F428575

General Info

Members Datasets Scaffolds Average Seq Length
380 235 760 191

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100344530|Ga0070700_1003445302
Length 222
Sequence MTLTSGGLFNDGHHLTVYMMHIMYNVKWNQNGGEAVRVTRKQSAANREKVLDVAGTLFRERGFDGIGVADIMKRAGLTHGGFYGQFASKDDLAAEATARVFGKVGWQERQTGKADPSFGDVVRGYLSPRHRDDPGTGCLLAALGSDAARQPRAVRRAFTDGFRLRIDELRKLLPGRSQAARREKALATMAGLVGALILSRAVDDPALSDEILEATATELGRR

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
229 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
230 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
231 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
232 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
233 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
234 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
235 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 3.42
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100344530 3300005441 Bacteria 1102
2 CNAas_1001865 3300000532 Bacteria 1631
3 Ga0065712_10070415 3300005290 Bacteria 6029
4 Ga0065712_10073187 3300005290 Bacteria 4473
5 Ga0065715_10239357 3300005293 Bacteria 1205
6 Ga0070676_10295597 3300005328 Bacteria 1096
7 Ga0070676_10678082 3300005328 Bacteria 751
8 Ga0070690_100243426 3300005330 Bacteria 1269
9 Ga0070677_10058332 3300005333 Bacteria 1585
10 Ga0068869_100765373 3300005334 Bacteria 828
11 Ga0070666_10360102 3300005335 Bacteria 1042
12 Ga0068868_100036559 3300005338 Bacteria 3802
13 Ga0070691_10100122 3300005341 Bacteria 1438
14 Ga0070687_100149661 3300005343 Bacteria 1369
15 Ga0070687_100331578 3300005343 Bacteria 976
16 Ga0070692_10095188 3300005345 Bacteria 1624
17 Ga0070668_100148575 3300005347 Bacteria 1893
18 Ga0070669_100020128 3300005353 Bacteria 4765
19 Ga0070669_101005420 3300005353 Bacteria 716
20 Ga0070675_100279722 3300005354 Bacteria 1466
21 Ga0070671_100059997 3300005355 Bacteria 3166
22 Ga0070671_100278242 3300005355 Bacteria 1423
23 Ga0070673_100104288 3300005364 Bacteria 2341
24 Ga0070673_100172047 3300005364 Bacteria 1849
25 Ga0070673_100304367 3300005364 Bacteria 1404
26 Ga0070659_100806049 3300005366 Bacteria 817
27 Ga0070703_10001802 3300005406 Bacteria 6332
28 Ga0070703_10015819 3300005406 Bacteria 2161
29 Ga0070703_10244019 3300005406 Bacteria 726
30 Ga0070709_10003314 3300005434 Bacteria 8665
31 Ga0070714_100929597 3300005435 Bacteria 845
32 Ga0070714_101463525 3300005435 Bacteria 667
33 Ga0070713_100297564 3300005436 Bacteria 1485
34 Ga0070713_100747491 3300005436 Unclassified 935
35 Ga0070713_100754252 3300005436 Bacteria 931
36 Ga0070710_10050896 3300005437 Bacteria 2324
37 Ga0070701_10017419 3300005438 Unclassified 3357
38 Ga0070701_10129832 3300005438 Bacteria 1430
39 Ga0070711_100002038 3300005439 Bacteria 11392
40 Ga0070711_100524675 3300005439 Bacteria 979
41 Ga0070705_100005748 3300005440 Bacteria 6060
42 Ga0070705_100307683 3300005440 Bacteria 1138
43 Ga0070705_100356584 3300005440 Bacteria 1068
44 Ga0070705_100389354 3300005440 Bacteria 1028
45 Ga0070694_100011110 3300005444 Bacteria 5574
46 Ga0070694_100412337 3300005444 Unclassified 1060
47 Ga0070708_100077039 3300005445 Bacteria 3012
48 Ga0070708_100255868 3300005445 Bacteria 1645
49 Ga0070708_100261259 3300005445 Bacteria 1628
50 Ga0070708_100411655 3300005445 Bacteria 1275
51 Ga0070662_100125547 3300005457 Bacteria 1972
52 Ga0070662_100641434 3300005457 Bacteria 895
53 Ga0068867_100176151 3300005459 Bacteria 1697
54 Ga0068867_101224908 3300005459 Bacteria 690
55 Ga0070706_100165238 3300005467 Bacteria 2067
56 Ga0070707_100423192 3300005468 Bacteria 1292
57 Ga0070707_100438283 3300005468 Bacteria 1267
58 Ga0070707_100607096 3300005468 Bacteria 1057
59 Ga0070707_101129470 3300005468 Bacteria 750
60 Ga0070698_100047042 3300005471 Bacteria 4411
61 Ga0070698_100124670 3300005471 Bacteria 2533
62 Ga0070698_100241533 3300005471 Bacteria 1739
63 Ga0070698_100710300 3300005471 Bacteria 947
64 Ga0070699_100268841 3300005518 Bacteria 1525
65 Ga0070679_100890097 3300005530 Bacteria 834
66 Ga0070697_100225961 3300005536 Bacteria 1596
67 Ga0070697_100694616 3300005536 Bacteria 897
68 Ga0068853_100619165 3300005539 Bacteria 1029
69 Ga0070672_100447240 3300005543 Bacteria 1113
70 Ga0070686_100017696 3300005544 Bacteria 4169
71 Ga0070686_100114043 3300005544 Bacteria 1846
72 Ga0070686_100139287 3300005544 Bacteria 1687
73 Ga0070686_100552651 3300005544 Bacteria 901
74 Ga0070695_100046354 3300005545 Bacteria 2773
75 Ga0070695_100200348 3300005545 Bacteria 1426
76 Ga0070695_100318301 3300005545 Bacteria 1156
77 Ga0070696_100018785 3300005546 Bacteria 4678
78 Ga0070696_100261010 3300005546 Bacteria 1314
79 Ga0070696_100342649 3300005546 Bacteria 1155
80 Ga0070696_100525800 3300005546 Bacteria 944
81 Ga0070665_100023298 3300005548 Bacteria 6235
82 Ga0070704_100001980 3300005549 Bacteria 11327
83 Ga0070704_100057893 3300005549 Bacteria 2758
84 Ga0070704_100059164 3300005549 Bacteria 2732
85 Ga0070704_101050855 3300005549 Bacteria 738
86 Ga0070664_100318231 3300005564 Bacteria 1409
87 Ga0070664_100689255 3300005564 Bacteria 951
88 Ga0068854_100240791 3300005578 Bacteria 1441
89 Ga0068854_100746463 3300005578 Bacteria 849
90 Ga0070702_100017739 3300005615 Bacteria 3679
91 Ga0068859_100311917 3300005617 Bacteria 1667
92 Ga0068864_100003943 3300005618 Bacteria 12222
93 Ga0068861_100044656 3300005719 Bacteria 3333
94 Ga0068861_100096950 3300005719 Bacteria 2338
95 Ga0068851_10403620 3300005834 Bacteria 804
96 Ga0068863_100119524 3300005841 Bacteria 2512
97 Ga0068863_100232692 3300005841 Bacteria 1777
98 Ga0068858_100008619 3300005842 Bacteria 9797
99 Ga0068860_100495101 3300005843 Bacteria 1220
100 Ga0068862_100883830 3300005844 Bacteria 877
101 Ga0070717_10345123 3300006028 Bacteria 1330
102 Ga0070717_10527431 3300006028 Bacteria 1068
103 Ga0075364_10010955 3300006051 Bacteria 5497
104 Ga0075432_10007365 3300006058 Bacteria 3746
105 Ga0070715_10113487 3300006163 Bacteria 1282
106 Ga0070715_10359950 3300006163 Bacteria 797
107 Ga0070716_100068901 3300006173 Bacteria 2071
108 Ga0070716_100189851 3300006173 Bacteria 1356
109 Ga0075367_10583965 3300006178 Unclassified 710
110 Ga0075427_10019489 3300006194 Bacteria 1070
111 Ga0075430_100093452 3300006846 Bacteria 2514
112 Ga0075433_10470042 3300006852 Bacteria 1108
113 Ga0075433_10542497 3300006852 Bacteria 1023
114 Ga0075433_10981189 3300006852 Bacteria 736
115 Ga0075434_100009198 3300006871 Bacteria 9207
116 Ga0075434_100015918 3300006871 Bacteria 7224
117 Ga0075434_100019786 3300006871 Bacteria 6517
118 Ga0075434_100055896 3300006871 Bacteria 3922
119 Ga0075434_100156296 3300006871 Bacteria 2299
120 Ga0075434_100198821 3300006871 Bacteria 2024
121 Ga0075434_100271983 3300006871 Bacteria 1713
122 Ga0075434_100318387 3300006871 Bacteria 1576
123 Ga0075434_100353104 3300006871 Bacteria 1491
124 Ga0075434_100410715 3300006871 Bacteria 1375
125 Ga0075434_101263755 3300006871 Bacteria 749
126 Ga0075429_100338796 3300006880 Bacteria 1316
127 Ga0068865_100494801 3300006881 Bacteria 1018
128 Ga0075436_100012754 3300006914 Bacteria 5762
129 Ga0075436_100142642 3300006914 Bacteria 1684
130 Ga0075436_100403685 3300006914 Bacteria 990
131 Ga0097620_100311906 3300006931 Bacteria 1667
132 Ga0075435_100000001 3300007076 Bacteria 207579
133 Ga0075435_100000450 3300007076 Bacteria 25173
134 Ga0075435_100075526 3300007076 Bacteria 2760
135 Ga0075435_100135840 3300007076 Unclassified 2060
136 Ga0075435_100166481 3300007076 Bacteria 1859
137 Ga0075435_100231838 3300007076 Bacteria 1569
138 Ga0075435_100279300 3300007076 Bacteria 1425
139 Ga0075435_100358572 3300007076 Bacteria 1250
140 Ga0075435_100614280 3300007076 Bacteria 943
141 Ga0105251_10067574 3300009011 Bacteria 1669
142 Ga0105240_10270174 3300009093 Bacteria 1958
143 Ga0111539_11118090 3300009094 Bacteria 915
144 Ga0105245_10058848 3300009098 Bacteria 3459
145 Ga0105245_10171667 3300009098 Bacteria 2065
146 Ga0105245_11267277 3300009098 Unclassified 786
147 Ga0114129_11527310 3300009147 Bacteria 820
148 Ga0105243_10424107 3300009148 Bacteria 1242
149 Ga0105241_10320883 3300009174 Bacteria 1336
150 Ga0105242_10024557 3300009176 Bacteria 4761
151 Ga0105248_10010003 3300009177 Bacteria 10441
152 Ga0105248_10015132 3300009177 Bacteria 8498
153 Ga0105237_10714165 3300009545 Bacteria 1009
154 Ga0105249_10379161 3300009553 Bacteria 1440
155 Ga0105249_10685355 3300009553 Bacteria 1084
156 Ga0105239_10319955 3300010375 Bacteria 1749
157 Ga0105239_10778406 3300010375 Bacteria 1096
158 Ga0105246_10466531 3300011119 Bacteria 1065
159 Ga0157373_10292218 3300013100 Bacteria 1156
160 Ga0157378_11369922 3300013297 Bacteria 750
161 Ga0163162_10049457 3300013306 Bacteria 4214
162 Ga0157375_10512195 3300013308 Bacteria 1364
163 Ga0157375_11545456 3300013308 Bacteria 784
164 Ga0163163_10056607 3300014325 Bacteria 3875
165 Ga0163163_10087768 3300014325 Bacteria 3121
166 Ga0157377_10584023 3300014745 Bacteria 794
167 Ga0157379_10118358 3300014968 Bacteria 2383
168 Ga0157379_10154652 3300014968 Bacteria 2069
169 Ga0157379_10187001 3300014968 Unclassified 1872
170 Ga0157376_10934190 3300014969 Bacteria 887
171 Ga0163161_10294267 3300017792 Bacteria 1277
172 Ga0207656_10270100 3300025321 Bacteria 837
173 Ga0207653_10001096 3300025885 Bacteria 8880
174 Ga0207653_10101595 3300025885 Bacteria 1017
175 Ga0207688_10317010 3300025901 Bacteria 956
176 Ga0207680_10214127 3300025903 Bacteria 1318
177 Ga0207699_10003385 3300025906 Bacteria 7603
178 Ga0207645_10090926 3300025907 Bacteria 1963
179 Ga0207684_10018914 3300025910 Bacteria 5892
180 Ga0207684_10605971 3300025910 Bacteria 935
181 Ga0207684_10631071 3300025910 Bacteria 914
182 Ga0207654_10248097 3300025911 Bacteria 1192
183 Ga0207695_10202269 3300025913 Bacteria 1900
184 Ga0207693_11045883 3300025915 Bacteria 622
185 Ga0207663_10000177 3300025916 Bacteria 28557
186 Ga0207663_10644583 3300025916 Bacteria 835
187 Ga0207662_10040843 3300025918 Bacteria 2729
188 Ga0207662_10179885 3300025918 Bacteria 1360
189 Ga0207646_10012580 3300025922 Bacteria 8124
190 Ga0207646_10052571 3300025922 Bacteria 3645
191 Ga0207646_10334491 3300025922 Bacteria 1368
192 Ga0207646_10875795 3300025922 Bacteria 797
193 Ga0207681_10066251 3300025923 Bacteria 2500
194 Ga0207681_10265767 3300025923 Bacteria 1345
195 Ga0207650_11071718 3300025925 Bacteria 686
196 Ga0207659_10365270 3300025926 Bacteria 1200
197 Ga0207687_10306874 3300025927 Bacteria 1280
198 Ga0207700_10138441 3300025928 Bacteria 1997
199 Ga0207700_10260470 3300025928 Bacteria 1485
200 Ga0207664_11095836 3300025929 Bacteria 712
201 Ga0207644_10102459 3300025931 Bacteria 2153
202 Ga0207690_10661734 3300025932 Bacteria 856
203 Ga0207706_10073388 3300025933 Bacteria 3009
204 Ga0207706_10323832 3300025933 Bacteria 1341
205 Ga0207686_10015834 3300025934 Bacteria 4225
206 Ga0207669_10355922 3300025937 Bacteria 1133
207 Ga0207704_10602350 3300025938 Bacteria 900
208 Ga0207665_10024991 3300025939 Bacteria 3938
209 Ga0207665_10039808 3300025939 Bacteria 3134
210 Ga0207665_10067865 3300025939 Bacteria 2429
211 Ga0207691_10206862 3300025940 Bacteria 1706
212 Ga0207711_10212502 3300025941 Bacteria 1767
213 Ga0207711_10460852 3300025941 Bacteria 1183
214 Ga0207711_10777440 3300025941 Bacteria 892
215 Ga0207689_10094808 3300025942 Bacteria 2451
216 Ga0207679_10286037 3300025945 Bacteria 1416
217 Ga0207679_10329264 3300025945 Bacteria 1325
218 Ga0207651_10414200 3300025960 Bacteria 1149
219 Ga0207712_10247561 3300025961 Bacteria 1439
220 Ga0207677_10072313 3300026023 Bacteria 2437
221 Ga0207703_10048391 3300026035 Bacteria 3433
222 Ga0207703_10110869 3300026035 Bacteria 2341
223 Ga0207708_10209596 3300026075 Bacteria 1557
224 Ga0207708_10217582 3300026075 Bacteria 1529
225 Ga0207641_10287719 3300026088 Bacteria 1548
226 Ga0207648_10120480 3300026089 Bacteria 2307
227 Ga0207648_10419377 3300026089 Bacteria 1215
228 Ga0207676_10004116 3300026095 Bacteria 10267
229 Ga0207675_100008781 3300026118 Bacteria 9488
230 Ga0207675_100120791 3300026118 Bacteria 2479
231 Ga0207675_100276988 3300026118 Bacteria 1629
232 Ga0207683_10882812 3300026121 Bacteria 830
233 Ga0265318_10074213 3300028577 Bacteria 1259
234 Ga0265330_10021797 3300031235 Bacteria 2919
235 Ga0265332_10154259 3300031238 Bacteria 960
236 Ga0265320_10057230 3300031240 Bacteria 1870
237 Ga0265325_10024648 3300031241 Bacteria 3271
238 Ga0265325_10058944 3300031241 Bacteria 1954
239 Ga0265340_10073706 3300031247 Bacteria 1615
240 Ga0265331_10018626 3300031250 Bacteria 3596
241 Ga0265316_10030697 3300031344 Bacteria 4402
242 Ga0307513_10168938 3300031456 Bacteria 2067
243 Ga0307513_10288754 3300031456 Bacteria 1413
244 Ga0265313_10088342 3300031595 Bacteria 1396
245 Ga0265314_10094440 3300031711 Bacteria 1939
246 Ga0265314_10157769 3300031711 Bacteria 1384
247 Ga0265342_10038524 3300031712 Bacteria 2910
248 Ga0373934_0065336 3300035086 Bacteria 1453
249 Ga0373944_0011889 3300035089 Bacteria 2392
250 Ga0373936_0013817 3300035113 Bacteria 3082
251 Ga0373941_0188873 3300035115 Bacteria 777
252 Ga0373945_0080511 3300035116 Bacteria 1247
253 Ga0373956_0171822 3300035119 Bacteria 1023
254 Ga0373943_0000973 3300035170 Bacteria 12728
255 Ga0373946_0001516 3300035171 Bacteria 8072
256 Ga0373955_0069519 3300035172 Bacteria 1965
257 Ga0373961_0227189 3300035241 Bacteria 668
258 Ga0373962_0149427 3300035242 Bacteria 764
259 Ga0373931_0565687 3300035691 Bacteria 740
260 Ga0373935_0008814 3300035692 Bacteria 6041
261 Ga0373935_0103429 3300035692 Bacteria 1881
262 Ga0373927_0001933 3300035695 Bacteria 15296
263 Ga0373933_0301948 3300035724 Bacteria 1036
264 Ga0373947_0000962 3300035725 Bacteria 17559
265 Ga0373937_0194838 3300036401 Bacteria 1904
266 Ga0373925_0006638 3300037068 Bacteria 8497
267 Ga0395905_0000160 3300037471 Bacteria 111265
268 Ga0451793_0137423 3300041452 Bacteria 3483
269 Ga0439459_0000573 3300042438 Bacteria 4885
270 Ga0451576_0043271 3300045051 Bacteria 4752
271 Ga0451576_0059262 3300045051 Bacteria 3998
272 Ga0451576_1139185 3300045051 Bacteria 816
273 Ga0495617_025218 3300046452 Bacteria 2005
274 Ga0495592_0279839 3300046454 Bacteria 1091
275 Ga0495592_0360364 3300046454 Unclassified 930
276 Ga0495629_0020266 3300046459 Bacteria 4749
277 Ga0495629_0146785 3300046459 Bacteria 1640
278 Ga0495638_0000071 3300046460 Bacteria 166300
279 Ga0495638_0000274 3300046460 Bacteria 69822
280 Ga0495638_0147155 3300046460 Bacteria 1369
281 Ga0495651_0269990 3300046462 Bacteria 1153
282 Ga0495664_0327170 3300046477 Bacteria 924
283 Ga0495583_0000373 3300046506 Bacteria 69685
284 Ga0495618_0084496 3300046514 Bacteria 2028
285 Ga0495618_0310210 3300046514 Bacteria 979
286 Ga0495628_0050910 3300046516 Bacteria 3275
287 Ga0495630_0002684 3300046517 Bacteria 12346
288 Ga0495632_0005498 3300046519 Bacteria 8363
289 Ga0495648_0000195 3300046524 Bacteria 69940
290 Ga0495665_0004982 3300046531 Bacteria 7156
291 Ga0495633_0114154 3300046558 Bacteria 1252
292 Ga0495667_0052285 3300046559 Bacteria 2692
293 Ga0495656_0290203 3300046615 Bacteria 836
294 Ga0495668_0388445 3300046616 Bacteria 767
295 Ga0495634_0059485 3300046642 Bacteria 2545
296 Ga0495634_0126891 3300046642 Bacteria 1630
297 Ga0495635_0315153 3300046663 Bacteria 1047
298 Ga0495659_0108704 3300046664 Bacteria 1081
299 Ga0495659_0216527 3300046664 Bacteria 790
300 Ga0495657_0054290 3300046675 Bacteria 2678
301 Ga0495599_0137955 3300046678 Bacteria 1513
302 Ga0495623_0028792 3300046679 Bacteria 3574
303 Ga0495658_0556646 3300046683 Bacteria 734
304 Ga0495613_0023724 3300046689 Bacteria 4572
305 Ga0495624_0010278 3300046690 Bacteria 6449
306 Ga0495671_0000125 3300046692 Bacteria 70115
307 Ga0495581_0016529 3300047315 Bacteria 4288
308 Ga0495674_0622529 3300047319 Bacteria 853
309 Ga0495672_0045932 3300047320 Bacteria 2609
310 Ga0495680_0328402 3300047322 Bacteria 1069
311 Ga0495673_0000275 3300047469 Bacteria 70004
312 Ga0495684_0004303 3300047471 Bacteria 11117
313 Ga0495684_0173963 3300047471 Bacteria 1599
314 Ga0495593_0449274 3300047673 Bacteria 645
315 Ga0495602_0045671 3300048088 Bacteria 3962
316 Ga0496101_0370200 3300048904 Bacteria 1127
317 Ga0496103_0405808 3300048906 Bacteria 875
318 Ga0496104_0070589 3300048907 Bacteria 3321
319 Ga0496108_0067132 3300048911 Bacteria 3025
320 Ga0496108_0259483 3300048911 Bacteria 1512
321 Ga0496109_1290796 3300048912 Bacteria 666
322 Ga0496110_0776286 3300048913 Bacteria 862
323 Ga0496112_0100695 3300048915 Bacteria 2859
324 Ga0496112_0501481 3300048915 Bacteria 1149
325 Ga0496112_0652702 3300048915 Unclassified 982
326 Ga0496112_1228657 3300048915 Bacteria 666
327 Ga0496115_0407836 3300048918 Bacteria 1102
328 Ga0496126_0301800 3300048929 Bacteria 1321
329 Ga0501081_0098098 3300049743 Bacteria 2069
330 Ga0501045_0645687 3300049824 Bacteria 782
331 nmdc:mga05p37_1308989_c1 3300050507 Bacteria 738
332 nmdc:mga05p37_580781_c1 3300050507 Bacteria 1269
333 nmdc:mga0qj67_238082_c1 3300050509 Bacteria 1477
334 nmdc:mga06r32_286938_c1 3300050510 Bacteria 1633
335 nmdc:mga08y16_1136403_c1 3300050511 Bacteria 755
336 nmdc:mga0n895_1241942_c1 3300050512 Bacteria 718
337 nmdc:mga0n895_12992_c1 3300050512 Bacteria 3966
338 nmdc:mga0n895_23_c1 3300050512 Bacteria 92165
339 nmdc:mga0n895_24905_c1 3300050512 Bacteria 5647
340 nmdc:mga0n895_315022_c1 3300050512 Bacteria 1586
341 nmdc:mga0n895_34365_c1 3300050512 Bacteria 4879
342 nmdc:mga0n895_411880_c1 3300050512 Bacteria 1367
343 nmdc:mga0n895_549475_c1 3300050512 Bacteria 1161
344 nmdc:mga0n895_55133_c1 3300050512 Bacteria 3912
345 nmdc:mga0n895_7861_c1 3300050512 Bacteria 9193
346 nmdc:mga0n895_798_c1 3300050512 Bacteria 22501
347 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
348 nmdc:mga0rr50_120369_c1 3300050513 Bacteria 2089
349 nmdc:mga0rr50_12510_c1 3300050513 Bacteria 5490
350 nmdc:mga0rr50_1562835_c1 3300050513 Bacteria 557
351 nmdc:mga0rr50_201_c1 3300050513 Bacteria 32622
352 nmdc:mga0rr50_67843_c1 3300050513 Bacteria 2711
353 nmdc:mga0rr50_727630_c1 3300050513 Bacteria 847
354 nmdc:mga0rr50_829590_c1 3300050513 Bacteria 789
355 nmdc:mga0rr50_952551_c1 3300050513 Unclassified 732
356 nmdc:mga08x19_167531_c1 3300050514 Bacteria 1495
357 nmdc:mga08x19_33181_c1 3300050514 Bacteria 2235
358 nmdc:mga08x19_39865_c1 3300050514 Bacteria 2987
359 nmdc:mga08x19_60689_c1 3300050514 Bacteria 2449
360 nmdc:mga0a205_115163_c1 3300050515 Bacteria 2587
361 nmdc:mga0a205_18856_c1 3300050515 Bacteria 6496
362 nmdc:mga0a205_276095_c1 3300050515 Bacteria 1557
363 nmdc:mga0a205_32786_c1 3300050515 Bacteria 4979
364 Ga0495601_0061900 3300053077 Bacteria 2376
365 Ga0495601_0194223 3300053077 Bacteria 1326
366 Ga0495612_0363339 3300053078 Bacteria 654
367 Ga0495595_0030678 3300053084 Bacteria 2412
368 Ga0495619_0088802 3300053085 Bacteria 2091
369 Ga0495619_0247782 3300053085 Bacteria 1234
370 Ga0500578_0234466 3300053086 Bacteria 1111
371 Ga0500643_010710 3300053087 Bacteria 3393
372 Ga0500644_0033913 3300053088 Bacteria 1643
373 Ga0500655_078752 3300053133 Bacteria 677
374 Ga0500661_000193 3300055283 Bacteria 10729
375 2738746188 2738541281 Bacteria 5112672
376 2739355418 2738543032 Bacteria 5115625
377 2829746939 2829745981 Bacteria 5406054
378 2889311153 2889306138 Bacteria 6358934
379 2902407192 2902405164 Bacteria 6784948
380 8054008856 8054002106 Bacteria 7987183
381 Ga0070700_100344530
382 CNAas_1001865
383 Ga0065712_10070415
384 Ga0065712_10073187
385 Ga0065715_10239357
386 Ga0070676_10295597
387 Ga0070676_10678082
388 Ga0070690_100243426
389 Ga0070677_10058332
390 Ga0068869_100765373
391 Ga0070666_10360102
392 Ga0068868_100036559
393 Ga0070691_10100122
394 Ga0070687_100149661
395 Ga0070687_100331578
396 Ga0070692_10095188
397 Ga0070668_100148575
398 Ga0070669_100020128
399 Ga0070669_101005420
400 Ga0070675_100279722
401 Ga0070671_100059997
402 Ga0070671_100278242
403 Ga0070673_100104288
404 Ga0070673_100172047
405 Ga0070673_100304367
406 Ga0070659_100806049
407 Ga0070703_10001802
408 Ga0070703_10015819
409 Ga0070703_10244019
410 Ga0070709_10003314
411 Ga0070714_100929597
412 Ga0070714_101463525
413 Ga0070713_100297564
414 Ga0070713_100747491
415 Ga0070713_100754252
416 Ga0070710_10050896
417 Ga0070701_10017419
418 Ga0070701_10129832
419 Ga0070711_100002038
420 Ga0070711_100524675
421 Ga0070705_100005748
422 Ga0070705_100307683
423 Ga0070705_100356584
424 Ga0070705_100389354
425 Ga0070694_100011110
426 Ga0070694_100412337
427 Ga0070708_100077039
428 Ga0070708_100255868
429 Ga0070708_100261259
430 Ga0070708_100411655
431 Ga0070662_100125547
432 Ga0070662_100641434
433 Ga0068867_100176151
434 Ga0068867_101224908
435 Ga0070706_100165238
436 Ga0070707_100423192
437 Ga0070707_100438283
438 Ga0070707_100607096
439 Ga0070707_101129470
440 Ga0070698_100047042
441 Ga0070698_100124670
442 Ga0070698_100241533
443 Ga0070698_100710300
444 Ga0070699_100268841
445 Ga0070679_100890097
446 Ga0070697_100225961
447 Ga0070697_100694616
448 Ga0068853_100619165
449 Ga0070672_100447240
450 Ga0070686_100017696
451 Ga0070686_100114043
452 Ga0070686_100139287
453 Ga0070686_100552651
454 Ga0070695_100046354
455 Ga0070695_100200348
456 Ga0070695_100318301
457 Ga0070696_100018785
458 Ga0070696_100261010
459 Ga0070696_100342649
460 Ga0070696_100525800
461 Ga0070665_100023298
462 Ga0070704_100001980
463 Ga0070704_100057893
464 Ga0070704_100059164
465 Ga0070704_101050855
466 Ga0070664_100318231
467 Ga0070664_100689255
468 Ga0068854_100240791
469 Ga0068854_100746463
470 Ga0070702_100017739
471 Ga0068859_100311917
472 Ga0068864_100003943
473 Ga0068861_100044656
474 Ga0068861_100096950
475 Ga0068851_10403620
476 Ga0068863_100119524
477 Ga0068863_100232692
478 Ga0068858_100008619
479 Ga0068860_100495101
480 Ga0068862_100883830
481 Ga0070717_10345123
482 Ga0070717_10527431
483 Ga0075364_10010955
484 Ga0075432_10007365
485 Ga0070715_10113487
486 Ga0070715_10359950
487 Ga0070716_100068901
488 Ga0070716_100189851
489 Ga0075367_10583965
490 Ga0075427_10019489
491 Ga0075430_100093452
492 Ga0075433_10470042
493 Ga0075433_10542497
494 Ga0075433_10981189
495 Ga0075434_100009198
496 Ga0075434_100015918
497 Ga0075434_100019786
498 Ga0075434_100055896
499 Ga0075434_100156296
500 Ga0075434_100198821
501 Ga0075434_100271983
502 Ga0075434_100318387
503 Ga0075434_100353104
504 Ga0075434_100410715
505 Ga0075434_101263755
506 Ga0075429_100338796
507 Ga0068865_100494801
508 Ga0075436_100012754
509 Ga0075436_100142642
510 Ga0075436_100403685
511 Ga0097620_100311906
512 Ga0075435_100000001
513 Ga0075435_100000450
514 Ga0075435_100075526
515 Ga0075435_100135840
516 Ga0075435_100166481
517 Ga0075435_100231838
518 Ga0075435_100279300
519 Ga0075435_100358572
520 Ga0075435_100614280
521 Ga0105251_10067574
522 Ga0105240_10270174
523 Ga0111539_11118090
524 Ga0105245_10058848
525 Ga0105245_10171667
526 Ga0105245_11267277
527 Ga0114129_11527310
528 Ga0105243_10424107
529 Ga0105241_10320883
530 Ga0105242_10024557
531 Ga0105248_10010003
532 Ga0105248_10015132
533 Ga0105237_10714165
534 Ga0105249_10379161
535 Ga0105249_10685355
536 Ga0105239_10319955
537 Ga0105239_10778406
538 Ga0105246_10466531
539 Ga0157373_10292218
540 Ga0157378_11369922
541 Ga0163162_10049457
542 Ga0157375_10512195
543 Ga0157375_11545456
544 Ga0163163_10056607
545 Ga0163163_10087768
546 Ga0157377_10584023
547 Ga0157379_10118358
548 Ga0157379_10154652
549 Ga0157379_10187001
550 Ga0157376_10934190
551 Ga0163161_10294267
552 Ga0207656_10270100
553 Ga0207653_10001096
554 Ga0207653_10101595
555 Ga0207688_10317010
556 Ga0207680_10214127
557 Ga0207699_10003385
558 Ga0207645_10090926
559 Ga0207684_10018914
560 Ga0207684_10605971
561 Ga0207684_10631071
562 Ga0207654_10248097
563 Ga0207695_10202269
564 Ga0207693_11045883
565 Ga0207663_10000177
566 Ga0207663_10644583
567 Ga0207662_10040843
568 Ga0207662_10179885
569 Ga0207646_10012580
570 Ga0207646_10052571
571 Ga0207646_10334491
572 Ga0207646_10875795
573 Ga0207681_10066251
574 Ga0207681_10265767
575 Ga0207650_11071718
576 Ga0207659_10365270
577 Ga0207687_10306874
578 Ga0207700_10138441
579 Ga0207700_10260470
580 Ga0207664_11095836
581 Ga0207644_10102459
582 Ga0207690_10661734
583 Ga0207706_10073388
584 Ga0207706_10323832
585 Ga0207686_10015834
586 Ga0207669_10355922
587 Ga0207704_10602350
588 Ga0207665_10024991
589 Ga0207665_10039808
590 Ga0207665_10067865
591 Ga0207691_10206862
592 Ga0207711_10212502
593 Ga0207711_10460852
594 Ga0207711_10777440
595 Ga0207689_10094808
596 Ga0207679_10286037
597 Ga0207679_10329264
598 Ga0207651_10414200
599 Ga0207712_10247561
600 Ga0207677_10072313
601 Ga0207703_10048391
602 Ga0207703_10110869
603 Ga0207708_10209596
604 Ga0207708_10217582
605 Ga0207641_10287719
606 Ga0207648_10120480
607 Ga0207648_10419377
608 Ga0207676_10004116
609 Ga0207675_100008781
610 Ga0207675_100120791
611 Ga0207675_100276988
612 Ga0207683_10882812
613 Ga0265318_10074213
614 Ga0265330_10021797
615 Ga0265332_10154259
616 Ga0265320_10057230
617 Ga0265325_10024648
618 Ga0265325_10058944
619 Ga0265340_10073706
620 Ga0265331_10018626
621 Ga0265316_10030697
622 Ga0307513_10168938
623 Ga0307513_10288754
624 Ga0265313_10088342
625 Ga0265314_10094440
626 Ga0265314_10157769
627 Ga0265342_10038524
628 Ga0373934_0065336
629 Ga0373944_0011889
630 Ga0373936_0013817
631 Ga0373941_0188873
632 Ga0373945_0080511
633 Ga0373956_0171822
634 Ga0373943_0000973
635 Ga0373946_0001516
636 Ga0373955_0069519
637 Ga0373961_0227189
638 Ga0373962_0149427
639 Ga0373931_0565687
640 Ga0373935_0008814
641 Ga0373935_0103429
642 Ga0373927_0001933
643 Ga0373933_0301948
644 Ga0373947_0000962
645 Ga0373937_0194838
646 Ga0373925_0006638
647 Ga0395905_0000160
648 Ga0451793_0137423
649 Ga0439459_0000573
650 Ga0451576_0043271
651 Ga0451576_0059262
652 Ga0451576_1139185
653 Ga0495617_025218
654 Ga0495592_0279839
655 Ga0495592_0360364
656 Ga0495629_0020266
657 Ga0495629_0146785
658 Ga0495638_0000071
659 Ga0495638_0000274
660 Ga0495638_0147155
661 Ga0495651_0269990
662 Ga0495664_0327170
663 Ga0495583_0000373
664 Ga0495618_0084496
665 Ga0495618_0310210
666 Ga0495628_0050910
667 Ga0495630_0002684
668 Ga0495632_0005498
669 Ga0495648_0000195
670 Ga0495665_0004982
671 Ga0495633_0114154
672 Ga0495667_0052285
673 Ga0495656_0290203
674 Ga0495668_0388445
675 Ga0495634_0059485
676 Ga0495634_0126891
677 Ga0495635_0315153
678 Ga0495659_0108704
679 Ga0495659_0216527
680 Ga0495657_0054290
681 Ga0495599_0137955
682 Ga0495623_0028792
683 Ga0495658_0556646
684 Ga0495613_0023724
685 Ga0495624_0010278
686 Ga0495671_0000125
687 Ga0495581_0016529
688 Ga0495674_0622529
689 Ga0495672_0045932
690 Ga0495680_0328402
691 Ga0495673_0000275
692 Ga0495684_0004303
693 Ga0495684_0173963
694 Ga0495593_0449274
695 Ga0495602_0045671
696 Ga0496101_0370200
697 Ga0496103_0405808
698 Ga0496104_0070589
699 Ga0496108_0067132
700 Ga0496108_0259483
701 Ga0496109_1290796
702 Ga0496110_0776286
703 Ga0496112_0100695
704 Ga0496112_0501481
705 Ga0496112_0652702
706 Ga0496112_1228657
707 Ga0496115_0407836
708 Ga0496126_0301800
709 Ga0501081_0098098
710 Ga0501045_0645687
711 nmdc:mga05p37_1308989_c1
712 nmdc:mga05p37_580781_c1
713 nmdc:mga0qj67_238082_c1
714 nmdc:mga06r32_286938_c1
715 nmdc:mga08y16_1136403_c1
716 nmdc:mga0n895_1241942_c1
717 nmdc:mga0n895_12992_c1
718 nmdc:mga0n895_23_c1
719 nmdc:mga0n895_24905_c1
720 nmdc:mga0n895_315022_c1
721 nmdc:mga0n895_34365_c1
722 nmdc:mga0n895_411880_c1
723 nmdc:mga0n895_549475_c1
724 nmdc:mga0n895_55133_c1
725 nmdc:mga0n895_7861_c1
726 nmdc:mga0n895_798_c1
727 nmdc:mga0rr50_11_c1
728 nmdc:mga0rr50_120369_c1
729 nmdc:mga0rr50_12510_c1
730 nmdc:mga0rr50_1562835_c1
731 nmdc:mga0rr50_201_c1
732 nmdc:mga0rr50_67843_c1
733 nmdc:mga0rr50_727630_c1
734 nmdc:mga0rr50_829590_c1
735 nmdc:mga0rr50_952551_c1
736 nmdc:mga08x19_167531_c1
737 nmdc:mga08x19_33181_c1
738 nmdc:mga08x19_39865_c1
739 nmdc:mga08x19_60689_c1
740 nmdc:mga0a205_115163_c1
741 nmdc:mga0a205_18856_c1
742 nmdc:mga0a205_276095_c1
743 nmdc:mga0a205_32786_c1
744 Ga0495601_0061900
745 Ga0495601_0194223
746 Ga0495612_0363339
747 Ga0495595_0030678
748 Ga0495619_0088802
749 Ga0495619_0247782
750 Ga0500578_0234466
751 Ga0500643_010710
752 Ga0500644_0033913
753 Ga0500655_078752
754 Ga0500661_000193
755 2738746188
756 2739355418
757 2829746939
758 2889311153
759 2902407192
760 8054008856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

50

96

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8059 24 198
3dpj-assembly2.cif.gz_H the crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss 0.7893 25 200
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.7858 28 197
3eup-assembly1.cif.gz_B the crystal structure of the transcriptional regulator, tetr family from cytophaga hutchinsonii 0.7857 23 198
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.7824 23 197
ID Description Score Start End Superfamily
3br6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9656 27 73 1.10.10.60
2g0eE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.962 27 73 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9608 27 73 1.10.10.60
3br2E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9603 27 73 1.10.10.60
3br1E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9593 27 73 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1X4NDM1-F1-model_v4 deleted 0.9428 17 201
AF-A0A6P2DBA6-F1-model_v4 HTH tetR-type domain-containing protein 0.9314 17 200 GO:0003677
GO:0006355
GO:0016020
AF-I6AX63-F1-model_v4 Transcriptional regulator 0.9298 21 198 GO:0003677
GO:0006355
AF-A0A142WVV4-F1-model_v4 HTH-type transcriptional repressor BepR 0.9292 17 195 GO:0003677
GO:0006355
AF-A0A7W8IHS1-F1-model_v4 TetR/AcrR family transcriptional repressor of nem operon 0.9277 17 200 GO:0003677
GO:0006355

Map