F428556

General Info

Members Datasets Scaffolds Average Seq Length
380 175 760 294

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100028254|Ga0070660_1000282542
Length 316
Sequence MFLGEYDRSWEIFPPEPLTMQRAIYNAYFGFTDNPFDISPDPEFLYRSPQHEEALANLIYGVQSRKGFIVLTGEVGTGKTTMLECLRDYLDTVRTEFAFIFNSRLTPEQFFEMMAFDFDLDCDRKSKTDVLFALNNLLLQQGERGRTCVLIVDEAHNLEWDVLEEIRLLGNLENRGGKLLQIILAGQPELDRKLDAPNLRQLKQRIVLRCSLDPLAPAEASAYVESRMARAGMPNQTVFPPQILEEVYKRSRGIPRVINLICDNLLVTAFAMEQKVTTVAMIDEVCQDLRLEWPGSARDRRPRSRHNVAEEAAPSR

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.26
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100028254 3300005339 Bacteria 4194
2 Ga0070658_10098709 3300005327 Bacteria 2412
3 Ga0070676_10208008 3300005328 Bacteria 1286
4 Ga0070683_100000005 3300005329 Bacteria 361724
5 Ga0070683_100055177 3300005329 Bacteria 3686
6 Ga0070683_100225564 3300005329 Bacteria 1780
7 Ga0070683_100261121 3300005329 Unclassified 1647
8 Ga0070690_100132279 3300005330 Bacteria 1686
9 Ga0068869_100128340 3300005334 Bacteria 1947
10 Ga0070666_10011718 3300005335 Bacteria 5513
11 Ga0070680_100020789 3300005336 Bacteria 5208
12 Ga0070680_100286510 3300005336 Bacteria 1396
13 Ga0068868_100003385 3300005338 Bacteria 11095
14 Ga0068868_100057006 3300005338 Bacteria 3086
15 Ga0068868_100258665 3300005338 Bacteria 1467
16 Ga0070660_100079547 3300005339 Unclassified 2572
17 Ga0070660_100124793 3300005339 Bacteria 2057
18 Ga0070661_100089057 3300005344 Bacteria 2285
19 Ga0070661_100364214 3300005344 Bacteria 1137
20 Ga0070671_100140554 3300005355 Bacteria 2037
21 Ga0070671_100169599 3300005355 Bacteria 1846
22 Ga0070667_100116083 3300005367 Bacteria 2325
23 Ga0070667_100167724 3300005367 Unclassified 1937
24 Ga0070667_100591436 3300005367 Bacteria 1022
25 Ga0070709_10196835 3300005434 Bacteria 1425
26 Ga0070709_10422662 3300005434 Bacteria 999
27 Ga0070714_100023121 3300005435 Bacteria 5103
28 Ga0070714_100026980 3300005435 Unclassified 4752
29 Ga0070713_100144272 3300005436 Bacteria 2112
30 Ga0070713_100402754 3300005436 Unclassified 1278
31 Ga0070705_100118809 3300005440 Bacteria 1703
32 Ga0070681_10069873 3300005458 Bacteria 3478
33 Ga0070681_10110064 3300005458 Bacteria 2694
34 Ga0070681_10368698 3300005458 Unclassified 1346
35 Ga0068867_100011141 3300005459 Bacteria 6342
36 Ga0068867_100056983 3300005459 Bacteria 2893
37 Ga0070679_100250376 3300005530 Bacteria 1728
38 Ga0070684_100000053 3300005535 Bacteria 77715
39 Ga0070684_100026226 3300005535 Bacteria 4907
40 Ga0070684_100167482 3300005535 Bacteria 1995
41 Ga0068853_100031932 3300005539 Unclassified 4458
42 Ga0068853_100258926 3300005539 Bacteria 1599
43 Ga0070696_100214482 3300005546 Bacteria 1442
44 Ga0070693_100095387 3300005547 Bacteria 1801
45 Ga0070665_100008755 3300005548 Bacteria 10244
46 Ga0070665_100026971 3300005548 Bacteria 5784
47 Ga0070665_100224119 3300005548 Bacteria 1881
48 Ga0068855_100003186 3300005563 Bacteria 20093
49 Ga0068855_100019266 3300005563 Bacteria 8202
50 Ga0068855_100068162 3300005563 Bacteria 4142
51 Ga0068855_100085365 3300005563 Unclassified 3653
52 Ga0068855_100111650 3300005563 Bacteria 3138
53 Ga0068855_100173356 3300005563 Bacteria 2442
54 Ga0068855_100184794 3300005563 Unclassified 2355
55 Ga0068855_100296472 3300005563 Bacteria 1791
56 Ga0070664_100370639 3300005564 Bacteria 1305
57 Ga0068857_100006078 3300005577 Bacteria 10311
58 Ga0068857_100012995 3300005577 Bacteria 7255
59 Ga0068857_100021727 3300005577 Bacteria 5648
60 Ga0068856_100006343 3300005614 Bacteria 11600
61 Ga0068856_100012995 3300005614 Bacteria 8061
62 Ga0068856_100316267 3300005614 Bacteria 1579
63 Ga0068856_100421091 3300005614 Bacteria 1355
64 Ga0068852_100017885 3300005616 Bacteria 5572
65 Ga0068852_100197562 3300005616 Bacteria 1902
66 Ga0068859_100130831 3300005617 Bacteria 2581
67 Ga0068859_100139813 3300005617 Unclassified 2495
68 Ga0068864_100294306 3300005618 Bacteria 1518
69 Ga0068864_100324983 3300005618 Bacteria 1446
70 Ga0068863_100153732 3300005841 Bacteria 2202
71 Ga0068863_100192176 3300005841 Bacteria 1962
72 Ga0068863_100223888 3300005841 Bacteria 1813
73 Ga0068863_100287427 3300005841 Bacteria 1594
74 Ga0068863_100318125 3300005841 Bacteria 1511
75 Ga0068863_100655788 3300005841 Bacteria 1041
76 Ga0068858_100014584 3300005842 Bacteria 7404
77 Ga0068858_100327623 3300005842 Bacteria 1464
78 Ga0068860_100002292 3300005843 Bacteria 20102
79 Ga0068860_100053966 3300005843 Bacteria 3820
80 Ga0068860_100127450 3300005843 Plasmid 2440
81 Ga0070717_10003760 3300006028 Bacteria 10900
82 Ga0097621_100006028 3300006237 Bacteria 8568
83 Ga0097621_100229682 3300006237 Bacteria 1620
84 Ga0097621_100234015 3300006237 Unclassified 1604
85 Ga0097621_100248304 3300006237 Unclassified 1557
86 Ga0068871_100002553 3300006358 Bacteria 12428
87 Ga0068871_100058043 3300006358 Bacteria 3150
88 Ga0068871_100079840 3300006358 Unclassified 2708
89 Ga0068871_100095711 3300006358 Bacteria 2480
90 Ga0075430_100065444 3300006846 Bacteria 3054
91 Ga0075431_100005946 3300006847 Bacteria 12075
92 Ga0097620_100130833 3300006931 Bacteria 2581
93 Ga0097620_100139818 3300006931 Unclassified 2495
94 Ga0097620_100286007 3300006931 Unclassified 1742
95 Ga0097620_100350913 3300006931 Bacteria 1570
96 Ga0105240_10002632 3300009093 Bacteria 28611
97 Ga0105240_10004172 3300009093 Bacteria 22151
98 Ga0105240_10014385 3300009093 Bacteria 10806
99 Ga0105240_10018015 3300009093 Bacteria 9500
100 Ga0105240_10043843 3300009093 Bacteria 5688
101 Ga0105240_10055866 3300009093 Bacteria 4942
102 Ga0105240_10074075 3300009093 Unclassified 4204
103 Ga0105240_10248761 3300009093 Bacteria 2057
104 Ga0105240_10437189 3300009093 Unclassified 1467
105 Ga0105245_10004209 3300009098 Bacteria 12774
106 Ga0105245_10015442 3300009098 Bacteria 6657
107 Ga0105245_10021302 3300009098 Bacteria 5684
108 Ga0105245_10021907 3300009098 Bacteria 5607
109 Ga0105245_10063448 3300009098 Unclassified 3336
110 Ga0105245_10230260 3300009098 Bacteria 1792
111 Ga0105245_10315962 3300009098 Bacteria 1537
112 Ga0105247_10022220 3300009101 Bacteria 3819
113 Ga0105247_10055038 3300009101 Bacteria 2455
114 Ga0114129_10273774 3300009147 Bacteria 2258
115 Ga0105243_10014641 3300009148 Bacteria 5934
116 Ga0105241_10042120 3300009174 Unclassified 3453
117 Ga0105241_10046489 3300009174 Unclassified 3296
118 Ga0105241_10240640 3300009174 Bacteria 1530
119 Ga0105241_10253996 3300009174 Bacteria 1492
120 Ga0105242_10023406 3300009176 Bacteria 4867
121 Ga0105242_10100729 3300009176 Unclassified 2447
122 Ga0105242_10107369 3300009176 Bacteria 2374
123 Ga0105242_10130770 3300009176 Bacteria 2166
124 Ga0105248_10011881 3300009177 Bacteria 9607
125 Ga0105248_10045290 3300009177 Bacteria 4933
126 Ga0105248_10110292 3300009177 Unclassified 3103
127 Ga0105248_10189803 3300009177 Bacteria 2315
128 Ga0105248_10404812 3300009177 Unclassified 1536
129 Ga0105248_10530544 3300009177 Bacteria 1328
130 Ga0105237_10001745 3300009545 Bacteria 28090
131 Ga0105237_10097574 3300009545 Bacteria 2929
132 Ga0105237_10127182 3300009545 Bacteria 2542
133 Ga0105237_10153230 3300009545 Bacteria 2301
134 Ga0105237_10614902 3300009545 Bacteria 1093
135 Ga0105238_10075278 3300009551 Bacteria 3368
136 Ga0105238_10081878 3300009551 Bacteria 3218
137 Ga0105238_10121826 3300009551 Bacteria 2588
138 Ga0105238_10165037 3300009551 Bacteria 2190
139 Ga0105238_10235645 3300009551 Bacteria 1807
140 Ga0105238_10518902 3300009551 Bacteria 1194
141 Ga0105239_10030564 3300010375 Bacteria 5922
142 Ga0105239_10078286 3300010375 Bacteria 3638
143 Ga0105239_10117132 3300010375 Bacteria 2957
144 Ga0105246_10014962 3300011119 Bacteria 4890
145 Ga0105246_10136012 3300011119 Bacteria 1842
146 Ga0105246_10232164 3300011119 Bacteria 1453
147 Ga0105246_10373657 3300011119 Bacteria 1175
148 Ga0157373_10158028 3300013100 Bacteria 1595
149 Ga0157371_10025117 3300013102 Unclassified 4346
150 Ga0157370_10019312 3300013104 Bacteria 6841
151 Ga0157370_10028377 3300013104 Bacteria 5505
152 Ga0157370_10045000 3300013104 Bacteria 4238
153 Ga0157370_10058419 3300013104 Bacteria 3667
154 Ga0157370_10072232 3300013104 Unclassified 3256
155 Ga0157370_10179165 3300013104 Bacteria 1969
156 Ga0157369_10010248 3300013105 Bacteria 10696
157 Ga0157369_10071399 3300013105 Bacteria 3727
158 Ga0157369_10100741 3300013105 Bacteria 3079
159 Ga0157369_10117653 3300013105 Bacteria 2821
160 Ga0157369_10376409 3300013105 Unclassified 1474
161 Ga0157374_10049698 3300013296 Bacteria 3896
162 Ga0157374_10093709 3300013296 Bacteria 2868
163 Ga0157374_10218236 3300013296 Bacteria 1871
164 Ga0157374_10231106 3300013296 Unclassified 1817
165 Ga0157374_10456296 3300013296 Bacteria 1280
166 Ga0157374_10708955 3300013296 Bacteria 1020
167 Ga0157378_10014423 3300013297 Bacteria 6919
168 Ga0157378_10020304 3300013297 Bacteria 5843
169 Ga0163162_10015993 3300013306 Bacteria 7333
170 Ga0163162_10028461 3300013306 Bacteria 5530
171 Ga0157372_10057918 3300013307 Unclassified 4331
172 Ga0157372_10086007 3300013307 Bacteria 3567
173 Ga0157372_10102343 3300013307 Bacteria 3272
174 Ga0157372_10181952 3300013307 Bacteria 2433
175 Ga0157372_10344214 3300013307 Bacteria 1737
176 Ga0157375_10177528 3300013308 Bacteria 2280
177 Ga0163163_10015983 3300014325 Bacteria 6955
178 Ga0163163_10024938 3300014325 Bacteria 5694
179 Ga0163163_10264455 3300014325 Bacteria 1771
180 Ga0157380_10053827 3300014326 Bacteria 3192
181 Ga0157379_10014949 3300014968 Bacteria 6807
182 Ga0157379_10338217 3300014968 Bacteria 1376
183 Ga0157376_10113056 3300014969 Bacteria 2393
184 Ga0157376_10287713 3300014969 Bacteria 1550
185 Ga0206352_10314704 3300020078 Bacteria 1758
186 Ga0213874_10018757 3300021377 Bacteria 1874
187 Ga0213876_10018492 3300021384 Bacteria 3680
188 Ga0213876_10045631 3300021384 Unclassified 2317
189 Ga0213875_10000008 3300021388 Bacteria 533344
190 Ga0213875_10012734 3300021388 Bacteria 4142
191 Ga0213875_10014067 3300021388 Bacteria 3912
192 Ga0207680_10205202 3300025903 Bacteria 1345
193 Ga0207699_10192458 3300025906 Bacteria 1377
194 Ga0207645_10188160 3300025907 Bacteria 1356
195 Ga0207705_10037947 3300025909 Bacteria 3448
196 Ga0207654_10022485 3300025911 Bacteria 3365
197 Ga0207654_10079653 3300025911 Unclassified 1968
198 Ga0207707_10029317 3300025912 Bacteria 4810
199 Ga0207707_10081175 3300025912 Bacteria 2831
200 Ga0207707_10094594 3300025912 Bacteria 2611
201 Ga0207695_10016014 3300025913 Bacteria 8801
202 Ga0207695_10023602 3300025913 Bacteria 6942
203 Ga0207695_10043537 3300025913 Bacteria 4784
204 Ga0207695_10079612 3300025913 Bacteria 3320
205 Ga0207695_10082739 3300025913 Unclassified 3244
206 Ga0207695_10088213 3300025913 Bacteria 3123
207 Ga0207695_10234698 3300025913 Bacteria 1737
208 Ga0207695_10328340 3300025913 Unclassified 1418
209 Ga0207695_10403326 3300025913 Bacteria 1252
210 Ga0207671_10022806 3300025914 Bacteria 4728
211 Ga0207671_10055255 3300025914 Bacteria 2942
212 Ga0207671_10154208 3300025914 Bacteria 1776
213 Ga0207671_10164441 3300025914 Bacteria 1720
214 Ga0207671_10269249 3300025914 Bacteria 1342
215 Ga0207663_10090582 3300025916 Bacteria 2028
216 Ga0207660_10038013 3300025917 Bacteria 3358
217 Ga0207660_10215371 3300025917 Bacteria 1505
218 Ga0207657_10000858 3300025919 Bacteria 32103
219 Ga0207657_10040766 3300025919 Unclassified 4111
220 Ga0207657_10133686 3300025919 Bacteria 2031
221 Ga0207657_10185386 3300025919 Bacteria 1681
222 Ga0207649_10080972 3300025920 Bacteria 2102
223 Ga0207652_10076298 3300025921 Unclassified 2923
224 Ga0207652_10161566 3300025921 Unclassified 2008
225 Ga0207694_10103545 3300025924 Bacteria 2257
226 Ga0207694_10134496 3300025924 Unclassified 1984
227 Ga0207694_10165469 3300025924 Bacteria 1788
228 Ga0207694_10212441 3300025924 Bacteria 1576
229 Ga0207687_10008471 3300025927 Bacteria 6723
230 Ga0207687_10008529 3300025927 Bacteria 6701
231 Ga0207687_10031681 3300025927 Unclassified 3575
232 Ga0207687_10035411 3300025927 Bacteria 3395
233 Ga0207687_10085224 3300025927 Bacteria 2292
234 Ga0207687_10217531 3300025927 Bacteria 1502
235 Ga0207687_10260341 3300025927 Bacteria 1383
236 Ga0207700_10112884 3300025928 Unclassified 2190
237 Ga0207664_10037339 3300025929 Unclassified 3759
238 Ga0207664_10043565 3300025929 Bacteria 3511
239 Ga0207644_10109854 3300025931 Bacteria 2084
240 Ga0207690_10086858 3300025932 Bacteria 2199
241 Ga0207686_10005004 3300025934 Bacteria 7136
242 Ga0207686_10080043 3300025934 Bacteria 2129
243 Ga0207686_10091162 3300025934 Bacteria 2013
244 Ga0207686_10152073 3300025934 Bacteria 1612
245 Ga0207709_10030132 3300025935 Bacteria 3153
246 Ga0207704_10032670 3300025938 Bacteria 2948
247 Ga0207711_10018047 3300025941 Bacteria 5865
248 Ga0207711_10021210 3300025941 Bacteria 5425
249 Ga0207711_10142007 3300025941 Bacteria 2161
250 Ga0207711_10202549 3300025941 Bacteria 1811
251 Ga0207689_10166508 3300025942 Bacteria 1816
252 Ga0207661_10000031 3300025944 Bacteria 164429
253 Ga0207661_10094092 3300025944 Bacteria 2502
254 Ga0207661_10215559 3300025944 Bacteria 1694
255 Ga0207661_10383516 3300025944 Bacteria 1272
256 Ga0207679_10197019 3300025945 Bacteria 1680
257 Ga0207667_10027938 3300025949 Bacteria 6131
258 Ga0207667_10057355 3300025949 Bacteria 4087
259 Ga0207667_10093304 3300025949 Unclassified 3108
260 Ga0207667_10285563 3300025949 Bacteria 1686
261 Ga0207667_10381753 3300025949 Bacteria 1435
262 Ga0207667_10439288 3300025949 Bacteria 1327
263 Ga0207667_10610810 3300025949 Unclassified 1099
264 Ga0207712_10500425 3300025961 Bacteria 1039
265 Ga0207640_10219656 3300025981 Bacteria 1454
266 Ga0207658_10042155 3300025986 Unclassified 3309
267 Ga0207658_10057984 3300025986 Bacteria 2880
268 Ga0207658_10117204 3300025986 Unclassified 2116
269 Ga0207677_10024381 3300026023 Unclassified 3757
270 Ga0207677_10322447 3300026023 Bacteria 1284
271 Ga0207703_10145833 3300026035 Bacteria 2058
272 Ga0207702_10004990 3300026078 Bacteria 11658
273 Ga0207702_10005815 3300026078 Bacteria 10727
274 Ga0207702_10037991 3300026078 Bacteria 4032
275 Ga0207702_10048954 3300026078 Bacteria 3565
276 Ga0207641_10027904 3300026088 Bacteria 4663
277 Ga0207641_10109172 3300026088 Bacteria 2450
278 Ga0207641_10503783 3300026088 Bacteria 1176
279 Ga0207648_10083231 3300026089 Bacteria 2791
280 Ga0207676_10007173 3300026095 Bacteria 7889
281 Ga0207674_10005800 3300026116 Bacteria 14652
282 Ga0207674_10034301 3300026116 Bacteria 5307
283 Ga0207674_10091043 3300026116 Bacteria 3041
284 Ga0207683_10209354 3300026121 Unclassified 1774
285 Ga0207698_10117073 3300026142 Bacteria 2247
286 Ga0268266_10032704 3300028379 Bacteria 4419
287 Ga0268266_10045591 3300028379 Bacteria 3751
288 Ga0268266_10228243 3300028379 Bacteria 1714
289 Ga0268264_10011153 3300028381 Bacteria 7424
290 Ga0268264_10151416 3300028381 Unclassified 2080
291 Ga0268264_10320338 3300028381 Bacteria 1466
292 Ga0265323_10002741 3300028653 Bacteria 7948
293 Ga0265316_10080764 3300031344 Bacteria 2493
294 Ga0265316_10142499 3300031344 Bacteria 1799
295 Ga0265314_10023674 3300031711 Bacteria 4675
296 Ga0373926_0008338 3300035083 Bacteria 3447
297 Ga0373954_0091665 3300035118 Bacteria 1460
298 Ga0373943_0018118 3300035170 Bacteria 3231
299 Ga0373955_0017093 3300035172 Bacteria 3583
300 Ga0373927_0003324 3300035695 Bacteria 11571
301 Ga0373927_0222676 3300035695 Bacteria 1239
302 Ga0373933_0030543 3300035724 Unclassified 3120
303 Ga0373937_0156909 3300036401 Bacteria 2133
304 Ga0373925_0030707 3300037068 Bacteria 3945
305 Ga0436364_0195622 3300037853 Bacteria 5065
306 Ga0436364_0412469 3300037853 Bacteria 3437
307 Ga0436364_0627748 3300037853 Bacteria 5008
308 Ga0436364_0654010 3300037853 Bacteria 80215
309 Ga0436364_0691680 3300037853 Bacteria 3509
310 Ga0436364_0910695 3300037853 Bacteria 1952
311 Ga0436364_1093431 3300037853 Bacteria 1435
312 Ga0436364_1110771 3300037853 Bacteria 3851
313 Ga0436364_1415525 3300037853 Bacteria 425173
314 Ga0436365_0073198 3300039437 Bacteria 7029
315 Ga0436365_0576096 3300039437 Bacteria 4513
316 Ga0436365_0916383 3300039437 Bacteria 2352
317 Ga0436365_1228878 3300039437 Bacteria 8466
318 Ga0436365_1658155 3300039437 Unclassified 2163
319 Ga0436360_0641950 3300039438 Bacteria 12901
320 Ga0436363_0791659 3300039450 Unclassified 4541
321 Ga0436363_1154779 3300039450 Bacteria 7442
322 Ga0436362_0153509 3300039453 Unclassified 2437
323 Ga0466961_0087888 3300044693 Unclassified 1964
324 Ga0453684_0552964 3300044712 Bacteria 1268
325 Ga0451576_0023907 3300045051 Bacteria 6608
326 Ga0451576_0285103 3300045051 Bacteria 1727
327 Ga0466967_0067657 3300045976 Bacteria 3187
328 Ga0495592_0013870 3300046454 Bacteria 6125
329 Ga0495651_0016671 3300046462 Bacteria 5690
330 Ga0495662_0036426 3300046476 Unclassified 2374
331 Ga0495628_0011595 3300046516 Bacteria 7452
332 Ga0495630_0033836 3300046517 Bacteria 3812
333 Ga0495630_0056039 3300046517 Unclassified 2953
334 Ga0495665_0118385 3300046531 Bacteria 1387
335 Ga0495587_0034110 3300046536 Bacteria 3070
336 Ga0495645_0004311 3300046543 Bacteria 9720
337 Ga0495634_0035170 3300046642 Bacteria 3433
338 Ga0495634_0131546 3300046642 Bacteria 1595
339 Ga0495635_0019220 3300046663 Bacteria 4766
340 Ga0495599_0057393 3300046678 Bacteria 2436
341 Ga0495613_0294120 3300046689 Bacteria 1125
342 Ga0495600_0098008 3300046809 Unclassified 1911
343 Ga0495604_0177140 3300047317 Unclassified 1494
344 Ga0495674_0092518 3300047319 Bacteria 2581
345 Ga0495684_0016082 3300047471 Bacteria 5759
346 Ga0495684_0238654 3300047471 Bacteria 1327
347 Ga0495593_0155919 3300047673 Bacteria 1154
348 Ga0496112_0425814 3300048915 Bacteria 1266
349 Ga0501031_0005523 3300049568 Bacteria 8234
350 Ga0501032_0004092 3300049569 Bacteria 11051
351 Ga0501033_0004077 3300049570 Bacteria 11786
352 Ga0501034_0243560 3300049571 Bacteria 1743
353 Ga0501034_0343486 3300049571 Bacteria 1422
354 Ga0501036_0000824 3300049572 Bacteria 22971
355 Ga0501037_0003515 3300049573 Bacteria 11375
356 Ga0501038_0003326 3300049574 Bacteria 14993
357 Ga0501038_0028650 3300049574 Bacteria 4947
358 Ga0501043_0011807 3300049579 Bacteria 6841
359 Ga0501046_0000591 3300049580 Bacteria 35671
360 Ga0501046_0144690 3300049580 Bacteria 1796
361 Ga0501047_0023314 3300049581 Bacteria 5943
362 Ga0501048_0031971 3300049582 Bacteria 3805
363 Ga0501067_0014842 3300049583 Bacteria 4310
364 Ga0501068_0011036 3300049584 Bacteria 5084
365 Ga0501070_0004505 3300049586 Bacteria 11961
366 Ga0501070_0009595 3300049586 Bacteria 8175
367 Ga0501072_0016453 3300049588 Bacteria 5678
368 Ga0501073_0000929 3300049589 Bacteria 21018
369 Ga0501074_0029809 3300049590 Bacteria 3953
370 Ga0501079_0004585 3300049741 Bacteria 10247
371 Ga0501080_0000466 3300049742 Bacteria 31417
372 Ga0501035_0269492 3300049822 Bacteria 1441
373 Ga0501044_0007260 3300049823 Bacteria 12185
374 Ga0501044_0068592 3300049823 Unclassified 3612
375 Ga0501045_0105105 3300049824 Bacteria 2092
376 nmdc:mga05p37_77929_c1 3300050507 Bacteria 4080
377 nmdc:mga0qj67_56946_c1 3300050509 Bacteria 3099
378 nmdc:mga06r32_49460_c1 3300050510 Unclassified 4020
379 Ga0501084_0004154 3300054114 Bacteria 11803
380 Ga0501082_0001335 3300060353 Bacteria 21627
381 Ga0070660_100028254
382 Ga0070658_10098709
383 Ga0070676_10208008
384 Ga0070683_100000005
385 Ga0070683_100055177
386 Ga0070683_100225564
387 Ga0070683_100261121
388 Ga0070690_100132279
389 Ga0068869_100128340
390 Ga0070666_10011718
391 Ga0070680_100020789
392 Ga0070680_100286510
393 Ga0068868_100003385
394 Ga0068868_100057006
395 Ga0068868_100258665
396 Ga0070660_100079547
397 Ga0070660_100124793
398 Ga0070661_100089057
399 Ga0070661_100364214
400 Ga0070671_100140554
401 Ga0070671_100169599
402 Ga0070667_100116083
403 Ga0070667_100167724
404 Ga0070667_100591436
405 Ga0070709_10196835
406 Ga0070709_10422662
407 Ga0070714_100023121
408 Ga0070714_100026980
409 Ga0070713_100144272
410 Ga0070713_100402754
411 Ga0070705_100118809
412 Ga0070681_10069873
413 Ga0070681_10110064
414 Ga0070681_10368698
415 Ga0068867_100011141
416 Ga0068867_100056983
417 Ga0070679_100250376
418 Ga0070684_100000053
419 Ga0070684_100026226
420 Ga0070684_100167482
421 Ga0068853_100031932
422 Ga0068853_100258926
423 Ga0070696_100214482
424 Ga0070693_100095387
425 Ga0070665_100008755
426 Ga0070665_100026971
427 Ga0070665_100224119
428 Ga0068855_100003186
429 Ga0068855_100019266
430 Ga0068855_100068162
431 Ga0068855_100085365
432 Ga0068855_100111650
433 Ga0068855_100173356
434 Ga0068855_100184794
435 Ga0068855_100296472
436 Ga0070664_100370639
437 Ga0068857_100006078
438 Ga0068857_100012995
439 Ga0068857_100021727
440 Ga0068856_100006343
441 Ga0068856_100012995
442 Ga0068856_100316267
443 Ga0068856_100421091
444 Ga0068852_100017885
445 Ga0068852_100197562
446 Ga0068859_100130831
447 Ga0068859_100139813
448 Ga0068864_100294306
449 Ga0068864_100324983
450 Ga0068863_100153732
451 Ga0068863_100192176
452 Ga0068863_100223888
453 Ga0068863_100287427
454 Ga0068863_100318125
455 Ga0068863_100655788
456 Ga0068858_100014584
457 Ga0068858_100327623
458 Ga0068860_100002292
459 Ga0068860_100053966
460 Ga0068860_100127450
461 Ga0070717_10003760
462 Ga0097621_100006028
463 Ga0097621_100229682
464 Ga0097621_100234015
465 Ga0097621_100248304
466 Ga0068871_100002553
467 Ga0068871_100058043
468 Ga0068871_100079840
469 Ga0068871_100095711
470 Ga0075430_100065444
471 Ga0075431_100005946
472 Ga0097620_100130833
473 Ga0097620_100139818
474 Ga0097620_100286007
475 Ga0097620_100350913
476 Ga0105240_10002632
477 Ga0105240_10004172
478 Ga0105240_10014385
479 Ga0105240_10018015
480 Ga0105240_10043843
481 Ga0105240_10055866
482 Ga0105240_10074075
483 Ga0105240_10248761
484 Ga0105240_10437189
485 Ga0105245_10004209
486 Ga0105245_10015442
487 Ga0105245_10021302
488 Ga0105245_10021907
489 Ga0105245_10063448
490 Ga0105245_10230260
491 Ga0105245_10315962
492 Ga0105247_10022220
493 Ga0105247_10055038
494 Ga0114129_10273774
495 Ga0105243_10014641
496 Ga0105241_10042120
497 Ga0105241_10046489
498 Ga0105241_10240640
499 Ga0105241_10253996
500 Ga0105242_10023406
501 Ga0105242_10100729
502 Ga0105242_10107369
503 Ga0105242_10130770
504 Ga0105248_10011881
505 Ga0105248_10045290
506 Ga0105248_10110292
507 Ga0105248_10189803
508 Ga0105248_10404812
509 Ga0105248_10530544
510 Ga0105237_10001745
511 Ga0105237_10097574
512 Ga0105237_10127182
513 Ga0105237_10153230
514 Ga0105237_10614902
515 Ga0105238_10075278
516 Ga0105238_10081878
517 Ga0105238_10121826
518 Ga0105238_10165037
519 Ga0105238_10235645
520 Ga0105238_10518902
521 Ga0105239_10030564
522 Ga0105239_10078286
523 Ga0105239_10117132
524 Ga0105246_10014962
525 Ga0105246_10136012
526 Ga0105246_10232164
527 Ga0105246_10373657
528 Ga0157373_10158028
529 Ga0157371_10025117
530 Ga0157370_10019312
531 Ga0157370_10028377
532 Ga0157370_10045000
533 Ga0157370_10058419
534 Ga0157370_10072232
535 Ga0157370_10179165
536 Ga0157369_10010248
537 Ga0157369_10071399
538 Ga0157369_10100741
539 Ga0157369_10117653
540 Ga0157369_10376409
541 Ga0157374_10049698
542 Ga0157374_10093709
543 Ga0157374_10218236
544 Ga0157374_10231106
545 Ga0157374_10456296
546 Ga0157374_10708955
547 Ga0157378_10014423
548 Ga0157378_10020304
549 Ga0163162_10015993
550 Ga0163162_10028461
551 Ga0157372_10057918
552 Ga0157372_10086007
553 Ga0157372_10102343
554 Ga0157372_10181952
555 Ga0157372_10344214
556 Ga0157375_10177528
557 Ga0163163_10015983
558 Ga0163163_10024938
559 Ga0163163_10264455
560 Ga0157380_10053827
561 Ga0157379_10014949
562 Ga0157379_10338217
563 Ga0157376_10113056
564 Ga0157376_10287713
565 Ga0206352_10314704
566 Ga0213874_10018757
567 Ga0213876_10018492
568 Ga0213876_10045631
569 Ga0213875_10000008
570 Ga0213875_10012734
571 Ga0213875_10014067
572 Ga0207680_10205202
573 Ga0207699_10192458
574 Ga0207645_10188160
575 Ga0207705_10037947
576 Ga0207654_10022485
577 Ga0207654_10079653
578 Ga0207707_10029317
579 Ga0207707_10081175
580 Ga0207707_10094594
581 Ga0207695_10016014
582 Ga0207695_10023602
583 Ga0207695_10043537
584 Ga0207695_10079612
585 Ga0207695_10082739
586 Ga0207695_10088213
587 Ga0207695_10234698
588 Ga0207695_10328340
589 Ga0207695_10403326
590 Ga0207671_10022806
591 Ga0207671_10055255
592 Ga0207671_10154208
593 Ga0207671_10164441
594 Ga0207671_10269249
595 Ga0207663_10090582
596 Ga0207660_10038013
597 Ga0207660_10215371
598 Ga0207657_10000858
599 Ga0207657_10040766
600 Ga0207657_10133686
601 Ga0207657_10185386
602 Ga0207649_10080972
603 Ga0207652_10076298
604 Ga0207652_10161566
605 Ga0207694_10103545
606 Ga0207694_10134496
607 Ga0207694_10165469
608 Ga0207694_10212441
609 Ga0207687_10008471
610 Ga0207687_10008529
611 Ga0207687_10031681
612 Ga0207687_10035411
613 Ga0207687_10085224
614 Ga0207687_10217531
615 Ga0207687_10260341
616 Ga0207700_10112884
617 Ga0207664_10037339
618 Ga0207664_10043565
619 Ga0207644_10109854
620 Ga0207690_10086858
621 Ga0207686_10005004
622 Ga0207686_10080043
623 Ga0207686_10091162
624 Ga0207686_10152073
625 Ga0207709_10030132
626 Ga0207704_10032670
627 Ga0207711_10018047
628 Ga0207711_10021210
629 Ga0207711_10142007
630 Ga0207711_10202549
631 Ga0207689_10166508
632 Ga0207661_10000031
633 Ga0207661_10094092
634 Ga0207661_10215559
635 Ga0207661_10383516
636 Ga0207679_10197019
637 Ga0207667_10027938
638 Ga0207667_10057355
639 Ga0207667_10093304
640 Ga0207667_10285563
641 Ga0207667_10381753
642 Ga0207667_10439288
643 Ga0207667_10610810
644 Ga0207712_10500425
645 Ga0207640_10219656
646 Ga0207658_10042155
647 Ga0207658_10057984
648 Ga0207658_10117204
649 Ga0207677_10024381
650 Ga0207677_10322447
651 Ga0207703_10145833
652 Ga0207702_10004990
653 Ga0207702_10005815
654 Ga0207702_10037991
655 Ga0207702_10048954
656 Ga0207641_10027904
657 Ga0207641_10109172
658 Ga0207641_10503783
659 Ga0207648_10083231
660 Ga0207676_10007173
661 Ga0207674_10005800
662 Ga0207674_10034301
663 Ga0207674_10091043
664 Ga0207683_10209354
665 Ga0207698_10117073
666 Ga0268266_10032704
667 Ga0268266_10045591
668 Ga0268266_10228243
669 Ga0268264_10011153
670 Ga0268264_10151416
671 Ga0268264_10320338
672 Ga0265323_10002741
673 Ga0265316_10080764
674 Ga0265316_10142499
675 Ga0265314_10023674
676 Ga0373926_0008338
677 Ga0373954_0091665
678 Ga0373943_0018118
679 Ga0373955_0017093
680 Ga0373927_0003324
681 Ga0373927_0222676
682 Ga0373933_0030543
683 Ga0373937_0156909
684 Ga0373925_0030707
685 Ga0436364_0195622
686 Ga0436364_0412469
687 Ga0436364_0627748
688 Ga0436364_0654010
689 Ga0436364_0691680
690 Ga0436364_0910695
691 Ga0436364_1093431
692 Ga0436364_1110771
693 Ga0436364_1415525
694 Ga0436365_0073198
695 Ga0436365_0576096
696 Ga0436365_0916383
697 Ga0436365_1228878
698 Ga0436365_1658155
699 Ga0436360_0641950
700 Ga0436363_0791659
701 Ga0436363_1154779
702 Ga0436362_0153509
703 Ga0466961_0087888
704 Ga0453684_0552964
705 Ga0451576_0023907
706 Ga0451576_0285103
707 Ga0466967_0067657
708 Ga0495592_0013870
709 Ga0495651_0016671
710 Ga0495662_0036426
711 Ga0495628_0011595
712 Ga0495630_0033836
713 Ga0495630_0056039
714 Ga0495665_0118385
715 Ga0495587_0034110
716 Ga0495645_0004311
717 Ga0495634_0035170
718 Ga0495634_0131546
719 Ga0495635_0019220
720 Ga0495599_0057393
721 Ga0495613_0294120
722 Ga0495600_0098008
723 Ga0495604_0177140
724 Ga0495674_0092518
725 Ga0495684_0016082
726 Ga0495684_0238654
727 Ga0495593_0155919
728 Ga0496112_0425814
729 Ga0501031_0005523
730 Ga0501032_0004092
731 Ga0501033_0004077
732 Ga0501034_0243560
733 Ga0501034_0343486
734 Ga0501036_0000824
735 Ga0501037_0003515
736 Ga0501038_0003326
737 Ga0501038_0028650
738 Ga0501043_0011807
739 Ga0501046_0000591
740 Ga0501046_0144690
741 Ga0501047_0023314
742 Ga0501048_0031971
743 Ga0501067_0014842
744 Ga0501068_0011036
745 Ga0501070_0004505
746 Ga0501070_0009595
747 Ga0501072_0016453
748 Ga0501073_0000929
749 Ga0501074_0029809
750 Ga0501079_0004585
751 Ga0501080_0000466
752 Ga0501035_0269492
753 Ga0501044_0007260
754 Ga0501044_0068592
755 Ga0501045_0105105
756 nmdc:mga05p37_77929_c1
757 nmdc:mga0qj67_56946_c1
758 nmdc:mga06r32_49460_c1
759 Ga0501084_0004154
760 Ga0501082_0001335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13401

AAA_22

AAA domain

62

194

0.91

PF07693

KAP_NTPase

KAP family P-loop domain

50

144

0.87

PF13191

AAA_16

AAA ATPase domain

43

183

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jgr-assembly1.cif.gz_G structure of drosophila orc bound to dna (84 bp) and cdc6 0.7464 2 266
7svu-assembly1.cif.gz_K tnsbctd-tnsc-tniq complex 0.7436 23 265
1fnn-assembly2.cif.gz_B crystal structure of cdc6p from pyrobaculum aerophilum 0.7353 3 265
8bd5-assembly1.cif.gz_J cas12k-sgrna-dsdna-s15-tniq-tnsc transposon recruitment complex 0.7301 23 265
5zr1-assembly1.cif.gz_A saccharomyces cerevisiae origin recognition complex bound to a 72-bp origin dna containing acs and b1 element 0.7264 24 266
ID Description Score Start End Superfamily
af_I6XFD1_186_270_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9028 191 264 1.10.8.60
af_I6XFD1_25_185_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.874 23 183 3.40.50.300
af_I6XFD1_25_185_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8642 23 183 3.40.50.300
af_I6XFD1_186_270_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.7851 191 264 1.10.8.60
1in4A03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.7841 193 269 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A2V8TM56-F1-model_v4 TonB C-terminal domain-containing protein 0.9799 1 273 GO:0005886
GO:0015031
GO:0016887
GO:0055085
AF-A0A3D1AUF2-F1-model_v4 General secretion pathway protein 0.974 1 273 GO:0016887
AF-A0A2V9CMI7-F1-model_v4 ORC1/DEAH AAA+ ATPase domain-containing protein 0.9667 1 273 GO:0016887
AF-A0A7C5I8Q2-F1-model_v4 General secretion pathway protein 0.9658 1 247 GO:0016887
AF-A0A2V9BMY3-F1-model_v4 ATPase 0.9637 1 266 GO:0016887

Map