F428706

General Info

Members Datasets Scaffolds Average Seq Length
380 224 760 306

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100011921|Ga0307408_1000119214
Length 361
Sequence MLVRACSWLQLLNDDIIERMKGSSCKLAPSSHQQKGGLALPVLSLPFPLTAFSNFNEMTDNKNFDVIIVGGSYAGLSAAMALGRALRNVLIIDSGLPCNRQTPHSHNFITQDGEKPSVIADKAKKEVLKYDTVKFLTDLAVSGTKTDKGFEISTQSGKLFSAKKLVFATGLKDEMLNIDGFSECWGITVIHCPYCHGYEVKNQKTGILANGYPAFHLARLIHNWTKDLTIFTNGKSELTQEQTDEIKRHNISIVEKEITSLKHKDGVVEEIIFSDNSTFELKAIYSRPPFKQHCKIPELLGCELTEQGLVKVDAFQKTTVDNIFACGDNTNPIRSVSYAVSTGNNTGVFLNNAMTEEEFLK

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
157 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
181 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
182 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
189 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
193 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
194 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
195 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
196 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
197 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
198 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
199 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
200 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
201 2738541278 Niastella sp. CF465 Isolate Unclassified
202 2738541284 Pedobacter sp. YR016 Isolate Unclassified
203 2739367656 Pedobacter sp. CF523 Isolate Unclassified
204 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
205 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
206 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
207 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
208 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
209 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
210 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
211 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
212 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
213 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
214 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
215 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
216 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
217 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
218 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
219 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
220 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
221 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
222 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
223 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
224 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.05
Metatranscriptomes 0
Isolates 8.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 0.26
Rhizoplane 0.53
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100011921 3300031548 Bacteria 5752
2 SwRhRL2b_contig_2056031 2162886007 Bacteria 41625
3 JGI24740J21852_10000062 3300001979 Bacteria 34499
4 JGI24739J22299_10000490 3300001989 Bacteria 13968
5 JGI25406J46586_10008588 3300003203 Bacteria 4616
6 JGI25153J46596_10013716 3300003215 Bacteria 3410
7 rootH2_10001891 3300003320 Bacteria 464318
8 rootL2_10057920 3300003322 Bacteria 2869
9 rootH1_10000778 3300003323 Bacteria 106851
10 rootH1_10248179 3300003323 Bacteria 2394
11 Ga0055542_1003027 3300003762 Bacteria 4874
12 Ga0055526_1006957 3300003771 Bacteria 6004
13 Ga0055536_1005915 3300003781 Bacteria 5853
14 Ga0055534_1005855 3300003784 Bacteria 3210
15 Ga0055531_10000077 3300003794 Bacteria 106111
16 Ga0065165_1010106 3300005262 Bacteria 4134
17 Ga0065714_10005451 3300005288 Bacteria 8360
18 Ga0065714_10071630 3300005288 Bacteria 3531
19 Ga0065714_10087123 3300005288 Bacteria 2062
20 Ga0065714_10088849 3300005288 Bacteria 2001
21 Ga0065704_10000217 3300005289 Bacteria 101781
22 Ga0070658_10136434 3300005327 Bacteria 2047
23 Ga0070658_10146930 3300005327 Bacteria 1972
24 Ga0070676_10034020 3300005328 Bacteria 2925
25 Ga0070683_100000590 3300005329 Bacteria 25960
26 Ga0070683_100012036 3300005329 Bacteria 7504
27 Ga0070683_100045245 3300005329 Bacteria 4062
28 Ga0070690_100051953 3300005330 Unclassified 2619
29 Ga0070690_100186771 3300005330 Bacteria 1435
30 Ga0068869_100002453 3300005334 Bacteria 11183
31 Ga0068869_100003875 3300005334 Bacteria 9231
32 Ga0070666_10002813 3300005335 Bacteria 10507
33 Ga0070680_100096858 3300005336 Bacteria 2446
34 Ga0070680_100180905 3300005336 Unclassified 1776
35 Ga0070682_100009532 3300005337 Bacteria 5495
36 Ga0068868_100000951 3300005338 Bacteria 19707
37 Ga0068868_100014674 3300005338 Bacteria 5779
38 Ga0068868_100116753 3300005338 Bacteria 2173
39 Ga0068868_100205993 3300005338 Bacteria 1642
40 Ga0070689_100001165 3300005340 Bacteria 16610
41 Ga0070689_100017344 3300005340 Bacteria 5286
42 Ga0070691_10002194 3300005341 Bacteria 8633
43 Ga0070687_100058465 3300005343 Bacteria 2026
44 Ga0070661_100002035 3300005344 Bacteria 13956
45 Ga0070661_100050079 3300005344 Bacteria 3057
46 Ga0070669_100073543 3300005353 Bacteria 2532
47 Ga0070675_100081616 3300005354 Bacteria 2696
48 Ga0070671_100017898 3300005355 Bacteria 5746
49 Ga0070671_100186953 3300005355 Bacteria 1755
50 Ga0070671_100268042 3300005355 Bacteria 1451
51 Ga0070673_100087068 3300005364 Bacteria 2546
52 Ga0070688_100031287 3300005365 Bacteria 3201
53 Ga0070667_100005964 3300005367 Bacteria 10127
54 Ga0070667_100007884 3300005367 Bacteria 8836
55 Ga0070667_100067270 3300005367 Bacteria 3045
56 Ga0070667_100252835 3300005367 Bacteria 1576
57 Ga0070701_10192920 3300005438 Bacteria 1200
58 Ga0070694_100196136 3300005444 Bacteria 1502
59 Ga0070663_100022468 3300005455 Bacteria 4218
60 Ga0070662_100013766 3300005457 Bacteria 5388
61 Ga0070662_100039908 3300005457 Bacteria 3341
62 Ga0070681_10418472 3300005458 Unclassified 1252
63 Ga0068867_100261784 3300005459 Bacteria 1410
64 Ga0070685_10005417 3300005466 Bacteria 6463
65 Ga0070679_100004894 3300005530 Bacteria 12350
66 Ga0070679_100165324 3300005530 Bacteria 2186
67 Ga0070679_100355504 3300005530 Bacteria 1412
68 Ga0070684_100000540 3300005535 Bacteria 25978
69 Ga0068853_100002832 3300005539 Bacteria 13144
70 Ga0068853_100078559 3300005539 Bacteria 2884
71 Ga0068853_100284605 3300005539 Bacteria 1524
72 Ga0070672_100006245 3300005543 Bacteria 7985
73 Ga0070665_100000063 3300005548 Bacteria 218300
74 Ga0070665_100003758 3300005548 Bacteria 16072
75 Ga0070665_100185859 3300005548 Bacteria 2079
76 Ga0068855_100012897 3300005563 Bacteria 10085
77 Ga0068855_100035945 3300005563 Bacteria 5898
78 Ga0068855_100220774 3300005563 Bacteria 2125
79 Ga0068855_100316311 3300005563 Bacteria 1726
80 Ga0068855_100465972 3300005563 Bacteria 1377
81 Ga0070664_100000688 3300005564 Bacteria 25823
82 Ga0070664_100093588 3300005564 Bacteria 2604
83 Ga0070664_100487386 3300005564 Bacteria 1135
84 Ga0068857_100361082 3300005577 Bacteria 1346
85 Ga0068854_100034941 3300005578 Bacteria 3516
86 Ga0068852_100000396 3300005616 Bacteria 29216
87 Ga0068852_100002850 3300005616 Bacteria 11991
88 Ga0068859_100010480 3300005617 Bacteria 9324
89 Ga0068859_100087206 3300005617 Bacteria 3168
90 Ga0068859_100185231 3300005617 Bacteria 2165
91 Ga0068859_100197880 3300005617 Bacteria 2094
92 Ga0068864_100015606 3300005618 Bacteria 6318
93 Ga0068864_100032622 3300005618 Bacteria 4426
94 Ga0068861_100014329 3300005719 Bacteria 5562
95 Ga0068861_100014829 3300005719 Bacteria 5476
96 Ga0068851_10020622 3300005834 Bacteria 3193
97 Ga0068863_100048526 3300005841 Bacteria 4026
98 Ga0068863_100172224 3300005841 Bacteria 2076
99 Ga0068858_100044117 3300005842 Bacteria 4134
100 Ga0068860_100000059 3300005843 Bacteria 196400
101 Ga0068860_100004512 3300005843 Bacteria 14204
102 Ga0068860_100014042 3300005843 Bacteria 7856
103 Ga0068860_100018044 3300005843 Bacteria 6871
104 Ga0068860_100028481 3300005843 Bacteria 5376
105 Ga0068860_100034582 3300005843 Bacteria 4848
106 Ga0068862_100039406 3300005844 Unclassified 4013
107 Ga0081455_10139773 3300005937 Bacteria 1882
108 Ga0081539_10006249 3300005985 Bacteria 11535
109 Ga0097621_100000708 3300006237 Bacteria 23406
110 Ga0097621_100058463 3300006237 Bacteria 3154
111 Ga0097621_100079355 3300006237 Bacteria 2728
112 Ga0097621_100617510 3300006237 Bacteria 992
113 Ga0068871_100004538 3300006358 Bacteria 9680
114 Ga0068871_100270465 3300006358 Bacteria 1484
115 Ga0068871_100469417 3300006358 Bacteria 1130
116 Ga0068865_100000626 3300006881 Bacteria 19886
117 Ga0097620_100010480 3300006931 Bacteria 9324
118 Ga0097620_100069174 3300006931 Unclassified 3565
119 Ga0097620_100087206 3300006931 Bacteria 3168
120 Ga0097620_100163833 3300006931 Bacteria 2302
121 Ga0097620_100185230 3300006931 Bacteria 2165
122 Ga0097620_100197868 3300006931 Bacteria 2094
123 Ga0099826_10108897 3300006948 Bacteria 1654
124 Ga0105251_10059604 3300009011 Bacteria 1799
125 Ga0105244_10154484 3300009036 Bacteria 1098
126 Ga0105240_10005978 3300009093 Bacteria 18006
127 Ga0105240_10025976 3300009093 Bacteria 7692
128 Ga0105240_10027823 3300009093 Bacteria 7397
129 Ga0105240_10034865 3300009093 Bacteria 6488
130 Ga0105243_10000012 3300009148 Bacteria 300885
131 Ga0105241_10161205 3300009174 Bacteria 1844
132 Ga0105241_10261533 3300009174 Bacteria 1471
133 Ga0105237_10001524 3300009545 Bacteria 30382
134 Ga0105237_10425549 3300009545 Bacteria 1333
135 Ga0105238_10108715 3300009551 Bacteria 2754
136 Ga0105249_10101346 3300009553 Bacteria 2708
137 Ga0105239_10002372 3300010375 Bacteria 24021
138 Ga0105239_10004497 3300010375 Bacteria 16641
139 Ga0105239_10009813 3300010375 Bacteria 10757
140 Ga0105246_10141991 3300011119 Bacteria 1807
141 Ga0157373_10000064 3300013100 Bacteria 94176
142 Ga0157373_10026615 3300013100 Bacteria 4175
143 Ga0157373_10071672 3300013100 Bacteria 2447
144 Ga0157371_10000760 3300013102 Bacteria 37271
145 Ga0157371_10001595 3300013102 Bacteria 23267
146 Ga0157371_10002418 3300013102 Bacteria 17861
147 Ga0157371_10014670 3300013102 Bacteria 5899
148 Ga0157371_10114889 3300013102 Unclassified 1912
149 Ga0157370_10000072 3300013104 Bacteria 110176
150 Ga0157370_10000121 3300013104 Bacteria 91715
151 Ga0157370_10009790 3300013104 Bacteria 10165
152 Ga0157370_10035364 3300013104 Bacteria 4856
153 Ga0157370_10050640 3300013104 Bacteria 3969
154 Ga0157370_10066485 3300013104 Bacteria 3409
155 Ga0157370_10105008 3300013104 Bacteria 2645
156 Ga0157370_10422941 3300013104 Bacteria 1226
157 Ga0157369_10001103 3300013105 Bacteria 33807
158 Ga0157369_10143840 3300013105 Bacteria 2522
159 Ga0157374_10000456 3300013296 Bacteria 37266
160 Ga0157374_10414132 3300013296 Bacteria 1346
161 Ga0157378_10006046 3300013297 Bacteria 10604
162 Ga0157378_10079084 3300013297 Bacteria 2968
163 Ga0157378_10082693 3300013297 Bacteria 2904
164 Ga0157378_10168248 3300013297 Bacteria 2054
165 Ga0163162_10007852 3300013306 Bacteria 10396
166 Ga0163162_10033120 3300013306 Bacteria 5133
167 Ga0157372_10000001 3300013307 Bacteria 791349
168 Ga0157372_10012837 3300013307 Bacteria 8929
169 Ga0157372_10065775 3300013307 Bacteria 4072
170 Ga0157372_10102240 3300013307 Unclassified 3273
171 Ga0157372_10140685 3300013307 Bacteria 2780
172 Ga0157372_10286619 3300013307 Unclassified 1915
173 Ga0157372_10465610 3300013307 Bacteria 1473
174 Ga0157375_10006506 3300013308 Bacteria 10168
175 Ga0163163_10127487 3300014325 Bacteria 2583
176 Ga0182008_10000008 3300014497 Bacteria 371823
177 Ga0182008_10000010 3300014497 Bacteria 301527
178 Ga0157377_10009093 3300014745 Bacteria 4866
179 Ga0157377_10021076 3300014745 Bacteria 3423
180 Ga0157379_10040224 3300014968 Bacteria 4172
181 Ga0157379_10138096 3300014968 Bacteria 2197
182 Ga0157376_10057763 3300014969 Bacteria 3247
183 Ga0182006_1003292 3300015261 Bacteria 8344
184 Ga0182006_1013095 3300015261 Bacteria 3609
185 Ga0182006_1064282 3300015261 Bacteria 1376
186 Ga0182007_10064158 3300015262 Bacteria 1204
187 Ga0182005_1000101 3300015265 Bacteria 65209
188 Ga0163161_10000129 3300017792 Bacteria 70623
189 Ga0163161_10000458 3300017792 Bacteria 33817
190 Ga0163161_10002342 3300017792 Bacteria 13581
191 Ga0163161_10163516 3300017792 Bacteria 1698
192 Ga0163161_10255492 3300017792 Bacteria 1367
193 Ga0209258_100354 3300025242 Bacteria 63709
194 Ga0209646_1008605 3300025246 Bacteria 1638
195 Ga0209026_1000709 3300025250 Bacteria 19750
196 Ga0209026_1007987 3300025250 Bacteria 2279
197 Ga0209148_1000336 3300025254 Bacteria 63669
198 Ga0209148_1012329 3300025254 Bacteria 1566
199 Ga0209673_1018921 3300025273 Bacteria 2488
200 Ga0209675_1000637 3300025291 Bacteria 24923
201 Ga0209676_1002591 3300025292 Bacteria 12435
202 Ga0209564_1002576 3300025295 Bacteria 13943
203 Ga0209758_1003604 3300025297 Bacteria 13855
204 Ga0207426_1004483 3300025302 Bacteria 6775
205 Ga0207426_1021135 3300025302 Bacteria 2252
206 Ga0209257_1000007 3300025304 Bacteria 1564415
207 Ga0207656_10034724 3300025321 Bacteria 2107
208 Ga0207682_10134253 3300025893 Bacteria 1106
209 Ga0207710_10008295 3300025900 Bacteria 4385
210 Ga0207680_10000280 3300025903 Bacteria 24408
211 Ga0207647_10028068 3300025904 Bacteria 3661
212 Ga0207645_10005155 3300025907 Bacteria 9550
213 Ga0207645_10028566 3300025907 Bacteria 3599
214 Ga0207705_10007557 3300025909 Bacteria 7987
215 Ga0207654_10003301 3300025911 Bacteria 8157
216 Ga0207707_10001291 3300025912 Bacteria 23352
217 Ga0207695_10000648 3300025913 Bacteria 69088
218 Ga0207695_10004937 3300025913 Bacteria 17973
219 Ga0207695_10032985 3300025913 Bacteria 5658
220 Ga0207695_10380296 3300025913 Bacteria 1298
221 Ga0207671_10000157 3300025914 Bacteria 105839
222 Ga0207671_10000653 3300025914 Bacteria 45335
223 Ga0207671_10003400 3300025914 Bacteria 15913
224 Ga0207671_10025561 3300025914 Bacteria 4435
225 Ga0207671_10409794 3300025914 Bacteria 1078
226 Ga0207660_10002469 3300025917 Bacteria 12145
227 Ga0207660_10257403 3300025917 Bacteria 1379
228 Ga0207657_10164046 3300025919 Bacteria 1803
229 Ga0207649_10009949 3300025920 Bacteria 5211
230 Ga0207649_10045251 3300025920 Bacteria 2697
231 Ga0207649_10113550 3300025920 Bacteria 1814
232 Ga0207652_10002507 3300025921 Bacteria 15429
233 Ga0207652_10038326 3300025921 Unclassified 4062
234 Ga0207652_10119712 3300025921 Bacteria 2342
235 Ga0207646_10357696 3300025922 Bacteria 1319
236 Ga0207694_10157130 3300025924 Bacteria 1835
237 Ga0207659_10009276 3300025926 Bacteria 6144
238 Ga0207659_10139070 3300025926 Bacteria 1883
239 Ga0207687_10418772 3300025927 Bacteria 1105
240 Ga0207644_10055892 3300025931 Bacteria 2846
241 Ga0207706_10013235 3300025933 Bacteria 7505
242 Ga0207706_10108021 3300025933 Bacteria 2449
243 Ga0207709_10000006 3300025935 Bacteria 800946
244 Ga0207670_10023633 3300025936 Bacteria 3830
245 Ga0207670_10035593 3300025936 Bacteria 3230
246 Ga0207704_10000705 3300025938 Bacteria 14720
247 Ga0207704_10003499 3300025938 Bacteria 7143
248 Ga0207691_10082310 3300025940 Bacteria 2891
249 Ga0207689_10017077 3300025942 Bacteria 6141
250 Ga0207689_10023253 3300025942 Bacteria 5204
251 Ga0207689_10093653 3300025942 Bacteria 2468
252 Ga0207661_10025662 3300025944 Bacteria 4483
253 Ga0207661_10067641 3300025944 Bacteria 2906
254 Ga0207679_10000522 3300025945 Bacteria 25961
255 Ga0207679_10205007 3300025945 Bacteria 1650
256 Ga0207667_10022919 3300025949 Bacteria 6883
257 Ga0207667_10046729 3300025949 Bacteria 4584
258 Ga0207667_10152700 3300025949 Bacteria 2376
259 Ga0207651_10360072 3300025960 Bacteria 1227
260 Ga0207668_10011302 3300025972 Bacteria 5418
261 Ga0207640_10047773 3300025981 Bacteria 2763
262 Ga0207658_10005011 3300025986 Bacteria 9123
263 Ga0207677_10004535 3300026023 Bacteria 7470
264 Ga0207677_10035451 3300026023 Bacteria 3241
265 Ga0207677_10119372 3300026023 Bacteria 1980
266 Ga0207703_10005395 3300026035 Bacteria 10294
267 Ga0207703_10022724 3300026035 Bacteria 4925
268 Ga0207703_10099325 3300026035 Bacteria 2463
269 Ga0207639_10003747 3300026041 Bacteria 10231
270 Ga0207639_10005577 3300026041 Bacteria 8512
271 Ga0207639_10073109 3300026041 Bacteria 2687
272 Ga0207678_10103911 3300026067 Bacteria 2424
273 Ga0207678_10372733 3300026067 Bacteria 1233
274 Ga0207641_10001580 3300026088 Bacteria 22205
275 Ga0207641_10048004 3300026088 Bacteria 3603
276 Ga0207641_10657573 3300026088 Bacteria 1030
277 Ga0207648_10016273 3300026089 Bacteria 6803
278 Ga0207648_10302242 3300026089 Bacteria 1435
279 Ga0207648_10321742 3300026089 Bacteria 1390
280 Ga0207676_10025130 3300026095 Bacteria 4417
281 Ga0207676_10482031 3300026095 Bacteria 1175
282 Ga0207674_10246695 3300026116 Bacteria 1733
283 Ga0207674_10416228 3300026116 Bacteria 1298
284 Ga0207683_10017387 3300026121 Bacteria 6128
285 Ga0207683_10369395 3300026121 Bacteria 1318
286 Ga0207698_10007503 3300026142 Bacteria 6834
287 Ga0207698_10011494 3300026142 Bacteria 5742
288 Ga0207698_10067662 3300026142 Bacteria 2817
289 Ga0207698_10261243 3300026142 Bacteria 1591
290 Ga0207698_10466985 3300026142 Unclassified 1221
291 Ga0207428_10069522 3300027907 Bacteria 2769
292 Ga0268266_10000057 3300028379 Bacteria 284777
293 Ga0268266_10031270 3300028379 Bacteria 4519
294 Ga0268265_10030022 3300028380 Unclassified 3911
295 Ga0268264_10000015 3300028381 Bacteria 508501
296 Ga0268264_10003095 3300028381 Bacteria 14397
297 Ga0268264_10061175 3300028381 Bacteria 3158
298 Ga0307517_10001604 3300028786 Bacteria 37610
299 Ga0316176_1039412 3300030732 Bacteria 12999
300 Ga0316181_1172860 3300030744 Bacteria 2081
301 Ga0307408_100000402 3300031548 Bacteria 38881
302 Ga0307412_10001317 3300031911 Bacteria 13902
303 Ga0307412_10010714 3300031911 Bacteria 5287
304 Ga0307416_100000394 3300032002 Bacteria 22418
305 Ga0395899_0000121 3300037312 Bacteria 125324
306 Ga0395899_0000524 3300037312 Bacteria 42071
307 Ga0395899_0002278 3300037312 Bacteria 15677
308 Ga0395899_0018050 3300037312 Bacteria 5370
309 Ga0395899_0143324 3300037312 Bacteria 1699
310 Ga0395900_0000554 3300037418 Bacteria 51989
311 Ga0395900_0058343 3300037418 Bacteria 3973
312 Ga0395900_0106428 3300037418 Bacteria 2881
313 Ga0395898_0069260 3300037466 Bacteria 3413
314 Ga0395905_0000246 3300037471 Bacteria 81356
315 Ga0395905_0005875 3300037471 Bacteria 12454
316 Ga0395901_0000184 3300038443 Bacteria 81257
317 Ga0395901_0004177 3300038443 Bacteria 14574
318 Ga0395901_0186162 3300038443 Bacteria 2178
319 Ga0439439_0022708 3300041406 Bacteria 1569
320 Ga0439457_005726 3300042014 Bacteria 3090
321 Ga0450897_001586 3300042128 Bacteria 1569
322 Ga0439458_0014433 3300042157 Bacteria 1784
323 Ga0495607_0134872 3300046501 Bacteria 1279
324 Ga0495606_0093842 3300046507 Bacteria 1840
325 Ga0495633_0000951 3300046558 Bacteria 24071
326 Ga0495668_0000489 3300046616 Bacteria 49613
327 Ga0495687_000004 3300047443 Bacteria 779298
328 Ga0496109_0033862 3300048912 Bacteria 4599
329 Ga0496115_0010499 3300048918 Bacteria 6922
330 Ga0496121_0000011 3300048924 Bacteria 792193
331 Ga0496121_0012630 3300048924 Bacteria 9176
332 Ga0496124_0122700 3300048927 Bacteria 2074
333 Ga0496126_0000765 3300048929 Bacteria 58196
334 Ga0501033_0016432 3300049570 Bacteria 5606
335 Ga0501236_000331 3300049670 Bacteria 5157
336 Ga0501268_001909 3300049765 Bacteria 2667
337 Ga0501280_005915 3300049776 Bacteria 1737
338 Ga0501035_0091424 3300049822 Bacteria 2679
339 nmdc:mga06r32_88917_c1 3300050510 Bacteria 3015
340 nmdc:mga08y16_22544_c1 3300050511 Bacteria 6648
341 Ga0500644_0000044 3300053088 Bacteria 75503
342 Ga0500583_0001500 3300053092 Bacteria 6717
343 Ga0500569_000889 3300053109 Bacteria 5332
344 Ga0500577_0011034 3300053142 Unclassified 2682
345 Ga0500616_0065147 3300053153 Unclassified 1874
346 Ga0500622_0002871 3300053156 Bacteria 12047
347 2511231761 2511231000 Bacteria 4488346
348 2513233236 2513020052 Bacteria 5120511
349 2520880347 2519899754 Bacteria 5336938
350 2585156199 2582581281 Bacteria 4487904
351 2585160408 2582581282 Bacteria 4495830
352 2587866555 2585428095 Bacteria 3789702
353 2588209196 2585428182 Bacteria 5007281
354 2588234105 2585428187 Bacteria 4629388
355 2729202796 2728369107 Bacteria 5082720
356 2738730649 2738541278 Bacteria 9755573
357 2738760756 2738541284 Bacteria 5199923
358 2739614484 2739367656 Bacteria 5152243
359 2765576567 2765235839 Bacteria 5314748
360 2776612960 2775506987 Bacteria 5373360
361 2819576392 2818991442 Bacteria 8318214
362 2821142595 2821136567 Bacteria 8080116
363 2842906276 2842903701 Bacteria 6986368
364 2849281989 2849281842 Bacteria 6065644
365 2881249576 2881247448 Bacteria 3717788
366 2881361304 2881359912 Bacteria 4935907
367 2881363318 2881359912 Bacteria 4935907
368 2898715334 2898713307 Bacteria 4110805
369 2902050848 2902048731 Bacteria 4976191
370 2903896593 2903895155 Bacteria 5258610
371 2904470237 2904467357 Bacteria 8057758
372 2919186849 2919186247 Bacteria 6244071
373 2939665882 2939664404 Bacteria 6364494
374 2946002601 2945997725 Bacteria 6404843
375 2958461804 2958458903 Bacteria 5301041
376 2977233234 2977232053 Bacteria 5485925
377 2993374615 2993372514 Bacteria 4214139
378 2993481496 2993480792 Bacteria 4022225
379 8055420265 8055419101 Bacteria 5289643
380 8055592173 8055592153 Bacteria 5961247
381 Ga0307408_100011921
382 SwRhRL2b_contig_2056031
383 JGI24740J21852_10000062
384 JGI24739J22299_10000490
385 JGI25406J46586_10008588
386 JGI25153J46596_10013716
387 rootH2_10001891
388 rootL2_10057920
389 rootH1_10000778
390 rootH1_10248179
391 Ga0055542_1003027
392 Ga0055526_1006957
393 Ga0055536_1005915
394 Ga0055534_1005855
395 Ga0055531_10000077
396 Ga0065165_1010106
397 Ga0065714_10005451
398 Ga0065714_10071630
399 Ga0065714_10087123
400 Ga0065714_10088849
401 Ga0065704_10000217
402 Ga0070658_10136434
403 Ga0070658_10146930
404 Ga0070676_10034020
405 Ga0070683_100000590
406 Ga0070683_100012036
407 Ga0070683_100045245
408 Ga0070690_100051953
409 Ga0070690_100186771
410 Ga0068869_100002453
411 Ga0068869_100003875
412 Ga0070666_10002813
413 Ga0070680_100096858
414 Ga0070680_100180905
415 Ga0070682_100009532
416 Ga0068868_100000951
417 Ga0068868_100014674
418 Ga0068868_100116753
419 Ga0068868_100205993
420 Ga0070689_100001165
421 Ga0070689_100017344
422 Ga0070691_10002194
423 Ga0070687_100058465
424 Ga0070661_100002035
425 Ga0070661_100050079
426 Ga0070669_100073543
427 Ga0070675_100081616
428 Ga0070671_100017898
429 Ga0070671_100186953
430 Ga0070671_100268042
431 Ga0070673_100087068
432 Ga0070688_100031287
433 Ga0070667_100005964
434 Ga0070667_100007884
435 Ga0070667_100067270
436 Ga0070667_100252835
437 Ga0070701_10192920
438 Ga0070694_100196136
439 Ga0070663_100022468
440 Ga0070662_100013766
441 Ga0070662_100039908
442 Ga0070681_10418472
443 Ga0068867_100261784
444 Ga0070685_10005417
445 Ga0070679_100004894
446 Ga0070679_100165324
447 Ga0070679_100355504
448 Ga0070684_100000540
449 Ga0068853_100002832
450 Ga0068853_100078559
451 Ga0068853_100284605
452 Ga0070672_100006245
453 Ga0070665_100000063
454 Ga0070665_100003758
455 Ga0070665_100185859
456 Ga0068855_100012897
457 Ga0068855_100035945
458 Ga0068855_100220774
459 Ga0068855_100316311
460 Ga0068855_100465972
461 Ga0070664_100000688
462 Ga0070664_100093588
463 Ga0070664_100487386
464 Ga0068857_100361082
465 Ga0068854_100034941
466 Ga0068852_100000396
467 Ga0068852_100002850
468 Ga0068859_100010480
469 Ga0068859_100087206
470 Ga0068859_100185231
471 Ga0068859_100197880
472 Ga0068864_100015606
473 Ga0068864_100032622
474 Ga0068861_100014329
475 Ga0068861_100014829
476 Ga0068851_10020622
477 Ga0068863_100048526
478 Ga0068863_100172224
479 Ga0068858_100044117
480 Ga0068860_100000059
481 Ga0068860_100004512
482 Ga0068860_100014042
483 Ga0068860_100018044
484 Ga0068860_100028481
485 Ga0068860_100034582
486 Ga0068862_100039406
487 Ga0081455_10139773
488 Ga0081539_10006249
489 Ga0097621_100000708
490 Ga0097621_100058463
491 Ga0097621_100079355
492 Ga0097621_100617510
493 Ga0068871_100004538
494 Ga0068871_100270465
495 Ga0068871_100469417
496 Ga0068865_100000626
497 Ga0097620_100010480
498 Ga0097620_100069174
499 Ga0097620_100087206
500 Ga0097620_100163833
501 Ga0097620_100185230
502 Ga0097620_100197868
503 Ga0099826_10108897
504 Ga0105251_10059604
505 Ga0105244_10154484
506 Ga0105240_10005978
507 Ga0105240_10025976
508 Ga0105240_10027823
509 Ga0105240_10034865
510 Ga0105243_10000012
511 Ga0105241_10161205
512 Ga0105241_10261533
513 Ga0105237_10001524
514 Ga0105237_10425549
515 Ga0105238_10108715
516 Ga0105249_10101346
517 Ga0105239_10002372
518 Ga0105239_10004497
519 Ga0105239_10009813
520 Ga0105246_10141991
521 Ga0157373_10000064
522 Ga0157373_10026615
523 Ga0157373_10071672
524 Ga0157371_10000760
525 Ga0157371_10001595
526 Ga0157371_10002418
527 Ga0157371_10014670
528 Ga0157371_10114889
529 Ga0157370_10000072
530 Ga0157370_10000121
531 Ga0157370_10009790
532 Ga0157370_10035364
533 Ga0157370_10050640
534 Ga0157370_10066485
535 Ga0157370_10105008
536 Ga0157370_10422941
537 Ga0157369_10001103
538 Ga0157369_10143840
539 Ga0157374_10000456
540 Ga0157374_10414132
541 Ga0157378_10006046
542 Ga0157378_10079084
543 Ga0157378_10082693
544 Ga0157378_10168248
545 Ga0163162_10007852
546 Ga0163162_10033120
547 Ga0157372_10000001
548 Ga0157372_10012837
549 Ga0157372_10065775
550 Ga0157372_10102240
551 Ga0157372_10140685
552 Ga0157372_10286619
553 Ga0157372_10465610
554 Ga0157375_10006506
555 Ga0163163_10127487
556 Ga0182008_10000008
557 Ga0182008_10000010
558 Ga0157377_10009093
559 Ga0157377_10021076
560 Ga0157379_10040224
561 Ga0157379_10138096
562 Ga0157376_10057763
563 Ga0182006_1003292
564 Ga0182006_1013095
565 Ga0182006_1064282
566 Ga0182007_10064158
567 Ga0182005_1000101
568 Ga0163161_10000129
569 Ga0163161_10000458
570 Ga0163161_10002342
571 Ga0163161_10163516
572 Ga0163161_10255492
573 Ga0209258_100354
574 Ga0209646_1008605
575 Ga0209026_1000709
576 Ga0209026_1007987
577 Ga0209148_1000336
578 Ga0209148_1012329
579 Ga0209673_1018921
580 Ga0209675_1000637
581 Ga0209676_1002591
582 Ga0209564_1002576
583 Ga0209758_1003604
584 Ga0207426_1004483
585 Ga0207426_1021135
586 Ga0209257_1000007
587 Ga0207656_10034724
588 Ga0207682_10134253
589 Ga0207710_10008295
590 Ga0207680_10000280
591 Ga0207647_10028068
592 Ga0207645_10005155
593 Ga0207645_10028566
594 Ga0207705_10007557
595 Ga0207654_10003301
596 Ga0207707_10001291
597 Ga0207695_10000648
598 Ga0207695_10004937
599 Ga0207695_10032985
600 Ga0207695_10380296
601 Ga0207671_10000157
602 Ga0207671_10000653
603 Ga0207671_10003400
604 Ga0207671_10025561
605 Ga0207671_10409794
606 Ga0207660_10002469
607 Ga0207660_10257403
608 Ga0207657_10164046
609 Ga0207649_10009949
610 Ga0207649_10045251
611 Ga0207649_10113550
612 Ga0207652_10002507
613 Ga0207652_10038326
614 Ga0207652_10119712
615 Ga0207646_10357696
616 Ga0207694_10157130
617 Ga0207659_10009276
618 Ga0207659_10139070
619 Ga0207687_10418772
620 Ga0207644_10055892
621 Ga0207706_10013235
622 Ga0207706_10108021
623 Ga0207709_10000006
624 Ga0207670_10023633
625 Ga0207670_10035593
626 Ga0207704_10000705
627 Ga0207704_10003499
628 Ga0207691_10082310
629 Ga0207689_10017077
630 Ga0207689_10023253
631 Ga0207689_10093653
632 Ga0207661_10025662
633 Ga0207661_10067641
634 Ga0207679_10000522
635 Ga0207679_10205007
636 Ga0207667_10022919
637 Ga0207667_10046729
638 Ga0207667_10152700
639 Ga0207651_10360072
640 Ga0207668_10011302
641 Ga0207640_10047773
642 Ga0207658_10005011
643 Ga0207677_10004535
644 Ga0207677_10035451
645 Ga0207677_10119372
646 Ga0207703_10005395
647 Ga0207703_10022724
648 Ga0207703_10099325
649 Ga0207639_10003747
650 Ga0207639_10005577
651 Ga0207639_10073109
652 Ga0207678_10103911
653 Ga0207678_10372733
654 Ga0207641_10001580
655 Ga0207641_10048004
656 Ga0207641_10657573
657 Ga0207648_10016273
658 Ga0207648_10302242
659 Ga0207648_10321742
660 Ga0207676_10025130
661 Ga0207676_10482031
662 Ga0207674_10246695
663 Ga0207674_10416228
664 Ga0207683_10017387
665 Ga0207683_10369395
666 Ga0207698_10007503
667 Ga0207698_10011494
668 Ga0207698_10067662
669 Ga0207698_10261243
670 Ga0207698_10466985
671 Ga0207428_10069522
672 Ga0268266_10000057
673 Ga0268266_10031270
674 Ga0268265_10030022
675 Ga0268264_10000015
676 Ga0268264_10003095
677 Ga0268264_10061175
678 Ga0307517_10001604
679 Ga0316176_1039412
680 Ga0316181_1172860
681 Ga0307408_100000402
682 Ga0307412_10001317
683 Ga0307412_10010714
684 Ga0307416_100000394
685 Ga0395899_0000121
686 Ga0395899_0000524
687 Ga0395899_0002278
688 Ga0395899_0018050
689 Ga0395899_0143324
690 Ga0395900_0000554
691 Ga0395900_0058343
692 Ga0395900_0106428
693 Ga0395898_0069260
694 Ga0395905_0000246
695 Ga0395905_0005875
696 Ga0395901_0000184
697 Ga0395901_0004177
698 Ga0395901_0186162
699 Ga0439439_0022708
700 Ga0439457_005726
701 Ga0450897_001586
702 Ga0439458_0014433
703 Ga0495607_0134872
704 Ga0495606_0093842
705 Ga0495633_0000951
706 Ga0495668_0000489
707 Ga0495687_000004
708 Ga0496109_0033862
709 Ga0496115_0010499
710 Ga0496121_0000011
711 Ga0496121_0012630
712 Ga0496124_0122700
713 Ga0496126_0000765
714 Ga0501033_0016432
715 Ga0501236_000331
716 Ga0501268_001909
717 Ga0501280_005915
718 Ga0501035_0091424
719 nmdc:mga06r32_88917_c1
720 nmdc:mga08y16_22544_c1
721 Ga0500644_0000044
722 Ga0500583_0001500
723 Ga0500569_000889
724 Ga0500577_0011034
725 Ga0500616_0065147
726 Ga0500622_0002871
727 2511231761
728 2513233236
729 2520880347
730 2585156199
731 2585160408
732 2587866555
733 2588209196
734 2588234105
735 2729202796
736 2738730649
737 2738760756
738 2739614484
739 2765576567
740 2776612960
741 2819576392
742 2821142595
743 2842906276
744 2849281989
745 2881249576
746 2881361304
747 2881363318
748 2898715334
749 2902050848
750 2903896593
751 2904470237
752 2919186849
753 2939665882
754 2946002601
755 2958461804
756 2977233234
757 2993374615
758 2993481496
759 8055420265
760 8055592173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

64

343

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jna-assembly2.cif.gz_B crystal structure of the deph complex with dimethyl-fk228 0.9401 8 299
4nte-assembly1.cif.gz_A crystal structure of deph 0.939 7 299
4fk1-assembly1.cif.gz_B crystal structure of putative thioredoxin reductase trxb from bacillus anthracis 0.9367 9 301
4fk1-assembly2.cif.gz_C crystal structure of putative thioredoxin reductase trxb from bacillus anthracis 0.933 8 301
4nte-assembly1.cif.gz_B crystal structure of deph 0.9309 7 299
ID Description Score Start End Superfamily
af_A0A1D6PY47_409_549_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.9464 84 105 2.40.128.630
af_A0A0P0VCV0_7_225_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9422 82 107 2.130.10.10
4jnaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9374 7 299 3.50.50.60
4ntdA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9243 120 229 3.50.50.60
4fk1D02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9193 120 231 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4R5DW46-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9748 2 302 GO:0016491
AF-A0A1I6XHI0-F1-model_v4 Thioredoxin reductase 0.9719 6 303 GO:0016491
AF-A0A6L6UCM6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9713 1 301 GO:0016491
AF-A0A3B8HGW7-F1-model_v4 deleted 0.9705 37 301
AF-A0A4R5DW46-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9684 2 302 GO:0016491

Map