F428148

General Info

Members Datasets Scaffolds Average Seq Length
378 228 756 226

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0726304|Ga0496114_0726304_75_827
Length 250
Sequence LSCQSKALINPGTFVVSSMSLFRREASGRIPRASQAVRGEIRWDYDRAELIADGIVHAAGLLFGLTGVLAIVAIALGRKGQGATPVLIYGVGLLAMLGISALYNMWPVSRLKWLLRRFDHSAIYLLIAGTYTPFLAQMKSGLLAVGLGIGMWASAAFGIALKLLLPGRFDAVSIGLYLALGWIGVVAYDSFTAAIPPASLHLLWIGGALYSVGIVFHAWERLRFQNAIWHGFVLVAAMCHYAAVLELTLR

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
215 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
216 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
220 2791355199
221 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
222 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
223 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
224 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
225 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
226 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
227 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
228 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.46
Nodule 1.32
Rhizoplane 10.05
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0726304 3300048917 Bacteria 870
2 JGI25153J46596_10004480 3300003215 Bacteria 7524
3 rootH2_10143855 3300003320 Bacteria 1030
4 Ga0055542_1014445 3300003762 Bacteria 1296
5 Ga0065165_1033659 3300005262 Bacteria 1593
6 Ga0070676_10382636 3300005328 Bacteria 975
7 Ga0068868_100047697 3300005338 Bacteria 3359
8 Ga0070689_100165305 3300005340 Bacteria 1791
9 Ga0070668_100023565 3300005347 Bacteria 4657
10 Ga0070669_100396002 3300005353 Bacteria 1129
11 Ga0070671_100073097 3300005355 Bacteria 2864
12 Ga0070674_100542555 3300005356 Bacteria 974
13 Ga0070709_10000403 3300005434 Bacteria 26346
14 Ga0070714_100030976 3300005435 Bacteria 4457
15 Ga0070713_100204485 3300005436 Bacteria 1785
16 Ga0070710_10001786 3300005437 Bacteria 10174
17 Ga0070710_10029064 3300005437 Bacteria 2962
18 Ga0070711_100002968 3300005439 Bacteria 9791
19 Ga0070663_100004963 3300005455 Bacteria 7856
20 Ga0070663_100108938 3300005455 Bacteria 2079
21 Ga0070663_100118668 3300005455 Bacteria 1996
22 Ga0070663_100306286 3300005455 Bacteria 1273
23 Ga0070663_100381822 3300005455 Bacteria 1148
24 Ga0070663_100571241 3300005455 Bacteria 948
25 Ga0070678_100006243 3300005456 Bacteria 6973
26 Ga0070678_100632349 3300005456 Bacteria 958
27 Ga0070662_100018417 3300005457 Bacteria 4723
28 Ga0070679_100068612 3300005530 Bacteria 3536
29 Ga0068853_100513789 3300005539 Bacteria 1132
30 Ga0070686_100435807 3300005544 Bacteria 1004
31 Ga0070665_100012269 3300005548 Bacteria 8639
32 Ga0070665_100097412 3300005548 Bacteria 2946
33 Ga0070665_100101111 3300005548 Bacteria 2887
34 Ga0070665_100261127 3300005548 Bacteria 1733
35 Ga0068857_100077745 3300005577 Bacteria 2961
36 Ga0068854_100292956 3300005578 Bacteria 1314
37 Ga0068856_100208261 3300005614 Bacteria 1970
38 Ga0068856_100958728 3300005614 Bacteria 874
39 Ga0070702_100546500 3300005615 Bacteria 859
40 Ga0068859_100076162 3300005617 Bacteria 3395
41 Ga0068864_100038067 3300005618 Bacteria 4105
42 Ga0068861_100066017 3300005719 Bacteria 2788
43 Ga0068851_10165973 3300005834 Bacteria 1216
44 Ga0068870_10048453 3300005840 Bacteria 2238
45 Ga0068863_100915517 3300005841 Bacteria 878
46 Ga0068858_100183586 3300005842 Bacteria 1975
47 Ga0068860_100101121 3300005843 Bacteria 2750
48 Ga0081455_10001482 3300005937 Bacteria 29031
49 Ga0081455_10014521 3300005937 Bacteria 7712
50 Ga0081455_10027185 3300005937 Bacteria 5245
51 Ga0081538_10137428 3300005981 Bacteria 1134
52 Ga0081540_1005558 3300005983 Bacteria 9388
53 Ga0081540_1018517 3300005983 Bacteria 4267
54 Ga0081540_1041633 3300005983 Bacteria 2379
55 Ga0081539_10001833 3300005985 Bacteria 33546
56 Ga0070717_10068131 3300006028 Bacteria 2962
57 Ga0070717_10125194 3300006028 Bacteria 2206
58 Ga0070717_10407009 3300006028 Bacteria 1223
59 Ga0075365_10017479 3300006038 Bacteria 4388
60 Ga0075365_10129406 3300006038 Bacteria 1746
61 Ga0075365_10357359 3300006038 Bacteria 1030
62 Ga0075368_10060481 3300006042 Bacteria 1516
63 Ga0075368_10105126 3300006042 Bacteria 1161
64 Ga0075363_100073564 3300006048 Bacteria 1859
65 Ga0075363_100077645 3300006048 Bacteria 1812
66 Ga0075363_100108754 3300006048 Bacteria 1540
67 Ga0075363_100210048 3300006048 Bacteria 1114
68 Ga0075364_10125959 3300006051 Bacteria 1717
69 Ga0075364_10320268 3300006051 Bacteria 1056
70 Ga0070715_10055456 3300006163 Bacteria 1720
71 Ga0070712_100122028 3300006175 Bacteria 1962
72 Ga0075362_10000378 3300006177 Bacteria 12764
73 Ga0075362_10185911 3300006177 Bacteria 1008
74 Ga0075367_10024462 3300006178 Bacteria 3406
75 Ga0075367_10124003 3300006178 Bacteria 1593
76 Ga0075367_10168104 3300006178 Bacteria 1365
77 Ga0075367_10182842 3300006178 Bacteria 1307
78 Ga0075367_10369700 3300006178 Bacteria 906
79 Ga0075369_10112739 3300006186 Bacteria 1226
80 Ga0075366_10103580 3300006195 Bacteria 1709
81 Ga0097621_100042874 3300006237 Bacteria 3645
82 Ga0075370_10019697 3300006353 Bacteria 3678
83 Ga0075370_10385276 3300006353 Bacteria 840
84 Ga0068871_100182353 3300006358 Bacteria 1805
85 Ga0068871_100272536 3300006358 Bacteria 1479
86 Ga0075428_100248838 3300006844 Bacteria 1916
87 Ga0075428_100733162 3300006844 Bacteria 1052
88 Ga0075430_100343004 3300006846 Unclassified 1234
89 Ga0075431_100044806 3300006847 Bacteria 4561
90 Ga0075434_100612889 3300006871 Bacteria 1107
91 Ga0097620_100076160 3300006931 Bacteria 3395
92 Ga0099794_10101156 3300007265 Bacteria 1439
93 Ga0105240_10282419 3300009093 Bacteria 1906
94 Ga0111539_10592404 3300009094 Bacteria 1291
95 Ga0105247_10114816 3300009101 Bacteria 1737
96 Ga0105248_10954788 3300009177 Bacteria 968
97 Ga0105246_10450248 3300011119 Bacteria 1082
98 Ga0157370_10057575 3300013104 Bacteria 3695
99 Ga0157378_11344067 3300013297 Bacteria 756
100 Ga0157372_10495660 3300013307 Bacteria 1424
101 Ga0157375_10310728 3300013308 Bacteria 1740
102 Ga0157375_10415807 3300013308 Bacteria 1511
103 Ga0157380_10292181 3300014326 Bacteria 1497
104 Ga0157380_10351845 3300014326 Bacteria 1379
105 Ga0157380_10459310 3300014326 Bacteria 1225
106 Ga0157377_10130008 3300014745 Bacteria 1537
107 Ga0157379_10150485 3300014968 Bacteria 2099
108 Ga0157379_10188654 3300014968 Bacteria 1863
109 Ga0157376_10485058 3300014969 Bacteria 1212
110 Ga0157376_10731669 3300014969 Bacteria 997
111 Ga0163161_10466999 3300017792 Bacteria 1023
112 Ga0213873_10004229 3300021358 Bacteria 2660
113 Ga0213876_10001590 3300021384 Bacteria 13958
114 Ga0209148_1000527 3300025254 Bacteria 37706
115 Ga0209455_1001112 3300025272 Bacteria 13173
116 Ga0209564_1001290 3300025295 Bacteria 27322
117 Ga0209758_1004686 3300025297 Bacteria 11171
118 Ga0207692_10076329 3300025898 Bacteria 1780
119 Ga0207692_10248946 3300025898 Bacteria 1064
120 Ga0207710_10022339 3300025900 Bacteria 2715
121 Ga0207680_10064359 3300025903 Bacteria 2248
122 Ga0207699_10000347 3300025906 Bacteria 24590
123 Ga0207643_10025334 3300025908 Bacteria 3278
124 Ga0207693_10123607 3300025915 Bacteria 2033
125 Ga0207663_10023155 3300025916 Bacteria 3560
126 Ga0207663_10039595 3300025916 Bacteria 2857
127 Ga0207657_10383002 3300025919 Bacteria 1107
128 Ga0207650_10110891 3300025925 Bacteria 2124
129 Ga0207650_10173011 3300025925 Bacteria 1717
130 Ga0207659_10354877 3300025926 Bacteria 1217
131 Ga0207700_10007638 3300025928 Bacteria 6632
132 Ga0207700_10230049 3300025928 Bacteria 1576
133 Ga0207664_10039380 3300025929 Bacteria 3670
134 Ga0207664_10098574 3300025929 Bacteria 2410
135 Ga0207644_10280867 3300025931 Bacteria 1337
136 Ga0207690_10273744 3300025932 Bacteria 1313
137 Ga0207706_10068994 3300025933 Bacteria 3109
138 Ga0207686_10179270 3300025934 Bacteria 1501
139 Ga0207665_10008418 3300025939 Bacteria 6799
140 Ga0207691_10085786 3300025940 Bacteria 2826
141 Ga0207691_10403078 3300025940 Bacteria 1166
142 Ga0207711_10135708 3300025941 Bacteria 2210
143 Ga0207711_10361658 3300025941 Bacteria 1345
144 Ga0207711_10739252 3300025941 Bacteria 917
145 Ga0207689_10048730 3300025942 Bacteria 3495
146 Ga0207689_10604183 3300025942 Bacteria 923
147 Ga0207679_10186873 3300025945 Bacteria 1719
148 Ga0207667_10118628 3300025949 Bacteria 2726
149 Ga0207651_10044035 3300025960 Bacteria 2984
150 Ga0207668_10117374 3300025972 Bacteria 2008
151 Ga0207640_10102634 3300025981 Bacteria 2009
152 Ga0207658_10395446 3300025986 Bacteria 1214
153 Ga0207677_10279929 3300026023 Bacteria 1369
154 Ga0207703_10111619 3300026035 Bacteria 2334
155 Ga0207639_10387200 3300026041 Bacteria 1257
156 Ga0207678_10008735 3300026067 Bacteria 8919
157 Ga0207678_10025808 3300026067 Bacteria 5127
158 Ga0207678_10089890 3300026067 Bacteria 2625
159 Ga0207678_10187369 3300026067 Bacteria 1768
160 Ga0207678_10470917 3300026067 Bacteria 1093
161 Ga0207708_10322574 3300026075 Bacteria 1261
162 Ga0207702_10081241 3300026078 Bacteria 2814
163 Ga0207641_10347037 3300026088 Bacteria 1414
164 Ga0207648_10371493 3300026089 Bacteria 1292
165 Ga0207676_10030008 3300026095 Bacteria 4076
166 Ga0207676_10127769 3300026095 Bacteria 2156
167 Ga0207674_10062769 3300026116 Bacteria 3752
168 Ga0207674_10251680 3300026116 Bacteria 1714
169 Ga0207675_100092771 3300026118 Bacteria 2840
170 Ga0207675_100634386 3300026118 Bacteria 1074
171 Ga0207683_10036682 3300026121 Bacteria 4270
172 Ga0207683_10067542 3300026121 Bacteria 3154
173 Ga0268266_10009357 3300028379 Bacteria 8635
174 Ga0268266_10025034 3300028379 Bacteria 5080
175 Ga0268266_10071955 3300028379 Bacteria 2997
176 Ga0268266_10219803 3300028379 Bacteria 1746
177 Ga0268264_10316438 3300028381 Bacteria 1474
178 Ga0265337_1003669 3300028556 Bacteria 6575
179 Ga0265334_10059466 3300028573 Bacteria 1444
180 Ga0307508_10345750 3300031616 Bacteria 1079
181 Ga0307413_10017828 3300031824 Bacteria 3708
182 Ga0307409_100322500 3300031995 Bacteria 1446
183 Ga0307416_100433043 3300032002 Bacteria 1363
184 Ga0307416_100628827 3300032002 Bacteria 1156
185 Ga0307411_10440390 3300032005 Bacteria 1087
186 Ga0307415_100083826 3300032126 Bacteria 2285
187 Ga0307415_100414231 3300032126 Bacteria 1154
188 Ga0307510_10000403 3300033180 Bacteria 41043
189 Ga0373939_0086263 3300035114 Bacteria 1053
190 Ga0436365_0651557 3300039437 Bacteria 30425
191 Ga0436363_0920127 3300039450 Bacteria 1238
192 Ga0436362_1015402 3300039453 Bacteria 6103
193 Ga0466968_0055391 3300044735 Bacteria 1701
194 Ga0495617_105766 3300046452 Bacteria 912
195 Ga0495603_0014558 3300046455 Bacteria 4758
196 Ga0495590_0101489 3300046457 Bacteria 1022
197 Ga0495638_0015515 3300046460 Bacteria 5114
198 Ga0495638_0134533 3300046460 Bacteria 1449
199 Ga0495650_0081588 3300046471 Bacteria 1246
200 Ga0495584_0047230 3300046491 Bacteria 2171
201 Ga0495594_0154941 3300046499 Bacteria 1301
202 Ga0495596_0017957 3300046500 Bacteria 2921
203 Ga0495606_0001391 3300046507 Bacteria 32703
204 Ga0495616_0146888 3300046513 Bacteria 1069
205 Ga0495642_0179705 3300046528 Bacteria 921
206 Ga0495622_0060552 3300046557 Bacteria 1753
207 Ga0495622_0187108 3300046557 Bacteria 927
208 Ga0495656_0019549 3300046615 Bacteria 2615
209 Ga0495656_0139660 3300046615 Bacteria 1161
210 Ga0495668_0126430 3300046616 Bacteria 1399
211 Ga0495611_0102118 3300046648 Bacteria 1332
212 Ga0495659_0011124 3300046664 Bacteria 2899
213 Ga0495670_0182622 3300046691 Bacteria 1108
214 Ga0495671_0091998 3300046692 Bacteria 1484
215 Ga0495649_0167604 3300046694 Bacteria 1150
216 Ga0495604_0502898 3300047317 Bacteria 786
217 Ga0496101_0117848 3300048904 Bacteria 2005
218 Ga0496102_0229586 3300048905 Bacteria 1750
219 Ga0496103_0142184 3300048906 Bacteria 1535
220 Ga0496103_0425675 3300048906 Bacteria 852
221 Ga0496104_0281771 3300048907 Bacteria 1575
222 Ga0496104_0327511 3300048907 Bacteria 1445
223 Ga0496104_0653809 3300048907 Bacteria 960
224 Ga0496105_0316653 3300048908 Bacteria 1251
225 Ga0496106_0111421 3300048909 Bacteria 2131
226 Ga0496106_0485745 3300048909 Bacteria 992
227 Ga0496106_0659064 3300048909 Bacteria 836
228 Ga0496107_0216229 3300048910 Bacteria 1425
229 Ga0496107_0377361 3300048910 Unclassified 1055
230 Ga0496108_0028306 3300048911 Bacteria 4636
231 Ga0496108_0117561 3300048911 Bacteria 2278
232 Ga0496108_0449067 3300048911 Bacteria 1126
233 Ga0496109_0001683 3300048912 Bacteria 18416
234 Ga0496109_0018928 3300048912 Bacteria 6062
235 Ga0496109_0097109 3300048912 Bacteria 2730
236 Ga0496109_0371545 3300048912 Bacteria 1351
237 Ga0496110_0004523 3300048913 Bacteria 10790
238 Ga0496110_0049809 3300048913 Bacteria 3677
239 Ga0496110_0050922 3300048913 Bacteria 3638
240 Ga0496110_0155353 3300048913 Bacteria 2072
241 Ga0496111_0006252 3300048914 Bacteria 7719
242 Ga0496111_0048434 3300048914 Bacteria 3061
243 Ga0496111_0228427 3300048914 Bacteria 1382
244 Ga0496112_0050147 3300048915 Bacteria 4092
245 Ga0496112_0120084 3300048915 Bacteria 2598
246 Ga0496112_0236246 3300048915 Bacteria 1781
247 Ga0496113_0055521 3300048916 Bacteria 2969
248 Ga0496113_0210672 3300048916 Bacteria 1547
249 Ga0496113_0237656 3300048916 Bacteria 1453
250 Ga0496113_0525561 3300048916 Bacteria 950
251 Ga0496115_0071137 3300048918 Bacteria 2821
252 Ga0496115_0109367 3300048918 Bacteria 2270
253 Ga0496115_0570898 3300048918 Bacteria 902
254 Ga0496121_0117031 3300048924 Bacteria 2020
255 Ga0496121_0145584 3300048924 Bacteria 1751
256 Ga0496121_0175400 3300048924 Bacteria 1552
257 Ga0496123_0112125 3300048926 Bacteria 1556
258 Ga0496124_0206880 3300048927 Bacteria 1488
259 Ga0496124_0323632 3300048927 Bacteria 1103
260 Ga0496125_0172319 3300048928 Bacteria 1453
261 Ga0496126_0115739 3300048929 Bacteria 2331
262 Ga0501031_0032063 3300049568 Bacteria 3426
263 Ga0501031_0157656 3300049568 Bacteria 1484
264 Ga0501032_0002916 3300049569 Bacteria 13298
265 Ga0501032_0040020 3300049569 Bacteria 3187
266 Ga0501032_0115358 3300049569 Bacteria 1776
267 Ga0501033_0003392 3300049570 Bacteria 13140
268 Ga0501033_0017890 3300049570 Bacteria 5351
269 Ga0501033_0032086 3300049570 Bacteria 3943
270 Ga0501033_0071970 3300049570 Bacteria 2539
271 Ga0501033_0098558 3300049570 Bacteria 2134
272 Ga0501034_0145051 3300049571 Bacteria 2352
273 Ga0501034_0607491 3300049571 Bacteria 999
274 Ga0501036_0085442 3300049572 Bacteria 2667
275 Ga0501036_0357375 3300049572 Bacteria 1220
276 Ga0501036_0421490 3300049572 Bacteria 1113
277 Ga0501037_0000053 3300049573 Bacteria 110672
278 Ga0501037_0190601 3300049573 Bacteria 1452
279 Ga0501037_0211402 3300049573 Bacteria 1368
280 Ga0501041_0598363 3300049577 Bacteria 704
281 Ga0501043_0000008 3300049579 Bacteria 223654
282 Ga0501043_0108157 3300049579 Bacteria 2184
283 Ga0501043_0266185 3300049579 Bacteria 1317
284 Ga0501046_0160693 3300049580 Bacteria 1690
285 Ga0501046_0186618 3300049580 Bacteria 1548
286 Ga0501047_0064340 3300049581 Bacteria 3537
287 Ga0501047_0150199 3300049581 Bacteria 2206
288 Ga0501047_0247642 3300049581 Bacteria 1631
289 Ga0501048_0187026 3300049582 Bacteria 1468
290 Ga0501067_0271626 3300049583 Bacteria 944
291 Ga0501068_0023672 3300049584 Bacteria 3601
292 Ga0501069_0000004 3300049585 Bacteria 192353
293 Ga0501069_0024264 3300049585 Bacteria 3307
294 Ga0501069_0222066 3300049585 Bacteria 1098
295 Ga0501070_0000434 3300049586 Bacteria 38020
296 Ga0501070_0000638 3300049586 Bacteria 32294
297 Ga0501070_0068544 3300049586 Bacteria 2936
298 Ga0501070_0091427 3300049586 Bacteria 2518
299 Ga0501070_0158030 3300049586 Bacteria 1869
300 Ga0501070_0201494 3300049586 Bacteria 1634
301 Ga0501071_0126186 3300049587 Bacteria 1899
302 Ga0501071_0128009 3300049587 Bacteria 1885
303 Ga0501071_0542509 3300049587 Bacteria 893
304 Ga0501073_0032937 3300049589 Bacteria 3693
305 Ga0501073_0059588 3300049589 Bacteria 2666
306 Ga0501073_0078235 3300049589 Bacteria 2301
307 Ga0501073_0105313 3300049589 Bacteria 1957
308 Ga0501074_0007861 3300049590 Bacteria 7723
309 Ga0501074_0084609 3300049590 Bacteria 2273
310 Ga0501074_0121510 3300049590 Bacteria 1868
311 Ga0501074_0378810 3300049590 Bacteria 1004
312 Ga0501076_0079827 3300049592 Bacteria 2626
313 Ga0501080_0002111 3300049742 Bacteria 17250
314 Ga0501080_0015885 3300049742 Bacteria 6944
315 Ga0501080_0081204 3300049742 Bacteria 3012
316 Ga0501080_0846764 3300049742 Bacteria 800
317 Ga0501083_0000254 3300049744 Bacteria 33820
318 Ga0501083_0406410 3300049744 Unclassified 886
319 Ga0501035_0000011 3300049822 Bacteria 305794
320 Ga0501035_0002769 3300049822 Bacteria 16984
321 Ga0501035_0015391 3300049822 Bacteria 7057
322 Ga0501035_0025132 3300049822 Bacteria 5460
323 Ga0501044_0000041 3300049823 Bacteria 154183
324 Ga0501044_0025434 3300049823 Bacteria 6274
325 Ga0501044_0055593 3300049823 Bacteria 4065
326 Ga0501044_0282397 3300049823 Bacteria 1593
327 Ga0501044_0384455 3300049823 Bacteria 1318
328 Ga0501044_0480939 3300049823 Bacteria 1145
329 nmdc:mga03683_217052_c1 3300050489 Bacteria 881
330 nmdc:mga03683_282379_c1 3300050489 Bacteria 776
331 nmdc:mga03683_914_c1 3300050489 Bacteria 8506
332 nmdc:mga03n38_119956_c1 3300050490 Bacteria 1291
333 nmdc:mga03n38_59460_c1 3300050490 Bacteria 1735
334 nmdc:mga03n38_94645_c1 3300050490 Bacteria 1429
335 nmdc:mga00v17_129439_c1 3300050491 Bacteria 1612
336 nmdc:mga00v17_749797_c1 3300050491 Bacteria 624
337 nmdc:mga00v17_94271_c1 3300050491 Bacteria 1883
338 nmdc:mga0yw44_113309_c1 3300050492 Bacteria 1740
339 nmdc:mga0yw44_20086_c1 3300050492 Bacteria 3700
340 nmdc:mga0yw44_252524_c1 3300050492 Bacteria 1174
341 nmdc:mga0yw44_38779_c1 3300050492 Bacteria 2821
342 nmdc:mga0yw44_67312_c1 3300050492 Bacteria 2213
343 nmdc:mga0k408_105357_c1 3300050493 Bacteria 1665
344 nmdc:mga06z11_102507_c1 3300050494 Bacteria 1572
345 nmdc:mga06z11_118748_c1 3300050494 Bacteria 1473
346 nmdc:mga06z11_5599_c1 3300050494 Bacteria 5052
347 nmdc:mga06z11_6164_c1 3300050494 Bacteria 4858
348 nmdc:mga06z11_68870_c1 3300050494 Bacteria 1866
349 nmdc:mga07m45_11909_c1 3300050496 Bacteria 3419
350 nmdc:mga07m45_314225_c1 3300050496 Bacteria 911
351 nmdc:mga06r32_66691_c1 3300050510 Bacteria 3473
352 nmdc:mga0n895_725076_c1 3300050512 Bacteria 989
353 nmdc:mga0a205_736066_c1 3300050515 Bacteria 835
354 nmdc:mga0sz30_123975_c1 3300050516 Bacteria 1136
355 nmdc:mga0sz30_132256_c1 3300050516 Bacteria 1100
356 nmdc:mga0sz30_187_c1 3300050516 Bacteria 22807
357 Ga0500643_032486 3300053087 Bacteria 1585
358 Ga0500644_0221901 3300053088 Bacteria 789
359 Ga0500651_0034307 3300053093 Bacteria 3199
360 Ga0500566_0218899 3300053094 Bacteria 948
361 Ga0500641_0009750 3300053096 Bacteria 3456
362 Ga0500641_0029679 3300053096 Bacteria 2144
363 Ga0500562_027474 3300053108 Bacteria 1493
364 Ga0500592_027948 3300053116 Bacteria 910
365 Ga0500577_0197452 3300053142 Bacteria 867
366 Ga0500589_058350 3300053147 Bacteria 1775
367 Ga0500616_0041537 3300053153 Bacteria 2467
368 Ga0500634_0088032 3300053161 Bacteria 1584
369 2723848519 2721755755 Bacteria 8322773
370 2793077607
371 2874606311 2874604998 Bacteria 7834745
372 2876818091 2876808645 Bacteria 8824342
373 2879113245 2879110137 Bacteria 8907982
374 2889036909 2889033259 Bacteria 9099371
375 2917558374 2917554339 Bacteria 4987857
376 2922363684 2922361189 Bacteria 7436256
377 2937848517 2937843397 Bacteria 5256375
378 8056676522 8056673599 Bacteria 7871253
379 Ga0496114_0726304
380 JGI25153J46596_10004480
381 rootH2_10143855
382 Ga0055542_1014445
383 Ga0065165_1033659
384 Ga0070676_10382636
385 Ga0068868_100047697
386 Ga0070689_100165305
387 Ga0070668_100023565
388 Ga0070669_100396002
389 Ga0070671_100073097
390 Ga0070674_100542555
391 Ga0070709_10000403
392 Ga0070714_100030976
393 Ga0070713_100204485
394 Ga0070710_10001786
395 Ga0070710_10029064
396 Ga0070711_100002968
397 Ga0070663_100004963
398 Ga0070663_100108938
399 Ga0070663_100118668
400 Ga0070663_100306286
401 Ga0070663_100381822
402 Ga0070663_100571241
403 Ga0070678_100006243
404 Ga0070678_100632349
405 Ga0070662_100018417
406 Ga0070679_100068612
407 Ga0068853_100513789
408 Ga0070686_100435807
409 Ga0070665_100012269
410 Ga0070665_100097412
411 Ga0070665_100101111
412 Ga0070665_100261127
413 Ga0068857_100077745
414 Ga0068854_100292956
415 Ga0068856_100208261
416 Ga0068856_100958728
417 Ga0070702_100546500
418 Ga0068859_100076162
419 Ga0068864_100038067
420 Ga0068861_100066017
421 Ga0068851_10165973
422 Ga0068870_10048453
423 Ga0068863_100915517
424 Ga0068858_100183586
425 Ga0068860_100101121
426 Ga0081455_10001482
427 Ga0081455_10014521
428 Ga0081455_10027185
429 Ga0081538_10137428
430 Ga0081540_1005558
431 Ga0081540_1018517
432 Ga0081540_1041633
433 Ga0081539_10001833
434 Ga0070717_10068131
435 Ga0070717_10125194
436 Ga0070717_10407009
437 Ga0075365_10017479
438 Ga0075365_10129406
439 Ga0075365_10357359
440 Ga0075368_10060481
441 Ga0075368_10105126
442 Ga0075363_100073564
443 Ga0075363_100077645
444 Ga0075363_100108754
445 Ga0075363_100210048
446 Ga0075364_10125959
447 Ga0075364_10320268
448 Ga0070715_10055456
449 Ga0070712_100122028
450 Ga0075362_10000378
451 Ga0075362_10185911
452 Ga0075367_10024462
453 Ga0075367_10124003
454 Ga0075367_10168104
455 Ga0075367_10182842
456 Ga0075367_10369700
457 Ga0075369_10112739
458 Ga0075366_10103580
459 Ga0097621_100042874
460 Ga0075370_10019697
461 Ga0075370_10385276
462 Ga0068871_100182353
463 Ga0068871_100272536
464 Ga0075428_100248838
465 Ga0075428_100733162
466 Ga0075430_100343004
467 Ga0075431_100044806
468 Ga0075434_100612889
469 Ga0097620_100076160
470 Ga0099794_10101156
471 Ga0105240_10282419
472 Ga0111539_10592404
473 Ga0105247_10114816
474 Ga0105248_10954788
475 Ga0105246_10450248
476 Ga0157370_10057575
477 Ga0157378_11344067
478 Ga0157372_10495660
479 Ga0157375_10310728
480 Ga0157375_10415807
481 Ga0157380_10292181
482 Ga0157380_10351845
483 Ga0157380_10459310
484 Ga0157377_10130008
485 Ga0157379_10150485
486 Ga0157379_10188654
487 Ga0157376_10485058
488 Ga0157376_10731669
489 Ga0163161_10466999
490 Ga0213873_10004229
491 Ga0213876_10001590
492 Ga0209148_1000527
493 Ga0209455_1001112
494 Ga0209564_1001290
495 Ga0209758_1004686
496 Ga0207692_10076329
497 Ga0207692_10248946
498 Ga0207710_10022339
499 Ga0207680_10064359
500 Ga0207699_10000347
501 Ga0207643_10025334
502 Ga0207693_10123607
503 Ga0207663_10023155
504 Ga0207663_10039595
505 Ga0207657_10383002
506 Ga0207650_10110891
507 Ga0207650_10173011
508 Ga0207659_10354877
509 Ga0207700_10007638
510 Ga0207700_10230049
511 Ga0207664_10039380
512 Ga0207664_10098574
513 Ga0207644_10280867
514 Ga0207690_10273744
515 Ga0207706_10068994
516 Ga0207686_10179270
517 Ga0207665_10008418
518 Ga0207691_10085786
519 Ga0207691_10403078
520 Ga0207711_10135708
521 Ga0207711_10361658
522 Ga0207711_10739252
523 Ga0207689_10048730
524 Ga0207689_10604183
525 Ga0207679_10186873
526 Ga0207667_10118628
527 Ga0207651_10044035
528 Ga0207668_10117374
529 Ga0207640_10102634
530 Ga0207658_10395446
531 Ga0207677_10279929
532 Ga0207703_10111619
533 Ga0207639_10387200
534 Ga0207678_10008735
535 Ga0207678_10025808
536 Ga0207678_10089890
537 Ga0207678_10187369
538 Ga0207678_10470917
539 Ga0207708_10322574
540 Ga0207702_10081241
541 Ga0207641_10347037
542 Ga0207648_10371493
543 Ga0207676_10030008
544 Ga0207676_10127769
545 Ga0207674_10062769
546 Ga0207674_10251680
547 Ga0207675_100092771
548 Ga0207675_100634386
549 Ga0207683_10036682
550 Ga0207683_10067542
551 Ga0268266_10009357
552 Ga0268266_10025034
553 Ga0268266_10071955
554 Ga0268266_10219803
555 Ga0268264_10316438
556 Ga0265337_1003669
557 Ga0265334_10059466
558 Ga0307508_10345750
559 Ga0307413_10017828
560 Ga0307409_100322500
561 Ga0307416_100433043
562 Ga0307416_100628827
563 Ga0307411_10440390
564 Ga0307415_100083826
565 Ga0307415_100414231
566 Ga0307510_10000403
567 Ga0373939_0086263
568 Ga0436365_0651557
569 Ga0436363_0920127
570 Ga0436362_1015402
571 Ga0466968_0055391
572 Ga0495617_105766
573 Ga0495603_0014558
574 Ga0495590_0101489
575 Ga0495638_0015515
576 Ga0495638_0134533
577 Ga0495650_0081588
578 Ga0495584_0047230
579 Ga0495594_0154941
580 Ga0495596_0017957
581 Ga0495606_0001391
582 Ga0495616_0146888
583 Ga0495642_0179705
584 Ga0495622_0060552
585 Ga0495622_0187108
586 Ga0495656_0019549
587 Ga0495656_0139660
588 Ga0495668_0126430
589 Ga0495611_0102118
590 Ga0495659_0011124
591 Ga0495670_0182622
592 Ga0495671_0091998
593 Ga0495649_0167604
594 Ga0495604_0502898
595 Ga0496101_0117848
596 Ga0496102_0229586
597 Ga0496103_0142184
598 Ga0496103_0425675
599 Ga0496104_0281771
600 Ga0496104_0327511
601 Ga0496104_0653809
602 Ga0496105_0316653
603 Ga0496106_0111421
604 Ga0496106_0485745
605 Ga0496106_0659064
606 Ga0496107_0216229
607 Ga0496107_0377361
608 Ga0496108_0028306
609 Ga0496108_0117561
610 Ga0496108_0449067
611 Ga0496109_0001683
612 Ga0496109_0018928
613 Ga0496109_0097109
614 Ga0496109_0371545
615 Ga0496110_0004523
616 Ga0496110_0049809
617 Ga0496110_0050922
618 Ga0496110_0155353
619 Ga0496111_0006252
620 Ga0496111_0048434
621 Ga0496111_0228427
622 Ga0496112_0050147
623 Ga0496112_0120084
624 Ga0496112_0236246
625 Ga0496113_0055521
626 Ga0496113_0210672
627 Ga0496113_0237656
628 Ga0496113_0525561
629 Ga0496115_0071137
630 Ga0496115_0109367
631 Ga0496115_0570898
632 Ga0496121_0117031
633 Ga0496121_0145584
634 Ga0496121_0175400
635 Ga0496123_0112125
636 Ga0496124_0206880
637 Ga0496124_0323632
638 Ga0496125_0172319
639 Ga0496126_0115739
640 Ga0501031_0032063
641 Ga0501031_0157656
642 Ga0501032_0002916
643 Ga0501032_0040020
644 Ga0501032_0115358
645 Ga0501033_0003392
646 Ga0501033_0017890
647 Ga0501033_0032086
648 Ga0501033_0071970
649 Ga0501033_0098558
650 Ga0501034_0145051
651 Ga0501034_0607491
652 Ga0501036_0085442
653 Ga0501036_0357375
654 Ga0501036_0421490
655 Ga0501037_0000053
656 Ga0501037_0190601
657 Ga0501037_0211402
658 Ga0501041_0598363
659 Ga0501043_0000008
660 Ga0501043_0108157
661 Ga0501043_0266185
662 Ga0501046_0160693
663 Ga0501046_0186618
664 Ga0501047_0064340
665 Ga0501047_0150199
666 Ga0501047_0247642
667 Ga0501048_0187026
668 Ga0501067_0271626
669 Ga0501068_0023672
670 Ga0501069_0000004
671 Ga0501069_0024264
672 Ga0501069_0222066
673 Ga0501070_0000434
674 Ga0501070_0000638
675 Ga0501070_0068544
676 Ga0501070_0091427
677 Ga0501070_0158030
678 Ga0501070_0201494
679 Ga0501071_0126186
680 Ga0501071_0128009
681 Ga0501071_0542509
682 Ga0501073_0032937
683 Ga0501073_0059588
684 Ga0501073_0078235
685 Ga0501073_0105313
686 Ga0501074_0007861
687 Ga0501074_0084609
688 Ga0501074_0121510
689 Ga0501074_0378810
690 Ga0501076_0079827
691 Ga0501080_0002111
692 Ga0501080_0015885
693 Ga0501080_0081204
694 Ga0501080_0846764
695 Ga0501083_0000254
696 Ga0501083_0406410
697 Ga0501035_0000011
698 Ga0501035_0002769
699 Ga0501035_0015391
700 Ga0501035_0025132
701 Ga0501044_0000041
702 Ga0501044_0025434
703 Ga0501044_0055593
704 Ga0501044_0282397
705 Ga0501044_0384455
706 Ga0501044_0480939
707 nmdc:mga03683_217052_c1
708 nmdc:mga03683_282379_c1
709 nmdc:mga03683_914_c1
710 nmdc:mga03n38_119956_c1
711 nmdc:mga03n38_59460_c1
712 nmdc:mga03n38_94645_c1
713 nmdc:mga00v17_129439_c1
714 nmdc:mga00v17_749797_c1
715 nmdc:mga00v17_94271_c1
716 nmdc:mga0yw44_113309_c1
717 nmdc:mga0yw44_20086_c1
718 nmdc:mga0yw44_252524_c1
719 nmdc:mga0yw44_38779_c1
720 nmdc:mga0yw44_67312_c1
721 nmdc:mga0k408_105357_c1
722 nmdc:mga06z11_102507_c1
723 nmdc:mga06z11_118748_c1
724 nmdc:mga06z11_5599_c1
725 nmdc:mga06z11_6164_c1
726 nmdc:mga06z11_68870_c1
727 nmdc:mga07m45_11909_c1
728 nmdc:mga07m45_314225_c1
729 nmdc:mga06r32_66691_c1
730 nmdc:mga0n895_725076_c1
731 nmdc:mga0a205_736066_c1
732 nmdc:mga0sz30_123975_c1
733 nmdc:mga0sz30_132256_c1
734 nmdc:mga0sz30_187_c1
735 Ga0500643_032486
736 Ga0500644_0221901
737 Ga0500651_0034307
738 Ga0500566_0218899
739 Ga0500641_0009750
740 Ga0500641_0029679
741 Ga0500562_027474
742 Ga0500592_027948
743 Ga0500577_0197452
744 Ga0500589_058350
745 Ga0500616_0041537
746 Ga0500634_0088032
747 2723848519
748 2793077607
749 2874606311
750 2876818091
751 2879113245
752 2889036909
753 2917558374
754 2922363684
755 2937848517
756 8056676522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03006

HlyIII

Haemolysin-III related

49

241

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yxf-assembly1.cif.gz_A cryogenic human adiponectin receptor 2 (adipor2) with gd-do3 ligand determined by serial crystallography (ssx) using crystaldirect 0.7694 13 226
6yxf-assembly1.cif.gz_A cryogenic human adiponectin receptor 2 (adipor2) with gd-do3 ligand determined by serial crystallography (ssx) using crystaldirect 0.7181 13 226
7epf-assembly1.cif.gz_A crystal structure of mglu2 bound to nam597 0.6983 26 117
8oyx-assembly2.cif.gz_B de novo designed soluble gpcr-like fold glf_18 0.6982 28 225
7mtq-assembly1.cif.gz_A cryoem structure of full-length mglu2 in inactive-state bound to antagonist ly341495 0.6944 24 228
ID Description Score Start End Superfamily
af_P67153_11_209_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9539 25 219 1.20.1070.10
af_Q86A98_25_265_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9323 26 219 1.20.1070.10
af_P67153_11_209_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9308 25 219 1.20.1070.10
af_Q2FW82_22_220_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9306 26 219 1.20.1070.10
af_P9WFN7_30_234_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9132 34 219 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2W6YLB4-F1-model_v4 deleted 0.9844 25 223
AF-A0A7Y4M6B8-F1-model_v4 Hemolysin III family protein 0.982 67 230 GO:0016020
GO:0046872
AF-A0A0Q5WFC5-F1-model_v4 DNA-binding protein 0.9795 21 226 GO:0003677
GO:0016020
GO:0046872
AF-A0A840LW18-F1-model_v4 deleted 0.9793 19 226
AF-A0A0N1ALE1-F1-model_v4 DNA-binding protein 0.978 20 230 GO:0003677
GO:0016020
GO:0046872

Map