F428732

General Info

Members Datasets Scaffolds Average Seq Length
380 179 760 242

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0045629|Ga0436365_0045629_402_1253
Length 283
Sequence LRGFRGSRCELARSRDFVDEFCGVNRSKRSVVWTADERRIMGVAFPAESSEYRAARDRLLEQEIELRRAMEAVAAARRQLPPGGVVPRDYLFHGGGADGAPAEVRLFELFAPGKDSLLIYSFMFPRDPHDQTPGPSTGQTALLPLAEGPCPTCAAFIDQLEGAAEHVTQHINLAVVAKTPLPRLLTFAQERGWRRLRFLSSANNTFNVDYHAETAEGAQRPMLTVFHRDADAIRHFWSSELLYTPTEPGEDPRHVGTLEPLWNMFDLTPEGRPQDWVEQLQYR

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
76 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
77 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
82 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
83 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 8.42
Rhizosphere 81.05
Stem 0
Stem Tuber 0
Unclassified 10.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0045629 3300039437 Bacteria 4939
2 Ga0070668_100206915 3300005347 Bacteria 1612
3 Ga0070671_100392502 3300005355 Bacteria 1187
4 Ga0070673_100391656 3300005364 Unclassified 1241
5 Ga0070709_10036698 3300005434 Bacteria 2988
6 Ga0070714_100007344 3300005435 Bacteria 8571
7 Ga0070714_100019350 3300005435 Bacteria 5544
8 Ga0070714_100026158 3300005435 Bacteria 4821
9 Ga0070714_100051716 3300005435 Bacteria 3504
10 Ga0070713_100018149 3300005436 Bacteria 5346
11 Ga0070713_100030958 3300005436 Bacteria 4255
12 Ga0070713_100043427 3300005436 Bacteria 3675
13 Ga0070713_100145449 3300005436 Bacteria 2103
14 Ga0070713_100778032 3300005436 Bacteria 917
15 Ga0070710_10000280 3300005437 Bacteria 24115
16 Ga0070710_10006741 3300005437 Bacteria 5535
17 Ga0070710_10015323 3300005437 Bacteria 3878
18 Ga0070710_10019452 3300005437 Bacteria 3509
19 Ga0070711_100008299 3300005439 Bacteria 6356
20 Ga0070711_100017219 3300005439 Bacteria 4598
21 Ga0070711_100021086 3300005439 Bacteria 4209
22 Ga0070711_100166688 3300005439 Bacteria 1675
23 Ga0070708_100012213 3300005445 Bacteria 7005
24 Ga0070708_100015507 3300005445 Bacteria 6298
25 Ga0070708_100054019 3300005445 Bacteria 3566
26 Ga0070706_100008352 3300005467 Bacteria 9647
27 Ga0070706_100011744 3300005467 Bacteria 8126
28 Ga0070706_100027522 3300005467 Bacteria 5232
29 Ga0070706_100070955 3300005467 Bacteria 3222
30 Ga0070706_100260589 3300005467 Unclassified 1618
31 Ga0070707_100004183 3300005468 Bacteria 13526
32 Ga0070707_100087226 3300005468 Bacteria 3018
33 Ga0070707_100374919 3300005468 Unclassified 1382
34 Ga0070698_100012420 3300005471 Bacteria 9019
35 Ga0070698_100044172 3300005471 Bacteria 4565
36 Ga0070699_100022113 3300005518 Bacteria 5479
37 Ga0070699_100090512 3300005518 Bacteria 2674
38 Ga0070699_100100480 3300005518 Bacteria 2535
39 Ga0070699_100265186 3300005518 Unclassified 1536
40 Ga0070679_100438421 3300005530 Bacteria 1251
41 Ga0070697_100526893 3300005536 Unclassified 1035
42 Ga0070686_100564237 3300005544 Bacteria 892
43 Ga0070696_100162221 3300005546 Bacteria 1648
44 Ga0070693_100135772 3300005547 Bacteria 1543
45 Ga0068856_100052629 3300005614 Bacteria 4015
46 Ga0068856_100487671 3300005614 Unclassified 1253
47 Ga0070702_100193588 3300005615 Bacteria 1340
48 Ga0068863_100022125 3300005841 Bacteria 6069
49 Ga0068862_100421390 3300005844 Bacteria 1253
50 Ga0081455_10016242 3300005937 Bacteria 7193
51 Ga0081455_10045439 3300005937 Bacteria 3821
52 Ga0081538_10014175 3300005981 Bacteria 6263
53 Ga0081538_10036214 3300005981 Bacteria 3224
54 Ga0081538_10126003 3300005981 Bacteria 1217
55 Ga0070717_10022093 3300006028 Bacteria 5023
56 Ga0070717_10039140 3300006028 Bacteria 3857
57 Ga0070717_10066872 3300006028 Bacteria 2989
58 Ga0070717_10178189 3300006028 Bacteria 1851
59 Ga0070717_10221906 3300006028 Bacteria 1662
60 Ga0070717_10379388 3300006028 Bacteria 1267
61 Ga0075365_10001491 3300006038 Bacteria 10669
62 Ga0075364_10057504 3300006051 Bacteria 2548
63 Ga0070715_10003803 3300006163 Bacteria 4872
64 Ga0070715_10006934 3300006163 Bacteria 3876
65 Ga0070716_100006319 3300006173 Bacteria 5784
66 Ga0070716_100033145 3300006173 Bacteria 2823
67 Ga0070716_100089626 3300006173 Bacteria 1858
68 Ga0070712_100008789 3300006175 Bacteria 6360
69 Ga0070712_100018990 3300006175 Bacteria 4474
70 Ga0070712_100035910 3300006175 Bacteria 3368
71 Ga0068871_100306108 3300006358 Bacteria 1396
72 Ga0075428_100097222 3300006844 Bacteria 3210
73 Ga0075428_100790874 3300006844 Bacteria 1008
74 Ga0075430_100137941 3300006846 Unclassified 2032
75 Ga0075431_100113524 3300006847 Bacteria 2796
76 Ga0075433_10027677 3300006852 Bacteria 4810
77 Ga0075433_10049103 3300006852 Bacteria 3671
78 Ga0075434_100027269 3300006871 Bacteria 5606
79 Ga0075434_100242743 3300006871 Bacteria 1821
80 Ga0075434_100475345 3300006871 Bacteria 1271
81 Ga0075436_100229536 3300006914 Bacteria 1318
82 Ga0075435_100026324 3300007076 Bacteria 4536
83 Ga0105245_10341005 3300009098 Bacteria 1482
84 Ga0105247_10116229 3300009101 Bacteria 1728
85 Ga0105247_10183001 3300009101 Bacteria 1399
86 Ga0114129_10000886 3300009147 Bacteria 39030
87 Ga0114129_10021400 3300009147 Bacteria 9181
88 Ga0114129_10060899 3300009147 Bacteria 5276
89 Ga0114129_10399003 3300009147 Bacteria 1813
90 Ga0114129_10552840 3300009147 Bacteria 1497
91 Ga0114129_10940359 3300009147 Bacteria 1092
92 Ga0157369_10213964 3300013105 Bacteria 2019
93 Ga0157372_10766098 3300013307 Bacteria 1122
94 Ga0163163_10037311 3300014325 Bacteria 4727
95 Ga0157379_10096348 3300014968 Bacteria 2655
96 Ga0213874_10000123 3300021377 Bacteria 12931
97 Ga0213874_10009515 3300021377 Unclassified 2405
98 Ga0213876_10005965 3300021384 Bacteria 6656
99 Ga0213876_10006744 3300021384 Bacteria 6269
100 Ga0213876_10034640 3300021384 Bacteria 2663
101 Ga0213876_10047552 3300021384 Bacteria 2268
102 Ga0213876_10130730 3300021384 Bacteria 1334
103 Ga0207692_10007812 3300025898 Bacteria 4399
104 Ga0207692_10015998 3300025898 Bacteria 3311
105 Ga0207692_10020150 3300025898 Bacteria 3027
106 Ga0207692_10110194 3300025898 Bacteria 1526
107 Ga0207692_10162712 3300025898 Bacteria 1287
108 Ga0207642_10217506 3300025899 Bacteria 1066
109 Ga0207685_10000387 3300025905 Bacteria 7248
110 Ga0207685_10014765 3300025905 Unclassified 2453
111 Ga0207699_10001430 3300025906 Bacteria 11324
112 Ga0207699_10003839 3300025906 Bacteria 7174
113 Ga0207699_10015424 3300025906 Bacteria 3969
114 Ga0207699_10043121 3300025906 Bacteria 2619
115 Ga0207684_10001088 3300025910 Bacteria 30478
116 Ga0207684_10010240 3300025910 Bacteria 8254
117 Ga0207684_10010330 3300025910 Bacteria 8218
118 Ga0207684_10014550 3300025910 Bacteria 6778
119 Ga0207684_10081316 3300025910 Bacteria 2757
120 Ga0207684_10209510 3300025910 Unclassified 1681
121 Ga0207693_10001201 3300025915 Bacteria 23106
122 Ga0207693_10005301 3300025915 Bacteria 10775
123 Ga0207693_10020744 3300025915 Bacteria 5227
124 Ga0207693_10040994 3300025915 Bacteria 3646
125 Ga0207693_10205394 3300025915 Bacteria 1549
126 Ga0207663_10005187 3300025916 Bacteria 6554
127 Ga0207663_10011899 3300025916 Bacteria 4686
128 Ga0207663_10022752 3300025916 Bacteria 3587
129 Ga0207663_10341409 3300025916 Bacteria 1131
130 Ga0207652_10456235 3300025921 Bacteria 1152
131 Ga0207646_10178975 3300025922 Unclassified 1915
132 Ga0207646_10244931 3300025922 Bacteria 1619
133 Ga0207646_10563722 3300025922 Unclassified 1023
134 Ga0207650_10065760 3300025925 Bacteria 2718
135 Ga0207700_10001215 3300025928 Bacteria 14757
136 Ga0207700_10001951 3300025928 Bacteria 11735
137 Ga0207700_10025410 3300025928 Bacteria 4111
138 Ga0207700_10089116 3300025928 Bacteria 2431
139 Ga0207700_10092399 3300025928 Bacteria 2392
140 Ga0207700_10247667 3300025928 Bacteria 1521
141 Ga0207664_10004112 3300025929 Bacteria 9823
142 Ga0207664_10058115 3300025929 Bacteria 3076
143 Ga0207664_10064357 3300025929 Bacteria 2933
144 Ga0207664_10066606 3300025929 Bacteria 2887
145 Ga0207664_10307219 3300025929 Bacteria 1397
146 Ga0207664_10593817 3300025929 Unclassified 994
147 Ga0207706_10496775 3300025933 Unclassified 1053
148 Ga0207665_10000972 3300025939 Bacteria 19412
149 Ga0207665_10031923 3300025939 Bacteria 3486
150 Ga0207665_10033779 3300025939 Bacteria 3392
151 Ga0207665_10294734 3300025939 Unclassified 1211
152 Ga0207667_10064018 3300025949 Bacteria 3841
153 Ga0207668_10434627 3300025972 Unclassified 1117
154 Ga0207702_10369390 3300026078 Unclassified 1377
155 Ga0207675_100311535 3300026118 Bacteria 1535
156 Ga0207683_10270338 3300026121 Bacteria 1553
157 Ga0207428_10048701 3300027907 Bacteria 3398
158 Ga0268265_10486343 3300028380 Bacteria 1160
159 Ga0265760_10041427 3300031090 Bacteria 1373
160 Ga0307406_10116652 3300031901 Bacteria 1848
161 Ga0307406_10268651 3300031901 Bacteria 1294
162 Ga0307407_10054249 3300031903 Bacteria 2311
163 Ga0307409_100621368 3300031995 Bacteria 1070
164 Ga0307415_100018752 3300032126 Bacteria 4186
165 Ga0307415_100321966 3300032126 Bacteria 1289
166 Ga0373930_0029342 3300034816 Bacteria 1124
167 Ga0373958_0057426 3300034819 Bacteria 836
168 Ga0373928_0019068 3300035084 Bacteria 1428
169 Ga0373940_0034056 3300035088 Bacteria 1372
170 Ga0373944_0159026 3300035089 Unclassified 800
171 Ga0373949_0013507 3300035090 Bacteria 1811
172 Ga0373952_0024963 3300035092 Bacteria 1287
173 Ga0373932_0014962 3300035112 Bacteria 1960
174 Ga0373939_0022445 3300035114 Bacteria 1739
175 Ga0373945_0055698 3300035116 Bacteria 1465
176 Ga0373953_0118063 3300035117 Bacteria 1125
177 Ga0373954_0200332 3300035118 Bacteria 981
178 Ga0373957_0022038 3300035120 Bacteria 2267
179 Ga0373957_0090339 3300035120 Unclassified 1217
180 Ga0373943_0067670 3300035170 Bacteria 1802
181 Ga0373943_0089985 3300035170 Unclassified 1588
182 Ga0373955_0069569 3300035172 Bacteria 1964
183 Ga0373961_0013007 3300035241 Bacteria 2092
184 Ga0373924_0017963 3300035410 Bacteria 2721
185 Ga0373931_0019179 3300035691 Bacteria 3410
186 Ga0373935_0117859 3300035692 Bacteria 1770
187 Ga0373927_0049181 3300035695 Bacteria 2727
188 Ga0373927_0093468 3300035695 Bacteria 1954
189 Ga0373933_0004913 3300035724 Bacteria 7297
190 Ga0373933_0056573 3300035724 Unclassified 2355
191 Ga0373933_0103180 3300035724 Bacteria 1771
192 Ga0373947_0092204 3300035725 Bacteria 1891
193 Ga0373947_0213353 3300035725 Bacteria 1267
194 Ga0373947_0227225 3300035725 Unclassified 1228
195 Ga0373937_0011583 3300036401 Bacteria 7742
196 Ga0395899_0137203 3300037312 Bacteria 1743
197 Ga0395900_0104768 3300037418 Bacteria 2906
198 Ga0395900_0115785 3300037418 Bacteria 2751
199 Ga0395900_0189514 3300037418 Bacteria 2087
200 Ga0395898_0010492 3300037466 Bacteria 9685
201 Ga0395898_0037301 3300037466 Bacteria 4823
202 Ga0395905_0033053 3300037471 Bacteria 4863
203 Ga0395905_0097922 3300037471 Viruses 2754
204 Ga0436364_0119405 3300037853 Bacteria 1975
205 Ga0436364_0262328 3300037853 Bacteria 2168
206 Ga0436364_0278951 3300037853 Bacteria 1018
207 Ga0436364_0393760 3300037853 Bacteria 958
208 Ga0436364_0642014 3300037853 Bacteria 2659
209 Ga0436364_0901681 3300037853 Bacteria 4766
210 Ga0436364_0980411 3300037853 Bacteria 18071
211 Ga0436364_1092565 3300037853 Unclassified 961
212 Ga0436364_1104375 3300037853 Bacteria 1023
213 Ga0436364_1237450 3300037853 Bacteria 1398
214 Ga0436364_1265637 3300037853 Bacteria 2280
215 Ga0395901_0114209 3300038443 Bacteria 2836
216 Ga0395901_0127715 3300038443 Bacteria 2672
217 Ga0395901_0245398 3300038443 Unclassified 1867
218 Ga0395901_0409538 3300038443 Unclassified 1392
219 Ga0436365_0024354 3300039437 Unclassified 3964
220 Ga0436365_0119159 3300039437 Bacteria 3699
221 Ga0436365_0501323 3300039437 Bacteria 1834
222 Ga0436365_0622858 3300039437 Bacteria 15110
223 Ga0436365_0833692 3300039437 Bacteria 9210
224 Ga0436365_1155867 3300039437 Unclassified 1274
225 Ga0436365_1278280 3300039437 Bacteria 1331
226 Ga0436365_1817543 3300039437 Bacteria 5024
227 Ga0436363_0024411 3300039450 Unclassified 1806
228 Ga0436363_0143875 3300039450 Bacteria 8823
229 Ga0436363_0278323 3300039450 Bacteria 17762
230 Ga0436363_0341189 3300039450 Bacteria 4236
231 Ga0436363_0638480 3300039450 Unclassified 957
232 Ga0436363_0675537 3300039450 Unclassified 1497
233 Ga0436363_1360731 3300039450 Bacteria 2950
234 Ga0436363_1670711 3300039450 Bacteria 2067
235 Ga0436363_1718947 3300039450 Bacteria 3463
236 Ga0436362_0705963 3300039453 Unclassified 2387
237 Ga0436362_0805121 3300039453 Bacteria 1450
238 Ga0466965_0189144 3300044683 Bacteria 1088
239 Ga0466961_0014780 3300044693 Bacteria 5016
240 Ga0466961_0204192 3300044693 Unclassified 1221
241 Ga0466963_0002608 3300044694 Bacteria 10115
242 Ga0466964_0082193 3300044706 Bacteria 1385
243 Ga0466971_0124677 3300044719 Bacteria 1193
244 Ga0466968_0075397 3300044735 Unclassified 1475
245 Ga0466957_0009687 3300044842 Bacteria 5501
246 Ga0466957_0135555 3300044842 Bacteria 1582
247 Ga0466957_0208314 3300044842 Bacteria 1287
248 Ga0466959_0018207 3300045049 Bacteria 5156
249 Ga0466959_0031582 3300045049 Bacteria 3918
250 Ga0466959_0251035 3300045049 Bacteria 1220
251 Ga0466958_0009117 3300045836 Bacteria 5517
252 Ga0466958_0019978 3300045836 Bacteria 3903
253 Ga0466958_0028646 3300045836 Unclassified 3303
254 Ga0466958_0089448 3300045836 Unclassified 1904
255 Ga0466958_0159700 3300045836 Bacteria 1423
256 Ga0466967_0009133 3300045976 Bacteria 7334
257 Ga0466967_0065118 3300045976 Bacteria 3243
258 Ga0466967_0160141 3300045976 Bacteria 2112
259 Ga0466967_0618213 3300045976 Bacteria 1070
260 Ga0466967_0820127 3300045976 Bacteria 924
261 Ga0495592_0016886 3300046454 Bacteria 5542
262 Ga0495592_0019023 3300046454 Bacteria 5227
263 Ga0495629_0043466 3300046459 Bacteria 3154
264 Ga0495641_0047117 3300046461 Bacteria 1980
265 Ga0495651_0014135 3300046462 Bacteria 6170
266 Ga0495651_0019496 3300046462 Bacteria 5258
267 Ga0495651_0186330 3300046462 Bacteria 1464
268 Ga0495651_0270372 3300046462 Bacteria 1152
269 Ga0495653_0019529 3300046463 Bacteria 5495
270 Ga0495653_0145467 3300046463 Bacteria 1661
271 Ga0495653_0183600 3300046463 Bacteria 1433
272 Ga0495662_0038267 3300046476 Bacteria 2318
273 Ga0495664_0049766 3300046477 Bacteria 2488
274 Ga0495584_0070635 3300046491 Unclassified 1755
275 Ga0495585_0099386 3300046492 Bacteria 1558
276 Ga0495608_0001773 3300046511 Bacteria 15425
277 Ga0495608_0001916 3300046511 Bacteria 14928
278 Ga0495608_0009659 3300046511 Bacteria 6731
279 Ga0495608_0062167 3300046511 Bacteria 2454
280 Ga0495628_0004834 3300046516 Bacteria 11852
281 Ga0495652_0019461 3300046529 Bacteria 6046
282 Ga0495652_0029503 3300046529 Bacteria 4819
283 Ga0495652_0109348 3300046529 Bacteria 2225
284 Ga0495665_0063269 3300046531 Bacteria 1953
285 Ga0495640_0014642 3300046533 Bacteria 5925
286 Ga0495640_0018727 3300046533 Bacteria 5124
287 Ga0495640_0034979 3300046533 Bacteria 3558
288 Ga0495587_0002844 3300046536 Bacteria 11595
289 Ga0495587_0010077 3300046536 Bacteria 6031
290 Ga0495587_0012036 3300046536 Bacteria 5464
291 Ga0495667_0008855 3300046559 Bacteria 6842
292 Ga0495667_0012012 3300046559 Bacteria 5866
293 Ga0495634_0058142 3300046642 Bacteria 2578
294 Ga0495634_0117850 3300046642 Bacteria 1702
295 Ga0495635_0042471 3300046663 Bacteria 3139
296 Ga0495588_0110071 3300046674 Bacteria 1451
297 Ga0495657_0002233 3300046675 Bacteria 16399
298 Ga0495657_0005277 3300046675 Bacteria 10226
299 Ga0495657_0338575 3300046675 Bacteria 892
300 Ga0495599_0010093 3300046678 Bacteria 5779
301 Ga0495599_0063845 3300046678 Bacteria 2301
302 Ga0495623_0012001 3300046679 Bacteria 5613
303 Ga0495646_0091680 3300046680 Bacteria 1753
304 Ga0495646_0208467 3300046680 Unclassified 1061
305 Ga0495658_0111324 3300046683 Bacteria 1646
306 Ga0495613_0196885 3300046689 Unclassified 1422
307 Ga0495624_0035229 3300046690 Bacteria 3232
308 Ga0495600_0002583 3300046809 Bacteria 10432
309 Ga0495581_0283147 3300047315 Bacteria 969
310 Ga0495604_0018048 3300047317 Bacteria 5646
311 Ga0495604_0018134 3300047317 Bacteria 5634
312 Ga0495604_0026775 3300047317 Bacteria 4589
313 Ga0495674_0018644 3300047319 Bacteria 6457
314 Ga0495674_0034706 3300047319 Bacteria 4558
315 Ga0495674_0038026 3300047319 Bacteria 4322
316 Ga0495676_0101922 3300047321 Bacteria 2122
317 Ga0495676_0166537 3300047321 Bacteria 1554
318 Ga0495676_0260334 3300047321 Bacteria 1180
319 Ga0495680_0000911 3300047322 Bacteria 32800
320 Ga0495680_0019391 3300047322 Bacteria 5740
321 Ga0495680_0148010 3300047322 Bacteria 1714
322 Ga0495680_0298057 3300047322 Bacteria 1132
323 Ga0495675_0016778 3300047444 Bacteria 4631
324 Ga0495684_0031302 3300047471 Bacteria 4084
325 Ga0495684_0040953 3300047471 Bacteria 3550
326 Ga0495684_0159826 3300047471 Bacteria 1681
327 Ga0495684_0193363 3300047471 Bacteria 1503
328 Ga0495593_0015247 3300047673 Bacteria 4359
329 Ga0495602_0011649 3300048088 Bacteria 9083
330 Ga0495602_0224159 3300048088 Unclassified 1417
331 Ga0496100_0126165 3300048903 Bacteria 1796
332 Ga0496101_0028123 3300048904 Bacteria 3923
333 Ga0496102_0275663 3300048905 Bacteria 1585
334 Ga0496103_0176681 3300048906 Bacteria 1372
335 Ga0496104_0084465 3300048907 Bacteria 3029
336 Ga0496105_0005065 3300048908 Bacteria 9982
337 Ga0496105_0031757 3300048908 Bacteria 4330
338 Ga0496105_0229575 3300048908 Bacteria 1508
339 Ga0496106_0050245 3300048909 Bacteria 3142
340 Ga0496106_0290734 3300048909 Bacteria 1310
341 Ga0496107_0156675 3300048910 Bacteria 1686
342 Ga0496108_0010038 3300048911 Bacteria 7679
343 Ga0496108_0390408 3300048911 Bacteria 1215
344 Ga0496109_0291536 3300048912 Bacteria 1538
345 Ga0496109_0397988 3300048912 Bacteria 1301
346 Ga0496110_0002833 3300048913 Bacteria 13087
347 Ga0496110_0086250 3300048913 Bacteria 2803
348 Ga0496110_0487338 3300048913 Bacteria 1123
349 Ga0496111_0017579 3300048914 Bacteria 4944
350 Ga0496111_0155974 3300048914 Bacteria 1694
351 Ga0496111_0170146 3300048914 Bacteria 1619
352 Ga0496112_0004909 3300048915 Bacteria 11441
353 Ga0496112_0007039 3300048915 Bacteria 9936
354 Ga0496112_0131733 3300048915 Bacteria 2471
355 Ga0496112_0848394 3300048915 Bacteria 837
356 Ga0496113_0022006 3300048916 Bacteria 4503
357 Ga0496113_0036821 3300048916 Bacteria 3587
358 Ga0496114_0007202 3300048917 Bacteria 8780
359 Ga0496114_0064886 3300048917 Unclassified 3059
360 Ga0496115_0057270 3300048918 Bacteria 3134
361 Ga0496115_0166252 3300048918 Bacteria 1824
362 Ga0496115_0281265 3300048918 Bacteria 1366
363 nmdc:mga00v17_52009_c2 3300050491 Bacteria 2010
364 nmdc:mga0yw44_1294_c1 3300050492 Bacteria 9877
365 nmdc:mga05p37_409279_c1 3300050507 Bacteria 1581
366 nmdc:mga05p37_42625_c1 3300050507 Bacteria 5578
367 nmdc:mga05p37_48911_c1 3300050507 Bacteria 5200
368 nmdc:mga0qj67_27654_c1 3300050509 Bacteria 4397
369 nmdc:mga06r32_115275_c1 3300050510 Unclassified 2646
370 nmdc:mga0n895_69124_c1 3300050512 Bacteria 3499
371 nmdc:mga0n895_8800_c1 3300050512 Bacteria 8780
372 nmdc:mga0rr50_17860_c1 3300050513 Bacteria 4750
373 nmdc:mga08x19_22385_c1 3300050514 Bacteria 3915
374 nmdc:mga0a205_6050_c1 3300050515 Bacteria 10918
375 nmdc:mga0a205_683000_c1 3300050515 Bacteria 877
376 Ga0495601_0003137 3300053077 Bacteria 9456
377 Ga0495595_0003169 3300053084 Bacteria 6523
378 Ga0495595_0016074 3300053084 Bacteria 3196
379 Ga0495619_0014184 3300053085 Bacteria 5032
380 Ga0495619_0249741 3300053085 Bacteria 1229
381 Ga0436365_0045629
382 Ga0070668_100206915
383 Ga0070671_100392502
384 Ga0070673_100391656
385 Ga0070709_10036698
386 Ga0070714_100007344
387 Ga0070714_100019350
388 Ga0070714_100026158
389 Ga0070714_100051716
390 Ga0070713_100018149
391 Ga0070713_100030958
392 Ga0070713_100043427
393 Ga0070713_100145449
394 Ga0070713_100778032
395 Ga0070710_10000280
396 Ga0070710_10006741
397 Ga0070710_10015323
398 Ga0070710_10019452
399 Ga0070711_100008299
400 Ga0070711_100017219
401 Ga0070711_100021086
402 Ga0070711_100166688
403 Ga0070708_100012213
404 Ga0070708_100015507
405 Ga0070708_100054019
406 Ga0070706_100008352
407 Ga0070706_100011744
408 Ga0070706_100027522
409 Ga0070706_100070955
410 Ga0070706_100260589
411 Ga0070707_100004183
412 Ga0070707_100087226
413 Ga0070707_100374919
414 Ga0070698_100012420
415 Ga0070698_100044172
416 Ga0070699_100022113
417 Ga0070699_100090512
418 Ga0070699_100100480
419 Ga0070699_100265186
420 Ga0070679_100438421
421 Ga0070697_100526893
422 Ga0070686_100564237
423 Ga0070696_100162221
424 Ga0070693_100135772
425 Ga0068856_100052629
426 Ga0068856_100487671
427 Ga0070702_100193588
428 Ga0068863_100022125
429 Ga0068862_100421390
430 Ga0081455_10016242
431 Ga0081455_10045439
432 Ga0081538_10014175
433 Ga0081538_10036214
434 Ga0081538_10126003
435 Ga0070717_10022093
436 Ga0070717_10039140
437 Ga0070717_10066872
438 Ga0070717_10178189
439 Ga0070717_10221906
440 Ga0070717_10379388
441 Ga0075365_10001491
442 Ga0075364_10057504
443 Ga0070715_10003803
444 Ga0070715_10006934
445 Ga0070716_100006319
446 Ga0070716_100033145
447 Ga0070716_100089626
448 Ga0070712_100008789
449 Ga0070712_100018990
450 Ga0070712_100035910
451 Ga0068871_100306108
452 Ga0075428_100097222
453 Ga0075428_100790874
454 Ga0075430_100137941
455 Ga0075431_100113524
456 Ga0075433_10027677
457 Ga0075433_10049103
458 Ga0075434_100027269
459 Ga0075434_100242743
460 Ga0075434_100475345
461 Ga0075436_100229536
462 Ga0075435_100026324
463 Ga0105245_10341005
464 Ga0105247_10116229
465 Ga0105247_10183001
466 Ga0114129_10000886
467 Ga0114129_10021400
468 Ga0114129_10060899
469 Ga0114129_10399003
470 Ga0114129_10552840
471 Ga0114129_10940359
472 Ga0157369_10213964
473 Ga0157372_10766098
474 Ga0163163_10037311
475 Ga0157379_10096348
476 Ga0213874_10000123
477 Ga0213874_10009515
478 Ga0213876_10005965
479 Ga0213876_10006744
480 Ga0213876_10034640
481 Ga0213876_10047552
482 Ga0213876_10130730
483 Ga0207692_10007812
484 Ga0207692_10015998
485 Ga0207692_10020150
486 Ga0207692_10110194
487 Ga0207692_10162712
488 Ga0207642_10217506
489 Ga0207685_10000387
490 Ga0207685_10014765
491 Ga0207699_10001430
492 Ga0207699_10003839
493 Ga0207699_10015424
494 Ga0207699_10043121
495 Ga0207684_10001088
496 Ga0207684_10010240
497 Ga0207684_10010330
498 Ga0207684_10014550
499 Ga0207684_10081316
500 Ga0207684_10209510
501 Ga0207693_10001201
502 Ga0207693_10005301
503 Ga0207693_10020744
504 Ga0207693_10040994
505 Ga0207693_10205394
506 Ga0207663_10005187
507 Ga0207663_10011899
508 Ga0207663_10022752
509 Ga0207663_10341409
510 Ga0207652_10456235
511 Ga0207646_10178975
512 Ga0207646_10244931
513 Ga0207646_10563722
514 Ga0207650_10065760
515 Ga0207700_10001215
516 Ga0207700_10001951
517 Ga0207700_10025410
518 Ga0207700_10089116
519 Ga0207700_10092399
520 Ga0207700_10247667
521 Ga0207664_10004112
522 Ga0207664_10058115
523 Ga0207664_10064357
524 Ga0207664_10066606
525 Ga0207664_10307219
526 Ga0207664_10593817
527 Ga0207706_10496775
528 Ga0207665_10000972
529 Ga0207665_10031923
530 Ga0207665_10033779
531 Ga0207665_10294734
532 Ga0207667_10064018
533 Ga0207668_10434627
534 Ga0207702_10369390
535 Ga0207675_100311535
536 Ga0207683_10270338
537 Ga0207428_10048701
538 Ga0268265_10486343
539 Ga0265760_10041427
540 Ga0307406_10116652
541 Ga0307406_10268651
542 Ga0307407_10054249
543 Ga0307409_100621368
544 Ga0307415_100018752
545 Ga0307415_100321966
546 Ga0373930_0029342
547 Ga0373958_0057426
548 Ga0373928_0019068
549 Ga0373940_0034056
550 Ga0373944_0159026
551 Ga0373949_0013507
552 Ga0373952_0024963
553 Ga0373932_0014962
554 Ga0373939_0022445
555 Ga0373945_0055698
556 Ga0373953_0118063
557 Ga0373954_0200332
558 Ga0373957_0022038
559 Ga0373957_0090339
560 Ga0373943_0067670
561 Ga0373943_0089985
562 Ga0373955_0069569
563 Ga0373961_0013007
564 Ga0373924_0017963
565 Ga0373931_0019179
566 Ga0373935_0117859
567 Ga0373927_0049181
568 Ga0373927_0093468
569 Ga0373933_0004913
570 Ga0373933_0056573
571 Ga0373933_0103180
572 Ga0373947_0092204
573 Ga0373947_0213353
574 Ga0373947_0227225
575 Ga0373937_0011583
576 Ga0395899_0137203
577 Ga0395900_0104768
578 Ga0395900_0115785
579 Ga0395900_0189514
580 Ga0395898_0010492
581 Ga0395898_0037301
582 Ga0395905_0033053
583 Ga0395905_0097922
584 Ga0436364_0119405
585 Ga0436364_0262328
586 Ga0436364_0278951
587 Ga0436364_0393760
588 Ga0436364_0642014
589 Ga0436364_0901681
590 Ga0436364_0980411
591 Ga0436364_1092565
592 Ga0436364_1104375
593 Ga0436364_1237450
594 Ga0436364_1265637
595 Ga0395901_0114209
596 Ga0395901_0127715
597 Ga0395901_0245398
598 Ga0395901_0409538
599 Ga0436365_0024354
600 Ga0436365_0119159
601 Ga0436365_0501323
602 Ga0436365_0622858
603 Ga0436365_0833692
604 Ga0436365_1155867
605 Ga0436365_1278280
606 Ga0436365_1817543
607 Ga0436363_0024411
608 Ga0436363_0143875
609 Ga0436363_0278323
610 Ga0436363_0341189
611 Ga0436363_0638480
612 Ga0436363_0675537
613 Ga0436363_1360731
614 Ga0436363_1670711
615 Ga0436363_1718947
616 Ga0436362_0705963
617 Ga0436362_0805121
618 Ga0466965_0189144
619 Ga0466961_0014780
620 Ga0466961_0204192
621 Ga0466963_0002608
622 Ga0466964_0082193
623 Ga0466971_0124677
624 Ga0466968_0075397
625 Ga0466957_0009687
626 Ga0466957_0135555
627 Ga0466957_0208314
628 Ga0466959_0018207
629 Ga0466959_0031582
630 Ga0466959_0251035
631 Ga0466958_0009117
632 Ga0466958_0019978
633 Ga0466958_0028646
634 Ga0466958_0089448
635 Ga0466958_0159700
636 Ga0466967_0009133
637 Ga0466967_0065118
638 Ga0466967_0160141
639 Ga0466967_0618213
640 Ga0466967_0820127
641 Ga0495592_0016886
642 Ga0495592_0019023
643 Ga0495629_0043466
644 Ga0495641_0047117
645 Ga0495651_0014135
646 Ga0495651_0019496
647 Ga0495651_0186330
648 Ga0495651_0270372
649 Ga0495653_0019529
650 Ga0495653_0145467
651 Ga0495653_0183600
652 Ga0495662_0038267
653 Ga0495664_0049766
654 Ga0495584_0070635
655 Ga0495585_0099386
656 Ga0495608_0001773
657 Ga0495608_0001916
658 Ga0495608_0009659
659 Ga0495608_0062167
660 Ga0495628_0004834
661 Ga0495652_0019461
662 Ga0495652_0029503
663 Ga0495652_0109348
664 Ga0495665_0063269
665 Ga0495640_0014642
666 Ga0495640_0018727
667 Ga0495640_0034979
668 Ga0495587_0002844
669 Ga0495587_0010077
670 Ga0495587_0012036
671 Ga0495667_0008855
672 Ga0495667_0012012
673 Ga0495634_0058142
674 Ga0495634_0117850
675 Ga0495635_0042471
676 Ga0495588_0110071
677 Ga0495657_0002233
678 Ga0495657_0005277
679 Ga0495657_0338575
680 Ga0495599_0010093
681 Ga0495599_0063845
682 Ga0495623_0012001
683 Ga0495646_0091680
684 Ga0495646_0208467
685 Ga0495658_0111324
686 Ga0495613_0196885
687 Ga0495624_0035229
688 Ga0495600_0002583
689 Ga0495581_0283147
690 Ga0495604_0018048
691 Ga0495604_0018134
692 Ga0495604_0026775
693 Ga0495674_0018644
694 Ga0495674_0034706
695 Ga0495674_0038026
696 Ga0495676_0101922
697 Ga0495676_0166537
698 Ga0495676_0260334
699 Ga0495680_0000911
700 Ga0495680_0019391
701 Ga0495680_0148010
702 Ga0495680_0298057
703 Ga0495675_0016778
704 Ga0495684_0031302
705 Ga0495684_0040953
706 Ga0495684_0159826
707 Ga0495684_0193363
708 Ga0495593_0015247
709 Ga0495602_0011649
710 Ga0495602_0224159
711 Ga0496100_0126165
712 Ga0496101_0028123
713 Ga0496102_0275663
714 Ga0496103_0176681
715 Ga0496104_0084465
716 Ga0496105_0005065
717 Ga0496105_0031757
718 Ga0496105_0229575
719 Ga0496106_0050245
720 Ga0496106_0290734
721 Ga0496107_0156675
722 Ga0496108_0010038
723 Ga0496108_0390408
724 Ga0496109_0291536
725 Ga0496109_0397988
726 Ga0496110_0002833
727 Ga0496110_0086250
728 Ga0496110_0487338
729 Ga0496111_0017579
730 Ga0496111_0155974
731 Ga0496111_0170146
732 Ga0496112_0004909
733 Ga0496112_0007039
734 Ga0496112_0131733
735 Ga0496112_0848394
736 Ga0496113_0022006
737 Ga0496113_0036821
738 Ga0496114_0007202
739 Ga0496114_0064886
740 Ga0496115_0057270
741 Ga0496115_0166252
742 Ga0496115_0281265
743 nmdc:mga00v17_52009_c2
744 nmdc:mga0yw44_1294_c1
745 nmdc:mga05p37_409279_c1
746 nmdc:mga05p37_42625_c1
747 nmdc:mga05p37_48911_c1
748 nmdc:mga0qj67_27654_c1
749 nmdc:mga06r32_115275_c1
750 nmdc:mga0n895_69124_c1
751 nmdc:mga0n895_8800_c1
752 nmdc:mga0rr50_17860_c1
753 nmdc:mga08x19_22385_c1
754 nmdc:mga0a205_6050_c1
755 nmdc:mga0a205_683000_c1
756 Ga0495601_0003137
757 Ga0495595_0003169
758 Ga0495595_0016074
759 Ga0495619_0014184
760 Ga0495619_0249741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

43

282

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6of9-assembly1.cif.gz_F-2 structure of the chlamydamonas reinhardtii camkii hub homology domain 0.8384 181 198
6of9-assembly1.cif.gz_E structure of the chlamydamonas reinhardtii camkii hub homology domain 0.8055 181 198
3p7x-assembly1.cif.gz_A crystal structure of an atypical two-cysteine peroxiredoxin (saouhsc_01822) from staphylococcus aureus nctc8325 0.7657 40 199
4l8o-assembly1.cif.gz_A crystal structure of a bile-acid 7-alpha dehydratase (clohylem_06634) from clostridium hylemonae dsm 15053 at 2.20 a resolution 0.7381 181 199
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.7224 44 196
ID Description Score Start End Superfamily
af_O94561_50_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7719 44 196 3.40.30.10
af_I6YGW6_98_222_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7556 75 196 3.40.30.10
af_Q8IJD0_13_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7272 50 197 3.40.30.10
af_Q5XFW6_79_391_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.722 181 199 2.130.10.10
af_I1N3I5_6_133_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7194 181 199 2.60.40.150
ID Description Score Start End GO Terms
AF-A0A160FWF9-F1-model_v4 DUF899 domain-containing protein 0.9716 2 203
AF-A0A2E6I187-F1-model_v4 Uncharacterized protein 0.9605 113 179
AF-A0A535ADI3-F1-model_v4 DUF899 domain-containing protein 0.9203 1 215
AF-A0A0Q4YBX6-F1-model_v4 Uncharacterized protein 0.9126 72 158
AF-C4B471-F1-model_v4 deleted 0.8956 1 214

Map