743 | 144 |
| 356 | 3300026041 | Ga0207639_11082603 | Ga0207639_110826032 | 144 |
| 357 | 3300026078 | Ga0207702_10155987 | Ga0207702_101559873 | 144 |
| 358 | 3300026088 | Ga0207641_10000030 | Ga0207641_10000030103 | 144 |
| 359 | 3300026095 | Ga0207676_10000134 | Ga0207676_1000013451 | 144 |
| 360 | 3300026116 | Ga0207674_10000069 | Ga0207674_1000006968 | 144 |
| 361 | 3300026121 | Ga0207683_10041785 | Ga0207683_100417853 | 144 |
| 362 | 3300026142 | Ga0207698_10111856 | Ga0207698_101118563 | 144 |
| 363 | 3300028379 | Ga0268266_10001493 | Ga0268266_100014935 | 144 |
| 364 | 3300028379 | Ga0268266_10297539 | Ga0268266_102975392 | 144 |
| 365 | 3300028380 | Ga0268265_10002498 | Ga0268265_100024986 | 144 |
| 366 | 3300028381 | Ga0268264_10011195 | Ga0268264_100111956 | 144 |
| 367 | 3300028381 | Ga0268264_10426613 | Ga0268264_104266132 | 144 |
| 368 | 3300031090 | Ga0265760_10037080 | Ga0265760_100370802 | 144 |
| 369 | 3300031241 | Ga0265325_10015501 | Ga0265325_100155016 | 144 |
| 370 | 3300031241 | Ga0265325_10076353 | Ga0265325_100763532 | 144 |
| 371 | 3300031241 | Ga0265325_10314704 | Ga0265325_103147041 | 144 |
| 372 | 3300031247 | Ga0265340_10061514 | Ga0265340_100615142 | 144 |
| 373 | 3300031250 | Ga0265331_10123567 | Ga0265331_101235672 | 144 |
| 374 | 3300031344 | Ga0265316_10379923 | Ga0265316_103799232 | 144 |
| 375 | 3300031711 | Ga0265314_10098120 | Ga0265314_100981202 | 144 |
| 376 | 3300046472 | Ga0495580_0423761 | Ga0495580_0423761_130_582 | 144 |
| 377 | 3300046472 | Ga0495580_0805390 | Ga0495580_0805390_62_502 | 144 |
| 378 | 3300046473 | Ga0495582_0356335 | Ga0495582_0356335_129_578 | 144 |
| 379 | 3300048907 | Ga0496104_0792653 | Ga0496104_0792653_37_486 | 144 |
| 380 | 3300048908 | Ga0496105_0294233 | Ga0496105_0294233_490_939 | 144 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6anw-assembly3.cif.gz_C | crystal structure of anti-crispr protein acrf10 | 0.7828 | 25 | 63 |
| 3k5l-assembly1.cif.gz_A | crystal structure of e.coli pol ii-abasic dna-datp lt(0, 3) ternary complex | 0.7628 | 18 | 62 |
| 3o6z-assembly1.cif.gz_B | structure of the d152a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ | 0.7435 | 25 | 63 |
| 8a98-assembly1.cif.gz_Sd | cryo-em structure of leishmania major 80s ribosome : snorna mutant | 0.7269 | 23 | 63 |
| 4bts-assembly1.cif.gz_A1 | the crystal structure of the eukaryotic 40s ribosomal subunit in complex with eif1 and eif1a | 0.7111 | 20 | 63 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09693_316_432_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.7449 | 23 | 61 | 3.30.460.10 |
| af_F4I201_85_164_3.10.450.10 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7221 | 20 | 66 | 3.10.450.10 |
| af_Q9T0E2_110_356_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.7143 | 30 | 63 | 2.120.10.80 |
| af_Q8GXH3_99_172_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7121 | 21 | 63 | 2.40.50.140 |
| 3lygA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7083 | 18 | 63 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3L024-F1-model_v4 | Uncharacterized protein | 0.7766 | 1 | 141 |
|
| AF-A0A2N9L2X4-F1-model_v4 | Uncharacterized protein | 0.7691 | 1 | 144 |
|
| AF-A0A2U3L024-F1-model_v4 | Uncharacterized protein | 0.7666 | 1 | 141 |
|
| AF-A0A2N9L2X4-F1-model_v4 | Uncharacterized protein | 0.7642 | 1 | 144 |
|
| AF-A0A2I1HAA4-F1-model_v4 | Uncharacterized protein | 0.7624 | 23 | 63 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar