F428607

General Info

Members Datasets Scaffolds Average Seq Length
380 131 720 1029

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000329|Ga0081539_1000032926
Length 1086
Sequence MRGLARVTIALAALDRYAARCVSSGFVAIRIAVQGAPGAPKDPDSQPRGRSVVRAAMLGWLVLLPATVFAQATLSGVVKDASGAVLPGVSVEATSPVLIEKVRSATTDSTGLYRIPDLPPGLYKVTFTLQGFTTVIRDAVEVTGGGVTSINADMRVGSVTETITVVGETPAVDVQTSARRQVVLSNEVVQEIPASRGYGNVLATVPGIQSTTLDISSGVATNFFTARGGRGNEGTIQLDGMNVGSSFNGGGVAGFGYPIGESAEIQVTIAGGLGETDRGGPAFNLVPKTGGNKFSGTGFLSLAGKWSQGDNIDDQLRSFGLTNPPDLIKNWDTNFALGGPILKDRIWFFNNVRSYGNQQDVPGLFANKNAGDQSKWIYERDQNVRGRAAAAKMIEAIRLTSQVSQKNKVGFYLDYQKVCNGSAYEKGGKQCRDRGDDWIGLGSVGAGFFGALAPESGNVWDDREKITQGSWTSPYTNKILFEAGISQFASRFGGDPPGGALTTFIPVQEQVSNTTTGTPIGNFTYRGWASAGAIEQYHNVWRASMTYVTGAHSAKVGYQAAYQVQKSLQQVGSQLSYIFNNRNPVQFTLRDGPFSQSNRTRFDAFYVQDQWTRGRLTLQGGLRYEHAWSWFPEGENGVVEDNRFGTRFIFPEGKGVTGYHDITPRMGAAYDVFGDGKTTVKVNFSKYLQAANNDAQFTQSNPAVTFQQTTNRSWTDVNRNFLVDCNLGSRVAEDNSASGGDICGPWTNLNFGNPFSTTTVNPDVLHGWGVRPYDWQFGVTLQREILPRVAADVAYNRRWWGNHFFTDNRALTTADFDIATMTAPNNPNLPNGGGYPVRFYTRNMRSALGAVDNYYTFASDYGDVSTYWHGFDVTVNARMSNGLTFQGGTSTGRGVRDYCEVTSQLPEINLTPLSLLANQQVEACAVTEPWLTTFRSLVAYTIPKVDVLVSGSMRSTPGVQPSTVNTFVATNGTPVSANYNVTSAILQQSSLARPLAFAQTFQTVDLLLPGQKYGDRINSLDMRVAKVLRFGRYRTDVGFDFYNLVNTNSGTAFNQVYDVVTNGATWFRPTSILTPRFARFNVTVNF

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.58
Rhizosphere 98.42
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10000329 3300005985 Bacteria 105307
2 JGI25406J46586_10000466 3300003203 Bacteria 18907
3 JGI25406J46586_10000509 3300003203 Bacteria 18226
4 JGI25406J46586_10000656 3300003203 Bacteria 16177
5 JGI25406J46586_10000661 3300003203 Bacteria 16045
6 JGI25406J46586_10001571 3300003203 Bacteria 10774
7 JGI25406J46586_10001675 3300003203 Bacteria 10463
8 Ga0065712_10000181 3300005290 Bacteria 61982
9 Ga0065712_10000369 3300005290 Bacteria 21661
10 Ga0065712_10001672 3300005290 Bacteria 5987
11 Ga0065712_10069226 3300005290 Bacteria 7685
12 Ga0065715_10089534 3300005293 Bacteria 9640
13 Ga0070676_10007546 3300005328 Bacteria 5842
14 Ga0070676_10013950 3300005328 Unclassified 4409
15 Ga0070683_100010126 3300005329 Bacteria 8092
16 Ga0070690_100002690 3300005330 Bacteria 9581
17 Ga0070690_100022613 3300005330 Unclassified 3847
18 Ga0070670_100042227 3300005331 Unclassified 3920
19 Ga0068869_100002684 3300005334 Bacteria 10761
20 Ga0068869_100006661 3300005334 Bacteria 7337
21 Ga0068869_100011907 3300005334 Bacteria 5722
22 Ga0070666_10003995 3300005335 Bacteria 8949
23 Ga0070666_10016785 3300005335 Unclassified 4688
24 Ga0068868_100005976 3300005338 Bacteria 8589
25 Ga0070687_100003580 3300005343 Bacteria 6053
26 Ga0070661_100026429 3300005344 Unclassified 4175
27 Ga0070669_100003566 3300005353 Bacteria 11236
28 Ga0070669_100013827 3300005353 Bacteria 5737
29 Ga0070669_100023945 3300005353 Bacteria 4374
30 Ga0070675_100003104 3300005354 Bacteria 12560
31 Ga0070675_100003235 3300005354 Bacteria 12332
32 Ga0070675_100006421 3300005354 Bacteria 9023
33 Ga0070675_100006693 3300005354 Bacteria 8857
34 Ga0070675_100021262 3300005354 Bacteria 5184
35 Ga0070675_100034323 3300005354 Unclassified 4116
36 Ga0070671_100009220 3300005355 Bacteria 7926
37 Ga0070674_100000237 3300005356 Bacteria 27272
38 Ga0070674_100000307 3300005356 Bacteria 24081
39 Ga0070674_100011910 3300005356 Bacteria 5317
40 Ga0070674_100019929 3300005356 Unclassified 4272
41 Ga0070673_100001886 3300005364 Bacteria 12569
42 Ga0070673_100006479 3300005364 Bacteria 7611
43 Ga0070673_100023767 3300005364 Bacteria 4483
44 Ga0070673_100023919 3300005364 Bacteria 4470
45 Ga0070688_100003055 3300005365 Bacteria 8542
46 Ga0070688_100010258 3300005365 Bacteria 5159
47 Ga0070701_10003752 3300005438 Bacteria 6070
48 Ga0070701_10013458 3300005438 Bacteria 3722
49 Ga0070700_100003621 3300005441 Bacteria 7992
50 Ga0070700_100006062 3300005441 Bacteria 6438
51 Ga0070678_100023585 3300005456 Bacteria 4102
52 Ga0070662_100005568 3300005457 Bacteria 8049
53 Ga0068867_100001311 3300005459 Bacteria 17220
54 Ga0068867_100007127 3300005459 Bacteria 7899
55 Ga0068867_100010498 3300005459 Bacteria 6533
56 Ga0070699_100009876 3300005518 Bacteria 8265
57 Ga0070672_100021788 3300005543 Bacteria 4693
58 Ga0070672_100041003 3300005543 Unclassified 3556
59 Ga0070686_100003479 3300005544 Bacteria 8632
60 Ga0070686_100006498 3300005544 Bacteria 6501
61 Ga0070665_100005767 3300005548 Bacteria 12717
62 Ga0070665_100007080 3300005548 Bacteria 11395
63 Ga0070665_100016956 3300005548 Bacteria 7303
64 Ga0070664_100008458 3300005564 Bacteria 8322
65 Ga0070664_100016963 3300005564 Bacteria 5977
66 Ga0068854_100011583 3300005578 Bacteria 5749
67 Ga0068859_100038276 3300005617 Unclassified 4812
68 Ga0068859_100039016 3300005617 Unclassified 4763
69 Ga0068859_100055607 3300005617 Bacteria 3982
70 Ga0068866_10002576 3300005718 Bacteria 7477
71 Ga0068870_10001506 3300005840 Bacteria 9448
72 Ga0068870_10003084 3300005840 Bacteria 7027
73 Ga0068863_100010719 3300005841 Bacteria 8902
74 Ga0068863_100018520 3300005841 Bacteria 6664
75 Ga0068858_100019201 3300005842 Bacteria 6393
76 Ga0068860_100004598 3300005843 Bacteria 14090
77 Ga0068860_100018426 3300005843 Bacteria 6791
78 Ga0068862_100024609 3300005844 Bacteria 5053
79 Ga0081539_10000017 3300005985 Bacteria 375107
80 Ga0081539_10000071 3300005985 Bacteria 233094
81 Ga0081539_10000108 3300005985 Bacteria 195322
82 Ga0081539_10000190 3300005985 Bacteria 142511
83 Ga0081539_10002038 3300005985 Bacteria 30443
84 Ga0081539_10003019 3300005985 Bacteria 21854
85 Ga0081539_10010405 3300005985 Bacteria 7562
86 Ga0081539_10013776 3300005985 Bacteria 6059
87 Ga0097621_100000835 3300006237 Bacteria 21687
88 Ga0097621_100013905 3300006237 Bacteria 6011
89 Ga0097621_100017097 3300006237 Bacteria 5501
90 Ga0097621_100031773 3300006237 Unclassified 4191
91 Ga0068871_100007228 3300006358 Bacteria 7920
92 Ga0068871_100007365 3300006358 Bacteria 7853
93 Ga0068871_100010645 3300006358 Bacteria 6723
94 Ga0068871_100013110 3300006358 Bacteria 6145
95 Ga0075428_100019115 3300006844 Bacteria 7577
96 Ga0075428_100048478 3300006844 Unclassified 4662
97 Ga0075430_100003894 3300006846 Bacteria 12575
98 Ga0075431_100001887 3300006847 Bacteria 19883
99 Ga0075431_100013465 3300006847 Bacteria 8260
100 Ga0075431_100024110 3300006847 Bacteria 6230
101 Ga0075433_10000790 3300006852 Bacteria 21907
102 Ga0075433_10001431 3300006852 Bacteria 17606
103 Ga0075433_10004111 3300006852 Bacteria 11290
104 Ga0075433_10004618 3300006852 Bacteria 10742
105 Ga0075433_10010364 3300006852 Bacteria 7477
106 Ga0075433_10060380 3300006852 Bacteria 3319
107 Ga0075434_100000392 3300006871 Bacteria 32043
108 Ga0075434_100010408 3300006871 Bacteria 8718
109 Ga0075434_100010965 3300006871 Bacteria 8525
110 Ga0075434_100013302 3300006871 Bacteria 7826
111 Ga0075434_100014431 3300006871 Bacteria 7551
112 Ga0075434_100043988 3300006871 Bacteria 4430
113 Ga0075429_100016308 3300006880 Bacteria 6440
114 Ga0075429_100026365 3300006880 Bacteria 5046
115 Ga0075429_100042950 3300006880 Unclassified 3933
116 Ga0068865_100001335 3300006881 Bacteria 14362
117 Ga0068865_100004564 3300006881 Bacteria 8356
118 Ga0068865_100005735 3300006881 Bacteria 7544
119 Ga0068865_100008556 3300006881 Bacteria 6326
120 Ga0097620_100038278 3300006931 Unclassified 4812
121 Ga0097620_100039015 3300006931 Unclassified 4763
122 Ga0097620_100055609 3300006931 Bacteria 3982
123 Ga0075435_100006044 3300007076 Bacteria 8526
124 Ga0075435_100031112 3300007076 Unclassified 4202
125 Ga0111539_10000057 3300009094 Bacteria 114860
126 Ga0111539_10000896 3300009094 Bacteria 38862
127 Ga0111539_10001343 3300009094 Bacteria 32787
128 Ga0111539_10008289 3300009094 Bacteria 13230
129 Ga0111539_10008761 3300009094 Bacteria 12830
130 Ga0111539_10011059 3300009094 Bacteria 11354
131 Ga0111539_10012017 3300009094 Bacteria 10857
132 Ga0111539_10012688 3300009094 Bacteria 10552
133 Ga0111539_10014195 3300009094 Bacteria 9949
134 Ga0111539_10024007 3300009094 Bacteria 7490
135 Ga0111539_10027459 3300009094 Bacteria 6953
136 Ga0111539_10030599 3300009094 Bacteria 6543
137 Ga0111539_10034183 3300009094 Bacteria 6167
138 Ga0111539_10048614 3300009094 Bacteria 5063
139 Ga0105245_10008943 3300009098 Bacteria 8737
140 Ga0105245_10043742 3300009098 Bacteria 3995
141 Ga0114129_10010822 3300009147 Bacteria 12999
142 Ga0114129_10026017 3300009147 Bacteria 8286
143 Ga0114129_10026242 3300009147 Bacteria 8251
144 Ga0114129_10038969 3300009147 Bacteria 6699
145 Ga0114129_10059812 3300009147 Bacteria 5327
146 Ga0114129_10066353 3300009147 Bacteria 5034
147 Ga0114129_10069413 3300009147 Unclassified 4912
148 Ga0105243_10005802 3300009148 Bacteria 9579
149 Ga0105242_10000944 3300009176 Bacteria 22679
150 Ga0105242_10010151 3300009176 Bacteria 7214
151 Ga0105242_10011112 3300009176 Bacteria 6921
152 Ga0105242_10012448 3300009176 Bacteria 6550
153 Ga0105242_10020522 3300009176 Bacteria 5181
154 Ga0105242_10026234 3300009176 Bacteria 4618
155 Ga0105242_10026727 3300009176 Bacteria 4576
156 Ga0105248_10008137 3300009177 Bacteria 11513
157 Ga0105248_10021351 3300009177 Bacteria 7175
158 Ga0105248_10047310 3300009177 Unclassified 4824
159 Ga0105248_10052432 3300009177 Bacteria 4578
160 Ga0105238_10000968 3300009551 Bacteria 29356
161 Ga0105238_10022327 3300009551 Bacteria 6451
162 Ga0105249_10007220 3300009553 Bacteria 9692
163 Ga0105249_10009698 3300009553 Bacteria 8439
164 Ga0105249_10022469 3300009553 Bacteria 5651
165 Ga0105246_10009855 3300011119 Bacteria 5891
166 Ga0105246_10011307 3300011119 Bacteria 5538
167 Ga0105246_10024595 3300011119 Unclassified 3915
168 Ga0163162_10001144 3300013306 Bacteria 24722
169 Ga0163163_10003026 3300014325 Bacteria 14242
170 Ga0163163_10011635 3300014325 Bacteria 7993
171 Ga0163163_10032309 3300014325 Bacteria 5054
172 Ga0163163_10042978 3300014325 Bacteria 4428
173 Ga0157380_10002816 3300014326 Bacteria 11826
174 Ga0157380_10007739 3300014326 Bacteria 7649
175 Ga0157380_10020127 3300014326 Unclassified 4984
176 Ga0157377_10001501 3300014745 Bacteria 10108
177 Ga0157377_10009553 3300014745 Unclassified 4765
178 Ga0157379_10009449 3300014968 Bacteria 8496
179 Ga0207697_10002956 3300025315 Bacteria 8579
180 Ga0207697_10003621 3300025315 Bacteria 7577
181 Ga0207697_10007120 3300025315 Bacteria 5005
182 Ga0207682_10000394 3300025893 Bacteria 20095
183 Ga0207682_10005375 3300025893 Bacteria 5220
184 Ga0207682_10005465 3300025893 Bacteria 5174
185 Ga0207682_10006882 3300025893 Bacteria 4562
186 Ga0207688_10000737 3300025901 Bacteria 16225
187 Ga0207645_10001375 3300025907 Bacteria 19967
188 Ga0207645_10001411 3300025907 Bacteria 19675
189 Ga0207645_10004373 3300025907 Bacteria 10460
190 Ga0207645_10006572 3300025907 Bacteria 8319
191 Ga0207645_10008323 3300025907 Bacteria 7245
192 Ga0207645_10013822 3300025907 Bacteria 5418
193 Ga0207643_10000174 3300025908 Bacteria 44035
194 Ga0207643_10002312 3300025908 Bacteria 10368
195 Ga0207643_10005408 3300025908 Bacteria 6836
196 Ga0207662_10003950 3300025918 Bacteria 7725
197 Ga0207662_10004456 3300025918 Bacteria 7371
198 Ga0207662_10013425 3300025918 Bacteria 4583
199 Ga0207681_10003876 3300025923 Bacteria 9287
200 Ga0207681_10005007 3300025923 Bacteria 8141
201 Ga0207681_10018322 3300025923 Unclassified 4411
202 Ga0207694_10002096 3300025924 Bacteria 16474
203 Ga0207659_10000662 3300025926 Bacteria 20344
204 Ga0207659_10007786 3300025926 Bacteria 6617
205 Ga0207659_10009256 3300025926 Bacteria 6152
206 Ga0207659_10011543 3300025926 Bacteria 5583
207 Ga0207659_10013588 3300025926 Bacteria 5220
208 Ga0207659_10015385 3300025926 Bacteria 4956
209 Ga0207659_10022535 3300025926 Bacteria 4194
210 Ga0207659_10025704 3300025926 Unclassified 3961
211 Ga0207659_10028631 3300025926 Unclassified 3788
212 Ga0207687_10004503 3300025927 Bacteria 9273
213 Ga0207706_10008203 3300025933 Bacteria 9636
214 Ga0207706_10012556 3300025933 Bacteria 7713
215 Ga0207706_10013551 3300025933 Bacteria 7409
216 Ga0207686_10002974 3300025934 Bacteria 9133
217 Ga0207686_10004053 3300025934 Bacteria 7865
218 Ga0207686_10008026 3300025934 Bacteria 5695
219 Ga0207686_10012159 3300025934 Bacteria 4730
220 Ga0207709_10004732 3300025935 Bacteria 7813
221 Ga0207669_10001400 3300025937 Bacteria 10255
222 Ga0207669_10001476 3300025937 Bacteria 10043
223 Ga0207704_10001392 3300025938 Bacteria 10808
224 Ga0207704_10001839 3300025938 Bacteria 9508
225 Ga0207704_10002048 3300025938 Bacteria 9018
226 Ga0207704_10006516 3300025938 Bacteria 5451
227 Ga0207691_10000927 3300025940 Bacteria 29118
228 Ga0207691_10004846 3300025940 Bacteria 13011
229 Ga0207691_10006360 3300025940 Bacteria 11411
230 Ga0207691_10006758 3300025940 Bacteria 11062
231 Ga0207691_10015897 3300025940 Bacteria 7149
232 Ga0207691_10023908 3300025940 Bacteria 5750
233 Ga0207691_10032684 3300025940 Bacteria 4850
234 Ga0207691_10035291 3300025940 Unclassified 4643
235 Ga0207711_10012952 3300025941 Bacteria 6926
236 Ga0207711_10020044 3300025941 Bacteria 5573
237 Ga0207689_10000545 3300025942 Bacteria 35823
238 Ga0207689_10003508 3300025942 Bacteria 14325
239 Ga0207689_10004374 3300025942 Bacteria 12858
240 Ga0207689_10009755 3300025942 Bacteria 8272
241 Ga0207679_10002989 3300025945 Bacteria 10485
242 Ga0207679_10008915 3300025945 Bacteria 6403
243 Ga0207679_10010026 3300025945 Bacteria 6088
244 Ga0207651_10001417 3300025960 Bacteria 10898
245 Ga0207651_10003536 3300025960 Bacteria 7679
246 Ga0207651_10007395 3300025960 Bacteria 5850
247 Ga0207703_10025210 3300026035 Bacteria 4677
248 Ga0207708_10003361 3300026075 Bacteria 11804
249 Ga0207708_10003388 3300026075 Bacteria 11745
250 Ga0207708_10017758 3300026075 Bacteria 5355
251 Ga0207641_10032910 3300026088 Unclassified 4306
252 Ga0207641_10052927 3300026088 Unclassified 3439
253 Ga0207648_10000646 3300026089 Bacteria 39114
254 Ga0207648_10009380 3300026089 Bacteria 9373
255 Ga0207648_10016960 3300026089 Bacteria 6637
256 Ga0207648_10018502 3300026089 Bacteria 6305
257 Ga0207675_100004792 3300026118 Bacteria 13032
258 Ga0207675_100005425 3300026118 Bacteria 12217
259 Ga0207675_100018392 3300026118 Bacteria 6516
260 Ga0207675_100026522 3300026118 Bacteria 5394
261 Ga0207675_100045068 3300026118 Unclassified 4120
262 Ga0207683_10009009 3300026121 Bacteria 8502
263 Ga0207683_10014093 3300026121 Bacteria 6812
264 Ga0207683_10062194 3300026121 Bacteria 3288
265 Ga0207428_10000992 3300027907 Bacteria 31455
266 Ga0207428_10000996 3300027907 Bacteria 31420
267 Ga0207428_10001074 3300027907 Bacteria 29830
268 Ga0207428_10002538 3300027907 Bacteria 18221
269 Ga0207428_10002731 3300027907 Bacteria 17583
270 Ga0207428_10003319 3300027907 Bacteria 15653
271 Ga0207428_10009334 3300027907 Bacteria 8800
272 Ga0207428_10019163 3300027907 Bacteria 5834
273 Ga0373943_0009304 3300035170 Unclassified 4404
274 Ga0373925_0045102 3300037068 Unclassified 3275
275 Ga0451576_0025284 3300045051 Bacteria 6398
276 Ga0495608_0042809 3300046511 Unclassified 3027
277 Ga0495630_0013602 3300046517 Bacteria 5919
278 Ga0495643_0000823 3300046522 Bacteria 33811
279 Ga0495645_0006871 3300046543 Bacteria 7914
280 Ga0495645_0010280 3300046543 Bacteria 6559
281 Ga0495613_0000790 3300046689 Bacteria 24652
282 Ga0495613_0005030 3300046689 Bacteria 9923
283 Ga0495613_0040626 3300046689 Unclassified 3446
284 Ga0495600_0014680 3300046809 Bacteria 4938
285 Ga0495604_0030271 3300047317 Unclassified 4300
286 Ga0495674_0035648 3300047319 Unclassified 4486
287 Ga0495684_0000066 3300047471 Bacteria 72827
288 Ga0495684_0000176 3300047471 Bacteria 48583
289 Ga0495684_0000538 3300047471 Bacteria 30801
290 Ga0495684_0003740 3300047471 Bacteria 11862
291 Ga0496101_0000225 3300048904 Bacteria 42158
292 Ga0496101_0000300 3300048904 Bacteria 34609
293 Ga0496109_0004578 3300048912 Bacteria 11543
294 Ga0496109_0037922 3300048912 Bacteria 4356
295 Ga0496114_0000508 3300048917 Bacteria 28503
296 Ga0496114_0002308 3300048917 Bacteria 14528
297 Ga0501033_0010197 3300049570 Bacteria 7214
298 Ga0501040_0002967 3300049576 Bacteria 10981
299 Ga0501040_0031131 3300049576 Bacteria 3604
300 Ga0501041_0001385 3300049577 Bacteria 13421
301 Ga0501042_0003141 3300049578 Bacteria 10295
302 Ga0501042_0010302 3300049578 Bacteria 6259
303 Ga0501046_0033626 3300049580 Unclassified 4141
304 Ga0501048_0011677 3300049582 Bacteria 6552
305 Ga0501071_0003217 3300049587 Bacteria 10174
306 Ga0501072_0013804 3300049588 Bacteria 6187
307 Ga0501075_0004333 3300049591 Bacteria 9604
308 Ga0501075_0005421 3300049591 Bacteria 8726
309 Ga0501075_0014085 3300049591 Bacteria 5727
310 Ga0501076_0017088 3300049592 Bacteria 5510
311 Ga0501079_0008210 3300049741 Bacteria 7914
312 Ga0501079_0018370 3300049741 Bacteria 5345
313 Ga0501080_0018511 3300049742 Bacteria 6443
314 Ga0501081_0005220 3300049743 Bacteria 8363
315 Ga0501045_0001971 3300049824 Bacteria 13869
316 nmdc:mga05p37_103828_c1 3300050507 Bacteria 3498
317 nmdc:mga05p37_34264_c1 3300050507 Bacteria 6218
318 nmdc:mga05p37_34716_c1 3300050507 Bacteria 6178
319 nmdc:mga05p37_40854_c1 3300050507 Bacteria 5695
320 nmdc:mga05p37_78412_c1 3300050507 Bacteria 4067
321 nmdc:mga09592_11212_c1 3300050508 Bacteria 7294
322 nmdc:mga09592_32882_c1 3300050508 Unclassified 4325
323 nmdc:mga0qj67_10329_c1 3300050509 Bacteria 6974
324 nmdc:mga0qj67_28033_c1 3300050509 Bacteria 4370
325 nmdc:mga06r32_32942_c1 3300050510 Bacteria 4879
326 nmdc:mga06r32_40500_c1 3300050510 Bacteria 4423
327 nmdc:mga08y16_162_c1 3300050511 Bacteria 58005
328 nmdc:mga08y16_1977_c1 3300050511 Bacteria 20900
329 nmdc:mga08y16_21233_c1 3300050511 Bacteria 6856
330 nmdc:mga08y16_22093_c1 3300050511 Bacteria 6718
331 nmdc:mga08y16_2751_c1 3300050511 Bacteria 18028
332 nmdc:mga08y16_29426_c1 3300050511 Bacteria 5787
333 nmdc:mga08y16_32652_c1 3300050511 Bacteria 5472
334 nmdc:mga08y16_3832_c1 3300050511 Bacteria 15651
335 nmdc:mga08y16_43859_c1 3300050511 Unclassified 4687
336 nmdc:mga08y16_5273_c1 3300050511 Bacteria 13510
337 nmdc:mga08y16_5949_c1 3300050511 Bacteria 12791
338 nmdc:mga08y16_6038_c1 3300050511 Bacteria 12697
339 nmdc:mga0n895_2264_c1 3300050512 Bacteria 14914
340 nmdc:mga0n895_28184_c1 3300050512 Bacteria 5342
341 nmdc:mga0n895_633_c1 3300050512 Bacteria 24437
342 nmdc:mga0n895_8366_c1 3300050512 Bacteria 8953
343 nmdc:mga0rr50_15450_c1 3300050513 Bacteria 5041
344 nmdc:mga0rr50_506_c1 3300050513 Bacteria 20754
345 nmdc:mga0a205_109_c1 3300050515 Bacteria 47859
346 nmdc:mga0a205_21890_c1 3300050515 Bacteria 6046
347 nmdc:mga0a205_2272_c1 3300050515 Bacteria 16955
348 nmdc:mga0a205_2809_c1 3300050515 Bacteria 15398
349 nmdc:mga0a205_4032_c1 3300050515 Bacteria 13135
350 nmdc:mga0a205_51648_c1 3300050515 Unclassified 3969
351 nmdc:mga0a205_9017_c1 3300050515 Bacteria 9091
352 Ga0495601_0001445 3300053077 Bacteria 13089
353 Ga0495601_0002477 3300053077 Bacteria 10503
354 Ga0495619_0001829 3300053085 Bacteria 14144
355 Ga0495619_0002273 3300053085 Bacteria 12668
356 Ga0501084_0006589 3300054114 Bacteria 9543
357 Ga0501084_0012648 3300054114 Bacteria 6993
358 Ga0501082_0003089 3300060353 Bacteria 14520
359 Ga0501082_0055497 3300060353 Unclassified 3413
360 Ga0530510_0003720 3300061734 Bacteria 10501
361 Ga0081539_10000329
362 JGI25406J46586_10000466
363 JGI25406J46586_10000509
364 JGI25406J46586_10000656
365 JGI25406J46586_10000661
366 JGI25406J46586_10001571
367 JGI25406J46586_10001675
368 Ga0065712_10000181
369 Ga0065712_10000369
370 Ga0065712_10001672
371 Ga0065712_10069226
372 Ga0065715_10089534
373 Ga0070676_10007546
374 Ga0070676_10013950
375 Ga0070683_100010126
376 Ga0070690_100002690
377 Ga0070690_100022613
378 Ga0070670_100042227
379 Ga0068869_100002684
380 Ga0068869_100006661
381 Ga0068869_100011907
382 Ga0070666_10003995
383 Ga0070666_10016785
384 Ga0068868_100005976
385 Ga0070687_100003580
386 Ga0070661_100026429
387 Ga0070669_100003566
388 Ga0070669_100013827
389 Ga0070669_100023945
390 Ga0070675_100003104
391 Ga0070675_100003235
392 Ga0070675_100006421
393 Ga0070675_100006693
394 Ga0070675_100021262
395 Ga0070675_100034323
396 Ga0070671_100009220
397 Ga0070674_100000237
398 Ga0070674_100000307
399 Ga0070674_100011910
400 Ga0070674_100019929
401 Ga0070673_100001886
402 Ga0070673_100006479
403 Ga0070673_100023767
404 Ga0070673_100023919
405 Ga0070688_100003055
406 Ga0070688_100010258
407 Ga0070701_10003752
408 Ga0070701_10013458
409 Ga0070700_100003621
410 Ga0070700_100006062
411 Ga0070678_100023585
412 Ga0070662_100005568
413 Ga0068867_100001311
414 Ga0068867_100007127
415 Ga0068867_100010498
416 Ga0070699_100009876
417 Ga0070672_100021788
418 Ga0070672_100041003
419 Ga0070686_100003479
420 Ga0070686_100006498
421 Ga0070665_100005767
422 Ga0070665_100007080
423 Ga0070665_100016956
424 Ga0070664_100008458
425 Ga0070664_100016963
426 Ga0068854_100011583
427 Ga0068859_100038276
428 Ga0068859_100039016
429 Ga0068859_100055607
430 Ga0068866_10002576
431 Ga0068870_10001506
432 Ga0068870_10003084
433 Ga0068863_100010719
434 Ga0068863_100018520
435 Ga0068858_100019201
436 Ga0068860_100004598
437 Ga0068860_100018426
438 Ga0068862_100024609
439 Ga0081539_10000017
440 Ga0081539_10000071
441 Ga0081539_10000108
442 Ga0081539_10000190
443 Ga0081539_10002038
444 Ga0081539_10003019
445 Ga0081539_10010405
446 Ga0081539_10013776
447 Ga0097621_100000835
448 Ga0097621_100013905
449 Ga0097621_100017097
450 Ga0097621_100031773
451 Ga0068871_100007228
452 Ga0068871_100007365
453 Ga0068871_100010645
454 Ga0068871_100013110
455 Ga0075428_100019115
456 Ga0075428_100048478
457 Ga0075430_100003894
458 Ga0075431_100001887
459 Ga0075431_100013465
460 Ga0075431_100024110
461 Ga0075433_10000790
462 Ga0075433_10001431
463 Ga0075433_10004111
464 Ga0075433_10004618
465 Ga0075433_10010364
466 Ga0075433_10060380
467 Ga0075434_100000392
468 Ga0075434_100010408
469 Ga0075434_100010965
470 Ga0075434_100013302
471 Ga0075434_100014431
472 Ga0075434_100043988
473 Ga0075429_100016308
474 Ga0075429_100026365
475 Ga0075429_100042950
476 Ga0068865_100001335
477 Ga0068865_100004564
478 Ga0068865_100005735
479 Ga0068865_100008556
480 Ga0097620_100038278
481 Ga0097620_100039015
482 Ga0097620_100055609
483 Ga0075435_100006044
484 Ga0075435_100031112
485 Ga0111539_10000057
486 Ga0111539_10000896
487 Ga0111539_10001343
488 Ga0111539_10008289
489 Ga0111539_10008761
490 Ga0111539_10011059
491 Ga0111539_10012017
492 Ga0111539_10012688
493 Ga0111539_10014195
494 Ga0111539_10024007
495 Ga0111539_10027459
496 Ga0111539_10030599
497 Ga0111539_10034183
498 Ga0111539_10048614
499 Ga0105245_10008943
500 Ga0105245_10043742
501 Ga0114129_10010822
502 Ga0114129_10026017
503 Ga0114129_10026242
504 Ga0114129_10038969
505 Ga0114129_10059812
506 Ga0114129_10066353
507 Ga0114129_10069413
508 Ga0105243_10005802
509 Ga0105242_10000944
510 Ga0105242_10010151
511 Ga0105242_10011112
512 Ga0105242_10012448
513 Ga0105242_10020522
514 Ga0105242_10026234
515 Ga0105242_10026727
516 Ga0105248_10008137
517 Ga0105248_10021351
518 Ga0105248_10047310
519 Ga0105248_10052432
520 Ga0105238_10000968
521 Ga0105238_10022327
522 Ga0105249_10007220
523 Ga0105249_10009698
524 Ga0105249_10022469
525 Ga0105246_10009855
526 Ga0105246_10011307
527 Ga0105246_10024595
528 Ga0163162_10001144
529 Ga0163163_10003026
530 Ga0163163_10011635
531 Ga0163163_10032309
532 Ga0163163_10042978
533 Ga0157380_10002816
534 Ga0157380_10007739
535 Ga0157380_10020127
536 Ga0157377_10001501
537 Ga0157377_10009553
538 Ga0157379_10009449
539 Ga0207697_10002956
540 Ga0207697_10003621
541 Ga0207697_10007120
542 Ga0207682_10000394
543 Ga0207682_10005375
544 Ga0207682_10005465
545 Ga0207682_10006882
546 Ga0207688_10000737
547 Ga0207645_10001375
548 Ga0207645_10001411
549 Ga0207645_10004373
550 Ga0207645_10006572
551 Ga0207645_10008323
552 Ga0207645_10013822
553 Ga0207643_10000174
554 Ga0207643_10002312
555 Ga0207643_10005408
556 Ga0207662_10003950
557 Ga0207662_10004456
558 Ga0207662_10013425
559 Ga0207681_10003876
560 Ga0207681_10005007
561 Ga0207681_10018322
562 Ga0207694_10002096
563 Ga0207659_10000662
564 Ga0207659_10007786
565 Ga0207659_10009256
566 Ga0207659_10011543
567 Ga0207659_10013588
568 Ga0207659_10015385
569 Ga0207659_10022535
570 Ga0207659_10025704
571 Ga0207659_10028631
572 Ga0207687_10004503
573 Ga0207706_10008203
574 Ga0207706_10012556
575 Ga0207706_10013551
576 Ga0207686_10002974
577 Ga0207686_10004053
578 Ga0207686_10008026
579 Ga0207686_10012159
580 Ga0207709_10004732
581 Ga0207669_10001400
582 Ga0207669_10001476
583 Ga0207704_10001392
584 Ga0207704_10001839
585 Ga0207704_10002048
586 Ga0207704_10006516
587 Ga0207691_10000927
588 Ga0207691_10004846
589 Ga0207691_10006360
590 Ga0207691_10006758
591 Ga0207691_10015897
592 Ga0207691_10023908
593 Ga0207691_10032684
594 Ga0207691_10035291
595 Ga0207711_10012952
596 Ga0207711_10020044
597 Ga0207689_10000545
598 Ga0207689_10003508
599 Ga0207689_10004374
600 Ga0207689_10009755
601 Ga0207679_10002989
602 Ga0207679_10008915
603 Ga0207679_10010026
604 Ga0207651_10001417
605 Ga0207651_10003536
606 Ga0207651_10007395
607 Ga0207703_10025210
608 Ga0207708_10003361
609 Ga0207708_10003388
610 Ga0207708_10017758
611 Ga0207641_10032910
612 Ga0207641_10052927
613 Ga0207648_10000646
614 Ga0207648_10009380
615 Ga0207648_10016960
616 Ga0207648_10018502
617 Ga0207675_100004792
618 Ga0207675_100005425
619 Ga0207675_100018392
620 Ga0207675_100026522
621 Ga0207675_100045068
622 Ga0207683_10009009
623 Ga0207683_10014093
624 Ga0207683_10062194
625 Ga0207428_10000992
626 Ga0207428_10000996
627 Ga0207428_10001074
628 Ga0207428_10002538
629 Ga0207428_10002731
630 Ga0207428_10003319
631 Ga0207428_10009334
632 Ga0207428_10019163
633 Ga0373943_0009304
634 Ga0373925_0045102
635 Ga0451576_0025284
636 Ga0495608_0042809
637 Ga0495630_0013602
638 Ga0495643_0000823
639 Ga0495645_0006871
640 Ga0495645_0010280
641 Ga0495613_0000790
642 Ga0495613_0005030
643 Ga0495613_0040626
644 Ga0495600_0014680
645 Ga0495604_0030271
646 Ga0495674_0035648
647 Ga0495684_0000066
648 Ga0495684_0000176
649 Ga0495684_0000538
650 Ga0495684_0003740
651 Ga0496101_0000225
652 Ga0496101_0000300
653 Ga0496109_0004578
654 Ga0496109_0037922
655 Ga0496114_0000508
656 Ga0496114_0002308
657 Ga0501033_0010197
658 Ga0501040_0002967
659 Ga0501040_0031131
660 Ga0501041_0001385
661 Ga0501042_0003141
662 Ga0501042_0010302
663 Ga0501046_0033626
664 Ga0501048_0011677
665 Ga0501071_0003217
666 Ga0501072_0013804
667 Ga0501075_0004333
668 Ga0501075_0005421
669 Ga0501075_0014085
670 Ga0501076_0017088
671 Ga0501079_0008210
672 Ga0501079_0018370
673 Ga0501080_0018511
674 Ga0501081_0005220
675 Ga0501045_0001971
676 nmdc:mga05p37_103828_c1
677 nmdc:mga05p37_34264_c1
678 nmdc:mga05p37_34716_c1
679 nmdc:mga05p37_40854_c1
680 nmdc:mga05p37_78412_c1
681 nmdc:mga09592_11212_c1
682 nmdc:mga09592_32882_c1
683 nmdc:mga0qj67_10329_c1
684 nmdc:mga0qj67_28033_c1
685 nmdc:mga06r32_32942_c1
686 nmdc:mga06r32_40500_c1
687 nmdc:mga08y16_162_c1
688 nmdc:mga08y16_1977_c1
689 nmdc:mga08y16_21233_c1
690 nmdc:mga08y16_22093_c1
691 nmdc:mga08y16_2751_c1
692 nmdc:mga08y16_29426_c1
693 nmdc:mga08y16_32652_c1
694 nmdc:mga08y16_3832_c1
695 nmdc:mga08y16_43859_c1
696 nmdc:mga08y16_5273_c1
697 nmdc:mga08y16_5949_c1
698 nmdc:mga08y16_6038_c1
699 nmdc:mga0n895_2264_c1
700 nmdc:mga0n895_28184_c1
701 nmdc:mga0n895_633_c1
702 nmdc:mga0n895_8366_c1
703 nmdc:mga0rr50_15450_c1
704 nmdc:mga0rr50_506_c1
705 nmdc:mga0a205_109_c1
706 nmdc:mga0a205_21890_c1
707 nmdc:mga0a205_2272_c1
708 nmdc:mga0a205_2809_c1
709 nmdc:mga0a205_4032_c1
710 nmdc:mga0a205_51648_c1
711 nmdc:mga0a205_9017_c1
712 Ga0495601_0001445
713 Ga0495601_0002477
714 Ga0495619_0001829
715 Ga0495619_0002273
716 Ga0501084_0006589
717 Ga0501084_0012648
718 Ga0501082_0003089
719 Ga0501082_0055497
720 Ga0530510_0003720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

73

155

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8937 27 108
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8421 27 108
4u3s-assembly1.cif.gz_B crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus 0.7828 25 105
1nqg-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli, with bound calcium 0.7591 131 1025
3efm-assembly1.cif.gz_A structure of the alcaligin outer membrane recepteur faua from bordetella pertussis 0.759 128 1025
ID Description Score Start End Superfamily
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8945 27 108 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8763 27 108 2.60.40.1120
af_E7FFQ7_1118_1203_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8612 27 108 2.60.40.1120
af_D4A536_407_501_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8466 27 108 2.60.40.1120
af_F1RAC0_1040_1118_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8456 27 110 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A7Y4TEJ5-F1-model_v4 TonB-dependent receptor 0.9173 234 1025 GO:0009279
AF-A0A2V8H9F8-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.9141 351 907 GO:0009279
AF-A0A7Y4TEJ5-F1-model_v4 TonB-dependent receptor 0.9125 234 1025 GO:0009279
AF-A0A2V8H9F8-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.9108 351 907 GO:0009279
AF-A0A7G9Z8Z8-F1-model_v4 SD-repeat containing protein B domain-containing protein 0.8997 22 106 GO:0030246

Map