F428735

General Info

Members Datasets Scaffolds Average Seq Length
380 154 380 144

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0971888|Ga0436360_0971888_32_529
Length 165
Sequence MKRHIEGLNQTREAGGTSVPDGLFLVRVDRAQYRWHAQKPFYLLRLSVLEPQEFAGRTISGRVYCTSKALWKLGWFLRDFLYDPESLGREEVDEKALTGLRGVVKISHSTVKGNSLLNFDGFAPASQWEELSCTYKRSSGVASCRTALPKLRSTSPAPDVIDIAI

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.05
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10029818 3300002459 Unclassified 1132
2 Ga0065712_10093442 3300005290 Unclassified 2292
3 Ga0065712_10572179 3300005290 Unclassified 606
4 Ga0065715_10563036 3300005293 Unclassified 732
5 Ga0070683_100002123 3300005329 Bacteria 15651
6 Ga0070683_100030202 3300005329 Bacteria 4915
7 Ga0070670_100016220 3300005331 Bacteria 6396
8 Ga0070670_100082408 3300005331 Unclassified 2764
9 Ga0070670_100412425 3300005331 Bacteria 1193
10 Ga0070677_10508390 3300005333 Unclassified 654
11 Ga0068869_100000409 3300005334 Bacteria 23378
12 Ga0068869_100002923 3300005334 Bacteria 10365
13 Ga0068869_100189148 3300005334 Bacteria 1618
14 Ga0068869_100215844 3300005334 Bacteria 1518
15 Ga0068869_100763411 3300005334 Unclassified 829
16 Ga0070666_10033227 3300005335 Bacteria 3412
17 Ga0070666_10069427 3300005335 Bacteria 2396
18 Ga0070682_101463440 3300005337 Unclassified 586
19 Ga0068868_100157638 3300005338 Viruses 1873
20 Ga0070660_100062066 3300005339 Unclassified 2902
21 Ga0070660_100633898 3300005339 Bacteria 895
22 Ga0070660_100995331 3300005339 Unclassified 708
23 Ga0070689_100006429 3300005340 Bacteria 8129
24 Ga0070689_100040215 3300005340 Bacteria 3584
25 Ga0070689_100188786 3300005340 Bacteria 1677
26 Ga0070687_100010174 3300005343 Bacteria 4056
27 Ga0070661_100001327 3300005344 Bacteria 17332
28 Ga0070661_100005018 3300005344 Bacteria 9120
29 Ga0070669_100011144 3300005353 Bacteria 6381
30 Ga0070669_100318175 3300005353 Bacteria 1256
31 Ga0070675_100025351 3300005354 Bacteria 4754
32 Ga0070675_100120243 3300005354 Unclassified 2231
33 Ga0070675_100432706 3300005354 Bacteria 1178
34 Ga0070675_100685082 3300005354 Unclassified 933
35 Ga0070671_100007177 3300005355 Bacteria 8906
36 Ga0070671_100017553 3300005355 Bacteria 5799
37 Ga0070671_100277818 3300005355 Bacteria 1424
38 Ga0070671_101029449 3300005355 Unclassified 722
39 Ga0070671_101543199 3300005355 Unclassified 588
40 Ga0070673_100000589 3300005364 Bacteria 19744
41 Ga0070673_100052363 3300005364 Unclassified 3202
42 Ga0070673_101380307 3300005364 Unclassified 663
43 Ga0070688_100002679 3300005365 Bacteria 9041
44 Ga0070659_100223092 3300005366 Bacteria 1556
45 Ga0070659_100689654 3300005366 Unclassified 882
46 Ga0070667_100013226 3300005367 Bacteria 6819
47 Ga0070667_100020313 3300005367 Bacteria 5513
48 Ga0070667_100439257 3300005367 Bacteria 1191
49 Ga0070667_101756514 3300005367 Unclassified 584
50 Ga0070713_101016703 3300005436 Unclassified 800
51 Ga0070713_101924137 3300005436 Bacteria 574
52 Ga0070701_10101954 3300005438 Unclassified 1591
53 Ga0070711_100614880 3300005439 Bacteria 908
54 Ga0070711_101174598 3300005439 Bacteria 663
55 Ga0070711_101825231 3300005439 Unclassified 534
56 Ga0070708_100459365 3300005445 Unclassified 1201
57 Ga0070708_100731770 3300005445 Unclassified 930
58 Ga0070708_101115838 3300005445 Bacteria 739
59 Ga0070663_100001276 3300005455 Bacteria 13788
60 Ga0070663_100006247 3300005455 Bacteria 7143
61 Ga0070663_100104315 3300005455 Bacteria 2120
62 Ga0070663_100106632 3300005455 Bacteria 2099
63 Ga0070678_100039990 3300005456 Unclassified 3314
64 Ga0070678_100082809 3300005456 Unclassified 2437
65 Ga0070678_100137565 3300005456 Unclassified 1950
66 Ga0070678_100534094 3300005456 Bacteria 1039
67 Ga0070678_100826398 3300005456 Unclassified 843
68 Ga0070678_101143584 3300005456 Unclassified 720
69 Ga0070678_101216981 3300005456 Bacteria 699
70 Ga0070678_101527019 3300005456 Bacteria 626
71 Ga0070662_100153755 3300005457 Bacteria 1794
72 Ga0070662_101173372 3300005457 Unclassified 660
73 Ga0070685_10003008 3300005466 Bacteria 8595
74 Ga0070706_101321617 3300005467 Unclassified 661
75 Ga0070706_101377493 3300005467 Unclassified 646
76 Ga0070707_100313841 3300005468 Bacteria 1524
77 Ga0070707_100333620 3300005468 Unclassified 1473
78 Ga0070707_100606167 3300005468 Unclassified 1057
79 Ga0070707_100827794 3300005468 Bacteria 890
80 Ga0070699_100071496 3300005518 Bacteria 3017
81 Ga0070699_100110719 3300005518 Unclassified 2411
82 Ga0070699_100816350 3300005518 Bacteria 853
83 Ga0070684_100000936 3300005535 Bacteria 20753
84 Ga0070684_100011359 3300005535 Bacteria 7092
85 Ga0070684_100051695 3300005535 Bacteria 3571
86 Ga0070697_100037401 3300005536 Bacteria 3921
87 Ga0070697_100357835 3300005536 Unclassified 1262
88 Ga0070697_100843605 3300005536 Unclassified 812
89 Ga0068853_100152117 3300005539 Unclassified 2083
90 Ga0068853_100413700 3300005539 Bacteria 1264
91 Ga0068853_100864201 3300005539 Unclassified 868
92 Ga0068853_101728320 3300005539 Unclassified 606
93 Ga0070672_100000364 3300005543 Bacteria 26086
94 Ga0070672_100053169 3300005543 Bacteria 3165
95 Ga0070672_100237810 3300005543 Bacteria 1531
96 Ga0070665_100010125 3300005548 Bacteria 9536
97 Ga0070665_100027710 3300005548 Bacteria 5704
98 Ga0070665_100313192 3300005548 Bacteria 1573
99 Ga0070665_100341015 3300005548 Unclassified 1503
100 Ga0070665_100528433 3300005548 Bacteria 1191
101 Ga0068855_100634745 3300005563 Unclassified 1149
102 Ga0068855_100952528 3300005563 Unclassified 904
103 Ga0068855_101152603 3300005563 Unclassified 808
104 Ga0070664_100002544 3300005564 Bacteria 14706
105 Ga0070664_100088765 3300005564 Bacteria 2673
106 Ga0070664_100202403 3300005564 Bacteria 1772
107 Ga0070664_100441041 3300005564 Bacteria 1194
108 Ga0070664_100751011 3300005564 Bacteria 910
109 Ga0068857_100001315 3300005577 Bacteria 19544
110 Ga0068857_100039101 3300005577 Bacteria 4201
111 Ga0068857_100177156 3300005577 Viruses 1940
112 Ga0068856_100455902 3300005614 Unclassified 1299
113 Ga0068856_100466041 3300005614 Unclassified 1284
114 Ga0068859_100003313 3300005617 Bacteria 16365
115 Ga0068859_100027742 3300005617 Bacteria 5679
116 Ga0068859_101165852 3300005617 Unclassified 848
117 Ga0068864_100000879 3300005618 Bacteria 25306
118 Ga0068864_100001704 3300005618 Bacteria 18071
119 Ga0068864_100023451 3300005618 Bacteria 5182
120 Ga0068851_10064091 3300005834 Bacteria 1888
121 Ga0068851_10146762 3300005834 Bacteria 1287
122 Ga0068851_10757081 3300005834 Unclassified 601
123 Ga0068863_100001146 3300005841 Bacteria 26467
124 Ga0068863_100002863 3300005841 Bacteria 17081
125 Ga0068863_100006619 3300005841 Bacteria 11374
126 Ga0068863_100028502 3300005841 Bacteria 5332
127 Ga0068858_100008599 3300005842 Bacteria 9805
128 Ga0068858_100035570 3300005842 Bacteria 4620
129 Ga0068858_100129986 3300005842 Bacteria 2361
130 Ga0068860_100014700 3300005843 Bacteria 7656
131 Ga0068860_100262525 3300005843 Bacteria 1684
132 Ga0068860_100263516 3300005843 Bacteria 1680
133 Ga0068862_100003035 3300005844 Bacteria 14617
134 Ga0068862_100012726 3300005844 Bacteria 6965
135 Ga0068862_100490190 3300005844 Bacteria 1165
136 Ga0068862_101532115 3300005844 Unclassified 672
137 Ga0070717_10204280 3300006028 Unclassified 1732
138 Ga0070716_100061546 3300006173 Bacteria 2173
139 Ga0070716_100092249 3300006173 Bacteria 1836
140 Ga0070712_100413765 3300006175 Bacteria 1116
141 Ga0070712_100847440 3300006175 Unclassified 786
142 Ga0070712_100990530 3300006175 Unclassified 727
143 Ga0070712_101229031 3300006175 Bacteria 652
144 Ga0097621_100008738 3300006237 Bacteria 7318
145 Ga0097621_100107277 3300006237 Unclassified 2356
146 Ga0097621_100457443 3300006237 Unclassified 1151
147 Ga0097621_100471820 3300006237 Unclassified 1133
148 Ga0097621_100777067 3300006237 Unclassified 886
149 Ga0068871_100009017 3300006358 Bacteria 7205
150 Ga0068871_100040381 3300006358 Unclassified 3737
151 Ga0068871_100575988 3300006358 Unclassified 1022
152 Ga0068871_100747598 3300006358 Bacteria 899
153 Ga0068871_101627521 3300006358 Unclassified 612
154 Ga0068871_101886123 3300006358 Unclassified 568
155 Ga0068865_100293889 3300006881 Bacteria 1298
156 Ga0097620_100003313 3300006931 Bacteria 16365
157 Ga0097620_100027739 3300006931 Bacteria 5679
158 Ga0097620_101165790 3300006931 Unclassified 848
159 Ga0105240_10059547 3300009093 Bacteria 4765
160 Ga0105240_10515449 3300009093 Unclassified 1328
161 Ga0105240_11454005 3300009093 Bacteria 719
162 Ga0105245_10787245 3300009098 Bacteria 988
163 Ga0105247_10061835 3300009101 Unclassified 2322
164 Ga0105247_10262437 3300009101 Bacteria 1185
165 Ga0105241_10623777 3300009174 Bacteria 976
166 Ga0105248_10012614 3300009177 Bacteria 9325
167 Ga0105248_10053886 3300009177 Bacteria 4512
168 Ga0105237_10208570 3300009545 Unclassified 1954
169 Ga0105237_10521327 3300009545 Bacteria 1195
170 Ga0105238_10138229 3300009551 Unclassified 2414
171 Ga0105238_11230387 3300009551 Bacteria 774
172 Ga0105249_10149244 3300009553 Bacteria 2249
173 Ga0105239_11214318 3300010375 Unclassified 869
174 Ga0105239_11254655 3300010375 Unclassified 854
175 Ga0105239_11513281 3300010375 Unclassified 775
176 Ga0105246_10001222 3300011119 Bacteria 15046
177 Ga0157371_10139666 3300013102 Unclassified 1726
178 Ga0157369_10042779 3300013105 Unclassified 4942
179 Ga0157369_10410550 3300013105 Unclassified 1404
180 Ga0157369_10535810 3300013105 Unclassified 1210
181 Ga0157369_12217555 3300013105 Unclassified 557
182 Ga0157374_10000388 3300013296 Bacteria 40353
183 Ga0157374_10013013 3300013296 Bacteria 7255
184 Ga0157374_10026180 3300013296 Bacteria 5246
185 Ga0157374_10264758 3300013296 Bacteria 1694
186 Ga0157374_10320207 3300013296 Bacteria 1537
187 Ga0157374_11097825 3300013296 Bacteria 816
188 Ga0157374_11560319 3300013296 Unclassified 684
189 Ga0157378_10028929 3300013297 Unclassified 4891
190 Ga0157378_10146694 3300013297 Bacteria 2195
191 Ga0157378_10958216 3300013297 Bacteria 888
192 Ga0157378_11725898 3300013297 Unclassified 673
193 Ga0157378_11764267 3300013297 Unclassified 667
194 Ga0163162_10077349 3300013306 Bacteria 3391
195 Ga0163162_10217306 3300013306 Bacteria 2042
196 Ga0157375_10010780 3300013308 Bacteria 8052
197 Ga0157375_11462829 3300013308 Unclassified 806
198 Ga0163163_10041481 3300014325 Unclassified 4500
199 Ga0163163_10504597 3300014325 Unclassified 1272
200 Ga0163163_10955916 3300014325 Unclassified 920
201 Ga0182008_10014395 3300014497 Plasmid 4142
202 Ga0182008_10080614 3300014497 Bacteria 1601
203 Ga0182008_10441774 3300014497 Unclassified 706
204 Ga0157377_10010765 3300014745 Bacteria 4538
205 Ga0157377_10327347 3300014745 Bacteria 1020
206 Ga0157377_10675957 3300014745 Unclassified 746
207 Ga0157379_10001205 3300014968 Bacteria 21029
208 Ga0157379_10034047 3300014968 Bacteria 4540
209 Ga0157376_10007265 3300014969 Bacteria 7890
210 Ga0157376_10490788 3300014969 Bacteria 1205
211 Ga0157376_11628929 3300014969 Unclassified 680
212 Ga0157376_11915127 3300014969 Unclassified 630
213 Ga0157376_12244543 3300014969 Unclassified 585
214 Ga0182007_10076635 3300015262 Unclassified 1096
215 Ga0182007_10130477 3300015262 Bacteria 845
216 Ga0182005_1047795 3300015265 Bacteria 1163
217 Ga0207656_10051857 3300025321 Bacteria 1775
218 Ga0207680_10526781 3300025903 Unclassified 843
219 Ga0207647_10011317 3300025904 Bacteria 6263
220 Ga0207647_10086788 3300025904 Bacteria 1870
221 Ga0207645_10027987 3300025907 Bacteria 3639
222 Ga0207645_10032967 3300025907 Bacteria 3330
223 Ga0207684_10828551 3300025910 Unclassified 781
224 Ga0207654_10441478 3300025911 Unclassified 911
225 Ga0207695_10050063 3300025913 Bacteria 4397
226 Ga0207695_10593861 3300025913 Unclassified 988
227 Ga0207693_10542867 3300025915 Unclassified 907
228 Ga0207693_10762321 3300025915 Unclassified 747
229 Ga0207693_10847743 3300025915 Unclassified 703
230 Ga0207693_11077547 3300025915 Bacteria 611
231 Ga0207663_10493225 3300025916 Bacteria 950
232 Ga0207657_10000660 3300025919 Bacteria 36719
233 Ga0207657_10182423 3300025919 Bacteria 1696
234 Ga0207657_10232234 3300025919 Unclassified 1475
235 Ga0207657_10931965 3300025919 Unclassified 668
236 Ga0207649_10000151 3300025920 Bacteria 56863
237 Ga0207649_10000513 3300025920 Bacteria 27268
238 Ga0207649_10193458 3300025920 Bacteria 1432
239 Ga0207646_10172462 3300025922 Unclassified 1953
240 Ga0207646_10304352 3300025922 Unclassified 1440
241 Ga0207646_10377468 3300025922 Unclassified 1281
242 Ga0207681_11020293 3300025923 Unclassified 694
243 Ga0207694_10403406 3300025924 Bacteria 1137
244 Ga0207650_10000024 3300025925 Bacteria 299184
245 Ga0207650_10000059 3300025925 Bacteria 151427
246 Ga0207650_10059278 3300025925 Bacteria 2853
247 Ga0207650_10082396 3300025925 Unclassified 2442
248 Ga0207659_10014083 3300025926 Bacteria 5149
249 Ga0207687_10442082 3300025927 Unclassified 1077
250 Ga0207687_10566587 3300025927 Unclassified 954
251 Ga0207687_11426267 3300025927 Unclassified 595
252 Ga0207700_10127471 3300025928 Unclassified 2073
253 Ga0207700_10134961 3300025928 Unclassified 2020
254 Ga0207700_10703522 3300025928 Bacteria 902
255 Ga0207664_10267751 3300025929 Unclassified 1496
256 Ga0207664_10908540 3300025929 Bacteria 790
257 Ga0207664_11137582 3300025929 Unclassified 697
258 Ga0207644_10036203 3300025931 Bacteria 3463
259 Ga0207644_10228070 3300025931 Unclassified 1479
260 Ga0207644_10334366 3300025931 Unclassified 1227
261 Ga0207644_11194942 3300025931 Unclassified 639
262 Ga0207690_10018279 3300025932 Unclassified 4298
263 Ga0207690_10032963 3300025932 Bacteria 3328
264 Ga0207706_10108976 3300025933 Bacteria 2437
265 Ga0207706_10807475 3300025933 Unclassified 797
266 Ga0207670_10078894 3300025936 Unclassified 2297
267 Ga0207704_10256067 3300025938 Bacteria 1317
268 Ga0207665_10047025 3300025939 Bacteria 2892
269 Ga0207665_10142066 3300025939 Bacteria 1713
270 Ga0207691_10013168 3300025940 Bacteria 7920
271 Ga0207691_10018001 3300025940 Bacteria 6689
272 Ga0207691_10088895 3300025940 Viruses 2770
273 Ga0207711_10005842 3300025941 Bacteria 10394
274 Ga0207711_10007700 3300025941 Bacteria 9004
275 Ga0207689_10000160 3300025942 Bacteria 57858
276 Ga0207689_10017588 3300025942 Bacteria 6043
277 Ga0207689_10110301 3300025942 Bacteria 2261
278 Ga0207689_10145776 3300025942 Viruses 1951
279 Ga0207661_10000324 3300025944 Bacteria 30399
280 Ga0207661_10004533 3300025944 Bacteria 9733
281 Ga0207661_10032116 3300025944 Viruses 4065
282 Ga0207679_10000040 3300025945 Bacteria 127317
283 Ga0207679_10001027 3300025945 Bacteria 17836
284 Ga0207679_10019557 3300025945 Bacteria 4552
285 Ga0207679_10323864 3300025945 Bacteria 1335
286 Ga0207667_10645080 3300025949 Unclassified 1065
287 Ga0207667_11274610 3300025949 Unclassified 712
288 Ga0207651_10003853 3300025960 Bacteria 7443
289 Ga0207651_10023563 3300025960 Bacteria 3790
290 Ga0207651_10199486 3300025960 Bacteria 1602
291 Ga0207658_10041674 3300025986 Bacteria 3326
292 Ga0207658_10311122 3300025986 Bacteria 1360
293 Ga0207677_10026864 3300026023 Bacteria 3616
294 Ga0207677_10043307 3300026023 Viruses 2992
295 Ga0207703_10010559 3300026035 Bacteria 7219
296 Ga0207703_10052024 3300026035 Bacteria 3323
297 Ga0207639_10851495 3300026041 Unclassified 851
298 Ga0207639_11020743 3300026041 Bacteria 775
299 Ga0207639_11082603 3300026041 Unclassified 751
300 Ga0207678_10013492 3300026067 Bacteria 7174
301 Ga0207678_10027779 3300026067 Unclassified 4940
302 Ga0207678_10624656 3300026067 Bacteria 945
303 Ga0207702_10155987 3300026078 Bacteria 2081
304 Ga0207641_10000025 3300026088 Bacteria 247727
305 Ga0207641_10000030 3300026088 Bacteria 224468
306 Ga0207641_10014807 3300026088 Bacteria 6393
307 Ga0207641_10022146 3300026088 Bacteria 5229
308 Ga0207676_10000134 3300026095 Bacteria 65594
309 Ga0207676_10000160 3300026095 Bacteria 58979
310 Ga0207676_10047292 3300026095 Bacteria 3333
311 Ga0207674_10000069 3300026116 Bacteria 106470
312 Ga0207674_10000162 3300026116 Bacteria 79631
313 Ga0207674_10135891 3300026116 Viruses 2421
314 Ga0207674_11739566 3300026116 Unclassified 591
315 Ga0207683_10041785 3300026121 Unclassified 4004
316 Ga0207683_10171709 3300026121 Unclassified 1964
317 Ga0207683_10302315 3300026121 Bacteria 1464
318 Ga0207683_10830362 3300026121 Unclassified 858
319 Ga0207683_10865263 3300026121 Bacteria 839
320 Ga0207698_10111856 3300026142 Bacteria 2291
321 Ga0207698_11176673 3300026142 Bacteria 780
322 Ga0268266_10001493 3300028379 Bacteria 27650
323 Ga0268266_10002593 3300028379 Bacteria 19155
324 Ga0268266_10004325 3300028379 Bacteria 13659
325 Ga0268266_10091645 3300028379 Viruses 2665
326 Ga0268266_10297539 3300028379 Unclassified 1504
327 Ga0268265_10002498 3300028380 Bacteria 13798
328 Ga0268265_10238480 3300028380 Bacteria 1603
329 Ga0268265_10467797 3300028380 Bacteria 1181
330 Ga0268264_10011195 3300028381 Bacteria 7410
331 Ga0268264_10026196 3300028381 Unclassified 4762
332 Ga0268264_10074643 3300028381 Viruses 2881
333 Ga0268264_10426613 3300028381 Bacteria 1280
334 Ga0265760_10037080 3300031090 Bacteria 1447
335 Ga0265325_10015501 3300031241 Unclassified 4284
336 Ga0265325_10076353 3300031241 Archaea 1672
337 Ga0265325_10314704 3300031241 Bacteria 696
338 Ga0265340_10061514 3300031247 Unclassified 1796
339 Ga0265331_10123567 3300031250 Bacteria 1183
340 Ga0265316_10379923 3300031344 Bacteria 1019
341 Ga0265314_10091401 3300031711 Bacteria 1981
342 Ga0265314_10098120 3300031711 Unclassified 1891
343 Ga0373949_0210400 3300035090 Unclassified 587
344 Ga0373931_0804859 3300035691 Unclassified 627
345 Ga0436360_0971888 3300039438 Unclassified 927
346 Ga0436363_0389171 3300039450 Unclassified 629
347 Ga0451577_0312260 3300042876 Bacteria 1425
348 Ga0453684_1083238 3300044712 Bacteria 848
349 Ga0451576_0571706 3300045051 Unclassified 1188
350 Ga0451576_1228753 3300045051 Unclassified 782
351 Ga0466967_0683707 3300045976 Bacteria 1016
352 Ga0495629_0718467 3300046459 Unclassified 663
353 Ga0495580_0274657 3300046472 Unclassified 1150
354 Ga0495580_0423761 3300046472 Unclassified 895
355 Ga0495580_0476479 3300046472 Unclassified 835
356 Ga0495580_0805390 3300046472 Unclassified 609
357 Ga0495582_0356335 3300046473 Unclassified 843
358 Ga0496100_0289444 3300048903 Bacteria 1224
359 Ga0496102_1013846 3300048905 Bacteria 751
360 Ga0496104_0329011 3300048907 Unclassified 1441
361 Ga0496104_0792653 3300048907 Unclassified 854
362 Ga0496104_0887236 3300048907 Unclassified 797
363 Ga0496105_0294233 3300048908 Unclassified 1307
364 Ga0496105_0710367 3300048908 Unclassified 771
365 Ga0496106_0313535 3300048909 Unclassified 1259
366 Ga0496108_0000203 3300048911 Bacteria 54921
367 Ga0496109_0000099 3300048912 Bacteria 89901
368 Ga0496109_0790679 3300048912 Unclassified 887
369 Ga0496110_0000189 3300048913 Bacteria 38583
370 Ga0496111_0092356 3300048914 Bacteria 2219
371 Ga0496112_0000048 3300048915 Bacteria 84789
372 Ga0496112_0046659 3300048915 Plasmid 4250
373 Ga0496112_0090889 3300048915 Bacteria 3022
374 Ga0496112_0118386 3300048915 Bacteria 2619
375 Ga0496112_0136515 3300048915 Bacteria 2422
376 Ga0496112_0286462 3300048915 Bacteria 1594
377 Ga0496113_0000655 3300048916 Bacteria 17490
378 Ga0496113_0168928 3300048916 Bacteria 1732
379 Ga0496114_1130259 3300048917 Unclassified 669
380 Ga0496115_0174282 3300048918 Bacteria 1778

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025916 Ga0207663_10493225 Ga0207663_104932252 133
2 3300042876 Ga0451577_0312260 Ga0451577_0312260_662_1072 135
3 3300014745 Ga0157377_10675957 Ga0157377_106759571 140
4 3300045976 Ga0466967_0683707 Ga0466967_0683707_289_714 140
5 3300006173 Ga0070716_100092249 Ga0070716_1000922492 141
6 3300025922 Ga0207646_10377468 Ga0207646_103774682 141
7 3300025939 Ga0207665_10142066 Ga0207665_101420662 141
8 3300039438 Ga0436360_0971888 Ga0436360_0971888_32_529 141
9 3300005290 Ga0065712_10572179 Ga0065712_105721791 142
10 3300005334 Ga0068869_100763411 Ga0068869_1007634112 142
11 3300005337 Ga0070682_101463440 Ga0070682_1014634401 142
12 3300005339 Ga0070660_100633898 Ga0070660_1006338982 142
13 3300005339 Ga0070660_100995331 Ga0070660_1009953311 142
14 3300005354 Ga0070675_100432706 Ga0070675_1004327062 142
15 3300005355 Ga0070671_100277818 Ga0070671_1002778182 142
16 3300005355 Ga0070671_101543199 Ga0070671_1015431991 142
17 3300005364 Ga0070673_101380307 Ga0070673_1013803071 142
18 3300005366 Ga0070659_100223092 Ga0070659_1002230923 142
19 3300005366 Ga0070659_100689654 Ga0070659_1006896542 142
20 3300005456 Ga0070678_101216981 Ga0070678_1012169812 142
21 3300005457 Ga0070662_101173372 Ga0070662_1011733722 142
22 3300005467 Ga0070706_101377493 Ga0070706_1013774932 142
23 3300005539 Ga0068853_100413700 Ga0068853_1004137002 142
24 3300005563 Ga0068855_100634745 Ga0068855_1006347452 142
25 3300005563 Ga0068855_100952528 Ga0068855_1009525282 142
26 3300005564 Ga0070664_100751011 Ga0070664_1007510111 142
27 3300005614 Ga0068856_100455902 Ga0068856_1004559022 142
28 3300005834 Ga0068851_10146762 Ga0068851_101467622 142
29 3300005834 Ga0068851_10757081 Ga0068851_107570812 142
30 3300006358 Ga0068871_101627521 Ga0068871_1016275212 142
31 3300009093 Ga0105240_10059547 Ga0105240_100595473 142
32 3300009093 Ga0105240_10515449 Ga0105240_105154492 142
33 3300009093 Ga0105240_11454005 Ga0105240_114540052 142
34 3300009174 Ga0105241_10623777 Ga0105241_106237772 142
35 3300009545 Ga0105237_10521327 Ga0105237_105213272 142
36 3300009551 Ga0105238_10138229 Ga0105238_101382294 142
37 3300009551 Ga0105238_11230387 Ga0105238_112303872 142
38 3300010375 Ga0105239_11214318 Ga0105239_112143182 142
39 3300010375 Ga0105239_11513281 Ga0105239_115132811 142
40 3300013105 Ga0157369_12217555 Ga0157369_122175552 142
41 3300013296 Ga0157374_10026180 Ga0157374_100261805 142
42 3300013296 Ga0157374_10264758 Ga0157374_102647583 142
43 3300013296 Ga0157374_11560319 Ga0157374_115603191 142
44 3300013297 Ga0157378_10146694 Ga0157378_101466943 142
45 3300013297 Ga0157378_10958216 Ga0157378_109582162 142
46 3300013297 Ga0157378_11725898 Ga0157378_117258981 142
47 3300014325 Ga0163163_10955916 Ga0163163_109559162 142
48 3300014497 Ga0182008_10014395 Ga0182008_100143956 142
49 3300014497 Ga0182008_10080614 Ga0182008_100806142 142
50 3300014497 Ga0182008_10441774 Ga0182008_104417742 142
51 3300014969 Ga0157376_11915127 Ga0157376_119151272 142
52 3300015262 Ga0182007_10076635 Ga0182007_100766352 142
53 3300015262 Ga0182007_10130477 Ga0182007_101304772 142
54 3300015265 Ga0182005_1047795 Ga0182005_10477952 142
55 3300025911 Ga0207654_10441478 Ga0207654_104414781 142
56 3300025913 Ga0207695_10050063 Ga0207695_100500635 142
57 3300025913 Ga0207695_10593861 Ga0207695_105938612 142
58 3300025915 Ga0207693_10847743 Ga0207693_108477432 142
59 3300025919 Ga0207657_10232234 Ga0207657_102322342 142
60 3300025919 Ga0207657_10931965 Ga0207657_109319652 142
61 3300025924 Ga0207694_10403406 Ga0207694_104034062 142
62 3300025927 Ga0207687_11426267 Ga0207687_114262672 142
63 3300025931 Ga0207644_10228070 Ga0207644_102280702 142
64 3300025931 Ga0207644_11194942 Ga0207644_111949422 142
65 3300025933 Ga0207706_10807475 Ga0207706_108074751 142
66 3300025949 Ga0207667_10645080 Ga0207667_106450802 142
67 3300026041 Ga0207639_10851495 Ga0207639_108514952 142
68 3300026116 Ga0207674_11739566 Ga0207674_117395661 142
69 3300026142 Ga0207698_11176673 Ga0207698_111766732 142
70 3300039450 Ga0436363_0389171 Ga0436363_0389171_54_488 142
71 3300044712 Ga0453684_1083238 Ga0453684_1083238_101_529 142
72 3300045051 Ga0451576_0571706 Ga0451576_0571706_497_928 142
73 3300045051 Ga0451576_1228753 Ga0451576_1228753_282_710 142
74 3300046459 Ga0495629_0718467 Ga0495629_0718467_172_612 142
75 3300048903 Ga0496100_0289444 Ga0496100_0289444_338_766 142
76 3300048905 Ga0496102_1013846 Ga0496102_1013846_55_483 142
77 3300048907 Ga0496104_0887236 Ga0496104_0887236_158_586 142
78 3300048912 Ga0496109_0790679 Ga0496109_0790679_185_616 142
79 3300048914 Ga0496111_0092356 Ga0496111_0092356_460_888 142
80 3300048915 Ga0496112_0046659 Ga0496112_0046659_3126_3557 142
81 3300048915 Ga0496112_0090889 Ga0496112_0090889_1677_2111 142
82 3300048915 Ga0496112_0118386 Ga0496112_0118386_1059_1487 142
83 3300048916 Ga0496113_0168928 Ga0496113_0168928_1283_1717 142
84 3300005329 Ga0070683_100002123 Ga0070683_1000021234 143
85 3300005331 Ga0070670_100082408 Ga0070670_1000824084 143
86 3300005331 Ga0070670_100412425 Ga0070670_1004124252 143
87 3300005334 Ga0068869_100002923 Ga0068869_1000029238 143
88 3300005334 Ga0068869_100189148 Ga0068869_1001891483 143
89 3300005334 Ga0068869_100215844 Ga0068869_1002158442 143
90 3300005335 Ga0070666_10033227 Ga0070666_100332272 143
91 3300005338 Ga0068868_100157638 Ga0068868_1001576383 143
92 3300005339 Ga0070660_100062066 Ga0070660_1000620661 143
93 3300005340 Ga0070689_100006429 Ga0070689_1000064295 143
94 3300005340 Ga0070689_100188786 Ga0070689_1001887862 143
95 3300005343 Ga0070687_100010174 Ga0070687_1000101742 143
96 3300005344 Ga0070661_100005018 Ga0070661_1000050186 143
97 3300005353 Ga0070669_100011144 Ga0070669_1000111444 143
98 3300005354 Ga0070675_100120243 Ga0070675_1001202432 143
99 3300005354 Ga0070675_100685082 Ga0070675_1006850822 143
100 3300005355 Ga0070671_100017553 Ga0070671_1000175533 143
101 3300005355 Ga0070671_101029449 Ga0070671_1010294492 143
102 3300005364 Ga0070673_100000589 Ga0070673_10000058911 143
103 3300005365 Ga0070688_100002679 Ga0070688_1000026798 143
104 3300005367 Ga0070667_100013226 Ga0070667_1000132266 143
105 3300005367 Ga0070667_100020313 Ga0070667_1000203135 143
106 3300005367 Ga0070667_101756514 Ga0070667_1017565142 143
107 3300005436 Ga0070713_101016703 Ga0070713_1010167032 143
108 3300005436 Ga0070713_101924137 Ga0070713_1019241371 143
109 3300005438 Ga0070701_10101954 Ga0070701_101019542 143
110 3300005439 Ga0070711_100614880 Ga0070711_1006148801 143
111 3300005439 Ga0070711_101174598 Ga0070711_1011745982 143
112 3300005439 Ga0070711_101825231 Ga0070711_1018252311 143
113 3300005455 Ga0070663_100001276 Ga0070663_1000012764 143
114 3300005455 Ga0070663_100104315 Ga0070663_1001043153 143
115 3300005455 Ga0070663_100106632 Ga0070663_1001066323 143
116 3300005456 Ga0070678_100039990 Ga0070678_1000399903 143
117 3300005456 Ga0070678_100082809 Ga0070678_1000828093 143
118 3300005456 Ga0070678_100534094 Ga0070678_1005340941 143
119 3300005456 Ga0070678_100826398 Ga0070678_1008263982 143
120 3300005456 Ga0070678_101143584 Ga0070678_1011435841 143
121 3300005456 Ga0070678_101527019 Ga0070678_1015270192 143
122 3300005466 Ga0070685_10003008 Ga0070685_100030086 143
123 3300005518 Ga0070699_100110719 Ga0070699_1001107194 143
124 3300005535 Ga0070684_100000936 Ga0070684_1000009364 143
125 3300005535 Ga0070684_100051695 Ga0070684_1000516955 143
126 3300005539 Ga0068853_100152117 Ga0068853_1001521172 143
127 3300005539 Ga0068853_101728320 Ga0068853_1017283201 143
128 3300005543 Ga0070672_100000364 Ga0070672_10000036411 143
129 3300005543 Ga0070672_100237810 Ga0070672_1002378102 143
130 3300005548 Ga0070665_100010125 Ga0070665_10001012510 143
131 3300005548 Ga0070665_100027710 Ga0070665_1000277103 143
132 3300005548 Ga0070665_100313192 Ga0070665_1003131923 143
133 3300005564 Ga0070664_100002544 Ga0070664_1000025449 143
134 3300005564 Ga0070664_100202403 Ga0070664_1002024032 143
135 3300005564 Ga0070664_100441041 Ga0070664_1004410412 143
136 3300005577 Ga0068857_100001315 Ga0068857_1000013158 143
137 3300005577 Ga0068857_100177156 Ga0068857_1001771562 143
138 3300005617 Ga0068859_100003313 Ga0068859_1000033133 143
139 3300005617 Ga0068859_101165852 Ga0068859_1011658522 143
140 3300005618 Ga0068864_100001704 Ga0068864_1000017049 143
141 3300005618 Ga0068864_100023451 Ga0068864_1000234514 143
142 3300005841 Ga0068863_100002863 Ga0068863_1000028635 143
143 3300005841 Ga0068863_100006619 Ga0068863_1000066195 143
144 3300005841 Ga0068863_100028502 Ga0068863_1000285024 143
145 3300005842 Ga0068858_100008599 Ga0068858_1000085997 143
146 3300005842 Ga0068858_100035570 Ga0068858_1000355703 143
147 3300005843 Ga0068860_100014700 Ga0068860_1000147005 143
148 3300005843 Ga0068860_100262525 Ga0068860_1002625253 143
149 3300005844 Ga0068862_100003035 Ga0068862_1000030356 143
150 3300005844 Ga0068862_100490190 Ga0068862_1004901902 143
151 3300005844 Ga0068862_101532115 Ga0068862_1015321152 143
152 3300006028 Ga0070717_10204280 Ga0070717_102042804 143
153 3300006173 Ga0070716_100061546 Ga0070716_1000615462 143
154 3300006175 Ga0070712_100413765 Ga0070712_1004137652 143
155 3300006175 Ga0070712_100847440 Ga0070712_1008474402 143
156 3300006175 Ga0070712_100990530 Ga0070712_1009905302 143
157 3300006175 Ga0070712_101229031 Ga0070712_1012290312 143
158 3300006237 Ga0097621_100008738 Ga0097621_1000087386 143
159 3300006237 Ga0097621_100107277 Ga0097621_1001072774 143
160 3300006237 Ga0097621_100471820 Ga0097621_1004718202 143
161 3300006237 Ga0097621_100777067 Ga0097621_1007770672 143
162 3300006358 Ga0068871_100009017 Ga0068871_1000090176 143
163 3300006358 Ga0068871_100040381 Ga0068871_1000403816 143
164 3300006358 Ga0068871_100747598 Ga0068871_1007475982 143
165 3300006358 Ga0068871_101886123 Ga0068871_1018861232 143
166 3300006881 Ga0068865_100293889 Ga0068865_1002938892 143
167 3300006931 Ga0097620_100003313 Ga0097620_1000033133 143
168 3300006931 Ga0097620_101165790 Ga0097620_1011657902 143
169 3300009098 Ga0105245_10787245 Ga0105245_107872452 143
170 3300009101 Ga0105247_10061835 Ga0105247_100618353 143
171 3300009101 Ga0105247_10262437 Ga0105247_102624372 143
172 3300009177 Ga0105248_10012614 Ga0105248_100126145 143
173 3300009177 Ga0105248_10053886 Ga0105248_100538863 143
174 3300009545 Ga0105237_10208570 Ga0105237_102085702 143
175 3300009553 Ga0105249_10149244 Ga0105249_101492442 143
176 3300010375 Ga0105239_11254655 Ga0105239_112546552 143
177 3300011119 Ga0105246_10001222 Ga0105246_100012223 143
178 3300013102 Ga0157371_10139666 Ga0157371_101396663 143
179 3300013105 Ga0157369_10042779 Ga0157369_100427794 143
180 3300013105 Ga0157369_10410550 Ga0157369_104105502 143
181 3300013105 Ga0157369_10535810 Ga0157369_105358102 143
182 3300013296 Ga0157374_10000388 Ga0157374_1000038818 143
183 3300013296 Ga0157374_10013013 Ga0157374_100130136 143
184 3300013296 Ga0157374_10320207 Ga0157374_103202072 143
185 3300013296 Ga0157374_11097825 Ga0157374_110978252 143
186 3300013297 Ga0157378_10028929 Ga0157378_100289293 143
187 3300013306 Ga0163162_10077349 Ga0163162_100773492 143
188 3300013306 Ga0163162_10217306 Ga0163162_102173062 143
189 3300013308 Ga0157375_10010780 Ga0157375_100107804 143
190 3300013308 Ga0157375_11462829 Ga0157375_114628292 143
191 3300014325 Ga0163163_10041481 Ga0163163_100414815 143
192 3300014325 Ga0163163_10504597 Ga0163163_105045972 143
193 3300014745 Ga0157377_10010765 Ga0157377_100107653 143
194 3300014745 Ga0157377_10327347 Ga0157377_103273472 143
195 3300014968 Ga0157379_10001205 Ga0157379_1000120511 143
196 3300014968 Ga0157379_10034047 Ga0157379_100340473 143
197 3300014969 Ga0157376_10007265 Ga0157376_100072653 143
198 3300014969 Ga0157376_10490788 Ga0157376_104907882 143
199 3300014969 Ga0157376_11628929 Ga0157376_116289292 143
200 3300014969 Ga0157376_12244543 Ga0157376_122445431 143
201 3300025904 Ga0207647_10011317 Ga0207647_100113176 143
202 3300025907 Ga0207645_10027987 Ga0207645_100279873 143
203 3300025915 Ga0207693_10542867 Ga0207693_105428672 143
204 3300025915 Ga0207693_10762321 Ga0207693_107623212 143
205 3300025915 Ga0207693_11077547 Ga0207693_110775472 143
206 3300025919 Ga0207657_10000660 Ga0207657_1000066035 143
207 3300025920 Ga0207649_10000513 Ga0207649_1000051316 143
208 3300025920 Ga0207649_10193458 Ga0207649_101934582 143
209 3300025923 Ga0207681_11020293 Ga0207681_110202932 143
210 3300025925 Ga0207650_10000059 Ga0207650_1000005951 143
211 3300025925 Ga0207650_10059278 Ga0207650_100592784 143
212 3300025925 Ga0207650_10082396 Ga0207650_100823962 143
213 3300025927 Ga0207687_10442082 Ga0207687_104420822 143
214 3300025927 Ga0207687_10566587 Ga0207687_105665872 143
215 3300025928 Ga0207700_10127471 Ga0207700_101274712 143
216 3300025928 Ga0207700_10134961 Ga0207700_101349613 143
217 3300025929 Ga0207664_10267751 Ga0207664_102677512 143
218 3300025929 Ga0207664_10908540 Ga0207664_109085402 143
219 3300025932 Ga0207690_10018279 Ga0207690_100182795 143
220 3300025936 Ga0207670_10078894 Ga0207670_100788942 143
221 3300025938 Ga0207704_10256067 Ga0207704_102560672 143
222 3300025939 Ga0207665_10047025 Ga0207665_100470252 143
223 3300025940 Ga0207691_10018001 Ga0207691_100180014 143
224 3300025940 Ga0207691_10088895 Ga0207691_100888954 143
225 3300025941 Ga0207711_10005842 Ga0207711_100058422 143
226 3300025942 Ga0207689_10017588 Ga0207689_100175884 143
227 3300025942 Ga0207689_10110301 Ga0207689_101103014 143
228 3300025942 Ga0207689_10145776 Ga0207689_101457763 143
229 3300025944 Ga0207661_10004533 Ga0207661_100045339 143
230 3300025944 Ga0207661_10032116 Ga0207661_100321164 143
231 3300025945 Ga0207679_10001027 Ga0207679_100010278 143
232 3300025945 Ga0207679_10019557 Ga0207679_100195575 143
233 3300025945 Ga0207679_10323864 Ga0207679_103238642 143
234 3300025960 Ga0207651_10003853 Ga0207651_100038536 143
235 3300025960 Ga0207651_10199486 Ga0207651_101994862 143
236 3300025986 Ga0207658_10311122 Ga0207658_103111222 143
237 3300026023 Ga0207677_10026864 Ga0207677_100268643 143
238 3300026023 Ga0207677_10043307 Ga0207677_100433074 143
239 3300026035 Ga0207703_10010559 Ga0207703_100105595 143
240 3300026035 Ga0207703_10052024 Ga0207703_100520245 143
241 3300026041 Ga0207639_11020743 Ga0207639_110207432 143
242 3300026067 Ga0207678_10013492 Ga0207678_100134925 143
243 3300026067 Ga0207678_10027779 Ga0207678_100277794 143
244 3300026067 Ga0207678_10624656 Ga0207678_106246562 143
245 3300026088 Ga0207641_10000025 Ga0207641_1000002553 143
246 3300026088 Ga0207641_10014807 Ga0207641_100148076 143
247 3300026088 Ga0207641_10022146 Ga0207641_100221465 143
248 3300026095 Ga0207676_10000160 Ga0207676_1000016041 143
249 3300026095 Ga0207676_10047292 Ga0207676_100472922 143
250 3300026116 Ga0207674_10000162 Ga0207674_1000016211 143
251 3300026116 Ga0207674_10135891 Ga0207674_101358913 143
252 3300026121 Ga0207683_10171709 Ga0207683_101717093 143
253 3300026121 Ga0207683_10302315 Ga0207683_103023153 143
254 3300026121 Ga0207683_10830362 Ga0207683_108303621 143
255 3300026121 Ga0207683_10865263 Ga0207683_108652632 143
256 3300028379 Ga0268266_10002593 Ga0268266_1000259314 143
257 3300028379 Ga0268266_10004325 Ga0268266_100043256 143
258 3300028379 Ga0268266_10091645 Ga0268266_100916453 143
259 3300028380 Ga0268265_10238480 Ga0268265_102384802 143
260 3300028380 Ga0268265_10467797 Ga0268265_104677972 143
261 3300028381 Ga0268264_10026196 Ga0268264_100261965 143
262 3300028381 Ga0268264_10074643 Ga0268264_100746432 143
263 3300031711 Ga0265314_10091401 Ga0265314_100914013 143
264 3300035090 Ga0373949_0210400 Ga0373949_0210400_74_511 143
265 3300035691 Ga0373931_0804859 Ga0373931_0804859_120_557 143
266 3300046472 Ga0495580_0274657 Ga0495580_0274657_172_609 143
267 3300046472 Ga0495580_0476479 Ga0495580_0476479_76_513 143
268 3300048907 Ga0496104_0329011 Ga0496104_0329011_624_1055 143
269 3300048908 Ga0496105_0710367 Ga0496105_0710367_218_649 143
270 3300048909 Ga0496106_0313535 Ga0496106_0313535_14_445 143
271 3300048911 Ga0496108_0000203 Ga0496108_0000203_22151_22582 143
272 3300048912 Ga0496109_0000099 Ga0496109_0000099_11068_11499 143
273 3300048913 Ga0496110_0000189 Ga0496110_0000189_33891_34322 143
274 3300048915 Ga0496112_0000048 Ga0496112_0000048_65499_65930 143
275 3300048915 Ga0496112_0136515 Ga0496112_0136515_901_1332 143
276 3300048915 Ga0496112_0286462 Ga0496112_0286462_939_1376 143
277 3300048916 Ga0496113_0000655 Ga0496113_0000655_2274_2705 143
278 3300048917 Ga0496114_1130259 Ga0496114_1130259_46_492 143
279 3300048918 Ga0496115_0174282 Ga0496115_0174282_396_830 143
280 3300002459 JGI24751J29686_10029818 JGI24751J29686_100298182 144
281 3300005290 Ga0065712_10093442 Ga0065712_100934422 144
282 3300005293 Ga0065715_10563036 Ga0065715_105630362 144
283 3300005329 Ga0070683_100030202 Ga0070683_1000302025 144
284 3300005331 Ga0070670_100016220 Ga0070670_1000162205 144
285 3300005333 Ga0070677_10508390 Ga0070677_105083901 144
286 3300005334 Ga0068869_100000409 Ga0068869_10000040919 144
287 3300005335 Ga0070666_10069427 Ga0070666_100694273 144
288 3300005340 Ga0070689_100040215 Ga0070689_1000402153 144
289 3300005344 Ga0070661_100001327 Ga0070661_10000132714 144
290 3300005353 Ga0070669_100318175 Ga0070669_1003181752 144
291 3300005354 Ga0070675_100025351 Ga0070675_1000253513 144
292 3300005355 Ga0070671_100007177 Ga0070671_1000071777 144
293 3300005364 Ga0070673_100052363 Ga0070673_1000523634 144
294 3300005367 Ga0070667_100439257 Ga0070667_1004392572 144
295 3300005445 Ga0070708_100459365 Ga0070708_1004593652 144
296 3300005445 Ga0070708_100731770 Ga0070708_1007317702 144
297 3300005445 Ga0070708_101115838 Ga0070708_1011158381 144
298 3300005455 Ga0070663_100006247 Ga0070663_1000062475 144
299 3300005456 Ga0070678_100137565 Ga0070678_1001375652 144
300 3300005457 Ga0070662_100153755 Ga0070662_1001537553 144
301 3300005467 Ga0070706_101321617 Ga0070706_1013216171 144
302 3300005468 Ga0070707_100313841 Ga0070707_1003138412 144
303 3300005468 Ga0070707_100333620 Ga0070707_1003336203 144
304 3300005468 Ga0070707_100606167 Ga0070707_1006061672 144
305 3300005468 Ga0070707_100827794 Ga0070707_1008277942 144
306 3300005518 Ga0070699_100071496 Ga0070699_1000714964 144
307 3300005518 Ga0070699_100816350 Ga0070699_1008163502 144
308 3300005535 Ga0070684_100011359 Ga0070684_1000113595 144
309 3300005536 Ga0070697_100037401 Ga0070697_1000374015 144
310 3300005536 Ga0070697_100357835 Ga0070697_1003578352 144
311 3300005536 Ga0070697_100843605 Ga0070697_1008436052 144
312 3300005539 Ga0068853_100864201 Ga0068853_1008642012 144
313 3300005543 Ga0070672_100053169 Ga0070672_1000531691 144
314 3300005548 Ga0070665_100341015 Ga0070665_1003410152 144
315 3300005548 Ga0070665_100528433 Ga0070665_1005284332 144
316 3300005563 Ga0068855_101152603 Ga0068855_1011526032 144
317 3300005564 Ga0070664_100088765 Ga0070664_1000887653 144
318 3300005577 Ga0068857_100039101 Ga0068857_1000391015 144
319 3300005614 Ga0068856_100466041 Ga0068856_1004660412 144
320 3300005617 Ga0068859_100027742 Ga0068859_1000277425 144
321 3300005618 Ga0068864_100000879 Ga0068864_1000008793 144
322 3300005834 Ga0068851_10064091 Ga0068851_100640912 144
323 3300005841 Ga0068863_100001146 Ga0068863_1000011465 144
324 3300005842 Ga0068858_100129986 Ga0068858_1001299862 144
325 3300005843 Ga0068860_100263516 Ga0068860_1002635163 144
326 3300005844 Ga0068862_100012726 Ga0068862_1000127265 144
327 3300006237 Ga0097621_100457443 Ga0097621_1004574432 144
328 3300006358 Ga0068871_100575988 Ga0068871_1005759882 144
329 3300006931 Ga0097620_100027739 Ga0097620_1000277394 144
330 3300013297 Ga0157378_11764267 Ga0157378_117642672 144
331 3300025321 Ga0207656_10051857 Ga0207656_100518571 144
332 3300025903 Ga0207680_10526781 Ga0207680_105267812 144
333 3300025904 Ga0207647_10086788 Ga0207647_100867882 144
334 3300025907 Ga0207645_10032967 Ga0207645_100329673 144
335 3300025910 Ga0207684_10828551 Ga0207684_108285512 144
336 3300025919 Ga0207657_10182423 Ga0207657_101824232 144
337 3300025920 Ga0207649_10000151 Ga0207649_1000015145 144
338 3300025922 Ga0207646_10172462 Ga0207646_101724622 144
339 3300025922 Ga0207646_10304352 Ga0207646_103043522 144
340 3300025925 Ga0207650_10000024 Ga0207650_10000024169 144
341 3300025926 Ga0207659_10014083 Ga0207659_100140835 144
342 3300025928 Ga0207700_10703522 Ga0207700_107035222 144
343 3300025929 Ga0207664_11137582 Ga0207664_111375822 144
344 3300025931 Ga0207644_10036203 Ga0207644_100362031 144
345 3300025931 Ga0207644_10334366 Ga0207644_103343662 144
346 3300025932 Ga0207690_10032963 Ga0207690_100329632 144
347 3300025933 Ga0207706_10108976 Ga0207706_101089762 144
348 3300025940 Ga0207691_10013168 Ga0207691_100131685 144
349 3300025941 Ga0207711_10007700 Ga0207711_100077005 144
350 3300025942 Ga0207689_10000160 Ga0207689_1000016040 144
351 3300025944 Ga0207661_10000324 Ga0207661_100003244 144
352 3300025945 Ga0207679_10000040 Ga0207679_1000004030 144
353 3300025949 Ga0207667_11274610 Ga0207667_112746101 144
354 3300025960 Ga0207651_10023563 Ga0207651_100235634 144
355 3300025986 Ga0207658_10041674 Ga0207658_100416743 144
356 3300026041 Ga0207639_11082603 Ga0207639_110826032 144
357 3300026078 Ga0207702_10155987 Ga0207702_101559873 144
358 3300026088 Ga0207641_10000030 Ga0207641_10000030103 144
359 3300026095 Ga0207676_10000134 Ga0207676_1000013451 144
360 3300026116 Ga0207674_10000069 Ga0207674_1000006968 144
361 3300026121 Ga0207683_10041785 Ga0207683_100417853 144
362 3300026142 Ga0207698_10111856 Ga0207698_101118563 144
363 3300028379 Ga0268266_10001493 Ga0268266_100014935 144
364 3300028379 Ga0268266_10297539 Ga0268266_102975392 144
365 3300028380 Ga0268265_10002498 Ga0268265_100024986 144
366 3300028381 Ga0268264_10011195 Ga0268264_100111956 144
367 3300028381 Ga0268264_10426613 Ga0268264_104266132 144
368 3300031090 Ga0265760_10037080 Ga0265760_100370802 144
369 3300031241 Ga0265325_10015501 Ga0265325_100155016 144
370 3300031241 Ga0265325_10076353 Ga0265325_100763532 144
371 3300031241 Ga0265325_10314704 Ga0265325_103147041 144
372 3300031247 Ga0265340_10061514 Ga0265340_100615142 144
373 3300031250 Ga0265331_10123567 Ga0265331_101235672 144
374 3300031344 Ga0265316_10379923 Ga0265316_103799232 144
375 3300031711 Ga0265314_10098120 Ga0265314_100981202 144
376 3300046472 Ga0495580_0423761 Ga0495580_0423761_130_582 144
377 3300046472 Ga0495580_0805390 Ga0495580_0805390_62_502 144
378 3300046473 Ga0495582_0356335 Ga0495582_0356335_129_578 144
379 3300048907 Ga0496104_0792653 Ga0496104_0792653_37_486 144
380 3300048908 Ga0496105_0294233 Ga0496105_0294233_490_939 144

Structural Annotation

Top 5 Hits

ID Description Score Start End
6anw-assembly3.cif.gz_C crystal structure of anti-crispr protein acrf10 0.7828 25 63
3k5l-assembly1.cif.gz_A crystal structure of e.coli pol ii-abasic dna-datp lt(0, 3) ternary complex 0.7628 18 62
3o6z-assembly1.cif.gz_B structure of the d152a e.coli gdp-mannose hydrolase (yffh) in complex with mg++ 0.7435 25 63
8a98-assembly1.cif.gz_Sd cryo-em structure of leishmania major 80s ribosome : snorna mutant 0.7269 23 63
4bts-assembly1.cif.gz_A1 the crystal structure of the eukaryotic 40s ribosomal subunit in complex with eif1 and eif1a 0.7111 20 63
ID Description Score Start End Superfamily
af_Q09693_316_432_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7449 23 61 3.30.460.10
af_F4I201_85_164_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7221 20 66 3.10.450.10
af_Q9T0E2_110_356_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7143 30 63 2.120.10.80
af_Q8GXH3_99_172_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7121 21 63 2.40.50.140
3lygA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7083 18 63 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2U3L024-F1-model_v4 Uncharacterized protein 0.7766 1 141
AF-A0A2N9L2X4-F1-model_v4 Uncharacterized protein 0.7691 1 144
AF-A0A2U3L024-F1-model_v4 Uncharacterized protein 0.7666 1 141
AF-A0A2N9L2X4-F1-model_v4 Uncharacterized protein 0.7642 1 144
AF-A0A2I1HAA4-F1-model_v4 Uncharacterized protein 0.7624 23 63

Feature Viewer

pLDDT pTM Quality
75.98 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map