F427924

General Info

Members Datasets Scaffolds Average Seq Length
378 167 757 297

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10095343|Ga0070692_100953432
Length 297
Sequence MSGRTSWADGFIAVDWGTTNRRAYLMGSDGKCSAEFDDGRGILSVNRGEFEGAIAEIRERLGDHPLLLAGMVGSNRGWVEAPYVPCPAGIDDLVHGLVRIGDDVVIVPGVSLSNGRCDVMRGEEVQLAGAVQSGEIPPDCLVCHPGTHNKWVEVKRGRIASFRTVMTGEMFSMLKHRSILSDLLSGRAKPGEAFRAGVRKGLSGGALTAELFEVRASFLLGRLEQSDGASLVSGILIGEDVREGLGSKRGSSLIVMGSPNLTALYTAALEVAGVESEQKDGETAFIAGAKSIVERLK

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
149 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
150 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
151 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
152 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
153 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
154 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
155 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
160 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
161 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
162 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
163 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
164 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
165 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 3.7
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10095343 3300005345 Unclassified 1623
2 JGI24740J21852_10001942 3300001979 Bacteria 9463
3 JGI24739J22299_10000129 3300001989 Bacteria 23885
4 JGI24737J22298_10001447 3300001990 Bacteria 8469
5 JGI24737J22298_10063072 3300001990 Bacteria 1113
6 JGI24738J21930_10001003 3300002075 Bacteria 8082
7 rootH1_10012391 3300003316 Bacteria 3331
8 rootH1_10091511 3300003316 Bacteria 2062
9 rootH1_10091511 3300003323 Bacteria 2893
10 Ga0070658_10007918 3300005327 Bacteria 8556
11 Ga0070683_100536787 3300005329 Bacteria 1118
12 Ga0070690_100131427 3300005330 Bacteria 1691
13 Ga0070670_100000265 3300005331 Bacteria 46560
14 Ga0070670_100014114 3300005331 Bacteria 6852
15 Ga0068869_100000331 3300005334 Bacteria 25170
16 Ga0068869_100291936 3300005334 Bacteria 1314
17 Ga0070666_10000924 3300005335 Bacteria 17819
18 Ga0070666_10024131 3300005335 Bacteria 3960
19 Ga0070682_100169901 3300005337 Bacteria 1514
20 Ga0068868_100000156 3300005338 Bacteria 44526
21 Ga0068868_100012563 3300005338 Bacteria 6193
22 Ga0068868_100041958 3300005338 Bacteria 3567
23 Ga0070660_100011417 3300005339 Bacteria 6308
24 Ga0070660_100015863 3300005339 Bacteria 5453
25 Ga0070660_100081053 3300005339 Bacteria 2547
26 Ga0070660_100103236 3300005339 Bacteria 2261
27 Ga0070660_100168756 3300005339 Bacteria 1767
28 Ga0070661_100035368 3300005344 Bacteria 3627
29 Ga0070661_100177191 3300005344 Bacteria 1621
30 Ga0070692_10004588 3300005345 Bacteria 5786
31 Ga0070668_100007660 3300005347 Bacteria 8014
32 Ga0070668_100214905 3300005347 Bacteria 1583
33 Ga0070669_100000383 3300005353 Bacteria 33931
34 Ga0070669_100040262 3300005353 Bacteria 3397
35 Ga0070675_100025854 3300005354 Bacteria 4707
36 Ga0070675_100201231 3300005354 Bacteria 1729
37 Ga0070671_100008552 3300005355 Bacteria 8206
38 Ga0070671_100031062 3300005355 Bacteria 4411
39 Ga0070671_100160172 3300005355 Bacteria 1902
40 Ga0070674_100072960 3300005356 Bacteria 2432
41 Ga0070674_100076490 3300005356 Bacteria 2380
42 Ga0070673_100000249 3300005364 Bacteria 27281
43 Ga0070673_100016074 3300005364 Bacteria 5281
44 Ga0070673_100017746 3300005364 Bacteria 5070
45 Ga0070673_100172043 3300005364 Bacteria 1849
46 Ga0070673_100337447 3300005364 Bacteria 1335
47 Ga0070659_100000814 3300005366 Bacteria 22773
48 Ga0070659_100001062 3300005366 Bacteria 20090
49 Ga0070659_100028049 3300005366 Bacteria 4344
50 Ga0070659_100060457 3300005366 Bacteria 2992
51 Ga0070659_100224972 3300005366 Bacteria 1549
52 Ga0070659_100274245 3300005366 Bacteria 1402
53 Ga0070667_100001760 3300005367 Bacteria 19301
54 Ga0070667_100003528 3300005367 Bacteria 13330
55 Ga0070667_100006388 3300005367 Bacteria 9794
56 Ga0070667_100043255 3300005367 Bacteria 3780
57 Ga0070714_100019248 3300005435 Bacteria 5556
58 Ga0070663_100006862 3300005455 Bacteria 6890
59 Ga0070663_100061799 3300005455 Bacteria 2698
60 Ga0070663_100132580 3300005455 Bacteria 1894
61 Ga0070678_100002527 3300005456 Bacteria 10025
62 Ga0070678_100275684 3300005456 Bacteria 1420
63 Ga0070662_100001186 3300005457 Bacteria 15980
64 Ga0070662_100001575 3300005457 Bacteria 14101
65 Ga0070662_100030731 3300005457 Bacteria 3762
66 Ga0070662_100125975 3300005457 Bacteria 1969
67 Ga0068867_100007188 3300005459 Bacteria 7869
68 Ga0070685_10033313 3300005466 Bacteria 2893
69 Ga0068853_100001793 3300005539 Bacteria 15788
70 Ga0068853_100199212 3300005539 Bacteria 1822
71 Ga0070672_100004771 3300005543 Bacteria 8896
72 Ga0070672_100006526 3300005543 Bacteria 7843
73 Ga0070672_100038689 3300005543 Bacteria 3647
74 Ga0070672_100362733 3300005543 Bacteria 1237
75 Ga0070695_100090071 3300005545 Bacteria 2046
76 Ga0070696_100006403 3300005546 Bacteria 7881
77 Ga0070665_100014720 3300005548 Bacteria 7849
78 Ga0070665_100016127 3300005548 Bacteria 7497
79 Ga0070665_100201850 3300005548 Bacteria 1989
80 Ga0070665_100391156 3300005548 Bacteria 1398
81 Ga0068855_100035645 3300005563 Bacteria 5926
82 Ga0068855_100106172 3300005563 Bacteria 3228
83 Ga0070664_100002185 3300005564 Bacteria 15712
84 Ga0070664_100003024 3300005564 Bacteria 13598
85 Ga0070664_100031827 3300005564 Bacteria 4410
86 Ga0070664_100052331 3300005564 Bacteria 3458
87 Ga0070664_100079535 3300005564 Bacteria 2822
88 Ga0070664_100257545 3300005564 Bacteria 1569
89 Ga0068857_100000282 3300005577 Bacteria 34844
90 Ga0068854_100001188 3300005578 Bacteria 15628
91 Ga0068854_100109581 3300005578 Bacteria 2081
92 Ga0068852_100005039 3300005616 Bacteria 9392
93 Ga0068852_100010367 3300005616 Bacteria 6961
94 Ga0068852_100033435 3300005616 Bacteria 4269
95 Ga0068852_100476982 3300005616 Bacteria 1239
96 Ga0068859_100000778 3300005617 Bacteria 32222
97 Ga0068859_100022894 3300005617 Bacteria 6264
98 Ga0068859_100114018 3300005617 Bacteria 2766
99 Ga0068859_100345590 3300005617 Bacteria 1582
100 Ga0068864_100000291 3300005618 Bacteria 44522
101 Ga0068864_100001458 3300005618 Bacteria 19498
102 Ga0068864_100006305 3300005618 Bacteria 9731
103 Ga0068864_100006905 3300005618 Bacteria 9309
104 Ga0068864_100073582 3300005618 Bacteria 2979
105 Ga0068866_10177184 3300005718 Bacteria 1256
106 Ga0068861_100055034 3300005719 Bacteria 3033
107 Ga0068861_100072766 3300005719 Bacteria 2668
108 Ga0068851_10003637 3300005834 Bacteria 6881
109 Ga0068863_100000816 3300005841 Bacteria 31200
110 Ga0068863_100000921 3300005841 Bacteria 29492
111 Ga0068863_100003770 3300005841 Bacteria 14990
112 Ga0068863_100073917 3300005841 Bacteria 3225
113 Ga0068858_100002150 3300005842 Bacteria 19979
114 Ga0068858_100005521 3300005842 Bacteria 12381
115 Ga0068858_100019092 3300005842 Bacteria 6412
116 Ga0068858_100044690 3300005842 Bacteria 4105
117 Ga0068858_100066580 3300005842 Bacteria 3335
118 Ga0068860_100001926 3300005843 Bacteria 21977
119 Ga0068860_100006472 3300005843 Bacteria 11762
120 Ga0068860_100169361 3300005843 Bacteria 2109
121 Ga0068860_100292779 3300005843 Bacteria 1593
122 Ga0068862_100014186 3300005844 Bacteria 6607
123 Ga0068862_100016468 3300005844 Bacteria 6153
124 Ga0068862_100059859 3300005844 Bacteria 3271
125 Ga0097621_100128876 3300006237 Bacteria 2151
126 Ga0068871_100083382 3300006358 Bacteria 2651
127 Ga0068871_100140425 3300006358 Bacteria 2054
128 Ga0075434_100245377 3300006871 Bacteria 1811
129 Ga0068865_100003247 3300006881 Bacteria 9738
130 Ga0097620_100000778 3300006931 Bacteria 32222
131 Ga0097620_100022895 3300006931 Bacteria 6264
132 Ga0097620_100114022 3300006931 Bacteria 2766
133 Ga0097620_100345590 3300006931 Bacteria 1582
134 Ga0105240_10363334 3300009093 Bacteria 1639
135 Ga0105245_10000326 3300009098 Bacteria 44899
136 Ga0105245_10024639 3300009098 Bacteria 5285
137 Ga0105241_10112882 3300009174 Bacteria 2178
138 Ga0105242_10023363 3300009176 Bacteria 4871
139 Ga0105248_10000123 3300009177 Bacteria 89301
140 Ga0105248_10000159 3300009177 Bacteria 78504
141 Ga0105248_10028455 3300009177 Bacteria 6225
142 Ga0105248_10041228 3300009177 Bacteria 5175
143 Ga0105249_10044637 3300009553 Bacteria 4030
144 Ga0105249_10117060 3300009553 Bacteria 2527
145 Ga0105249_10598487 3300009553 Bacteria 1157
146 Ga0105239_10110933 3300010375 Bacteria 3040
147 Ga0105246_10027780 3300011119 Bacteria 3712
148 Ga0105246_10037164 3300011119 Bacteria 3267
149 Ga0105246_10151161 3300011119 Unclassified 1757
150 Ga0157373_10016885 3300013100 Bacteria 5323
151 Ga0157373_10044155 3300013100 Bacteria 3182
152 Ga0157373_10063783 3300013100 Bacteria 2608
153 Ga0157371_10101186 3300013102 Bacteria 2044
154 Ga0157371_10112589 3300013102 Bacteria 1932
155 Ga0157371_10155519 3300013102 Bacteria 1632
156 Ga0157370_10040402 3300013104 Bacteria 4504
157 Ga0157370_10141272 3300013104 Bacteria 2243
158 Ga0157369_10001821 3300013105 Bacteria 25788
159 Ga0157374_10140292 3300013296 Bacteria 2346
160 Ga0157378_10008535 3300013297 Bacteria 8917
161 Ga0157378_10236782 3300013297 Bacteria 1742
162 Ga0157378_10577494 3300013297 Bacteria 1133
163 Ga0163162_10000839 3300013306 Bacteria 28555
164 Ga0163162_10116320 3300013306 Bacteria 2774
165 Ga0163162_10124191 3300013306 Bacteria 2687
166 Ga0163162_10492875 3300013306 Bacteria 1356
167 Ga0157375_10003764 3300013308 Bacteria 13151
168 Ga0157375_10042592 3300013308 Bacteria 4395
169 Ga0157375_10118328 3300013308 Bacteria 2756
170 Ga0157375_10251517 3300013308 Bacteria 1928
171 Ga0163163_10002107 3300014325 Bacteria 16792
172 Ga0163163_10006126 3300014325 Bacteria 10476
173 Ga0182008_10089327 3300014497 Bacteria 1518
174 Ga0157377_10011474 3300014745 Bacteria 4424
175 Ga0157379_10218636 3300014968 Bacteria 1726
176 Ga0207697_10000584 3300025315 Bacteria 20797
177 Ga0207656_10012882 3300025321 Bacteria 3186
178 Ga0207710_10174683 3300025900 Bacteria 1051
179 Ga0207688_10004411 3300025901 Bacteria 7657
180 Ga0207688_10007152 3300025901 Bacteria 6069
181 Ga0207688_10089586 3300025901 Bacteria 1765
182 Ga0207647_10000575 3300025904 Bacteria 28658
183 Ga0207647_10002145 3300025904 Bacteria 15075
184 Ga0207645_10001233 3300025907 Bacteria 21061
185 Ga0207645_10016623 3300025907 Bacteria 4867
186 Ga0207705_10007767 3300025909 Bacteria 7878
187 Ga0207705_10011481 3300025909 Bacteria 6406
188 Ga0207705_10016829 3300025909 Bacteria 5236
189 Ga0207705_10090152 3300025909 Bacteria 2244
190 Ga0207654_10094237 3300025911 Bacteria 1832
191 Ga0207657_10003334 3300025919 Bacteria 17170
192 Ga0207657_10009316 3300025919 Bacteria 9888
193 Ga0207657_10018947 3300025919 Bacteria 6551
194 Ga0207657_10024861 3300025919 Bacteria 5536
195 Ga0207657_10115198 3300025919 Bacteria 2216
196 Ga0207657_10324496 3300025919 Bacteria 1217
197 Ga0207649_10064128 3300025920 Bacteria 2322
198 Ga0207649_10070426 3300025920 Bacteria 2230
199 Ga0207649_10209957 3300025920 Bacteria 1380
200 Ga0207681_10001333 3300025923 Bacteria 15917
201 Ga0207681_10071445 3300025923 Bacteria 2421
202 Ga0207681_10074785 3300025923 Bacteria 2374
203 Ga0207681_10111637 3300025923 Bacteria 1989
204 Ga0207694_10223907 3300025924 Bacteria 1535
205 Ga0207650_10007278 3300025925 Bacteria 7536
206 Ga0207650_10471248 3300025925 Bacteria 1047
207 Ga0207659_10150691 3300025926 Bacteria 1816
208 Ga0207659_10384056 3300025926 Bacteria 1171
209 Ga0207687_10007615 3300025927 Bacteria 7120
210 Ga0207687_10138272 3300025927 Bacteria 1845
211 Ga0207664_10077268 3300025929 Bacteria 2697
212 Ga0207644_10004200 3300025931 Bacteria 9349
213 Ga0207644_10020085 3300025931 Bacteria 4538
214 Ga0207644_10125652 3300025931 Bacteria 1957
215 Ga0207644_10138404 3300025931 Bacteria 1872
216 Ga0207690_10003206 3300025932 Bacteria 9816
217 Ga0207690_10026340 3300025932 Bacteria 3660
218 Ga0207690_10054436 3300025932 Bacteria 2690
219 Ga0207690_10192450 3300025932 Bacteria 1543
220 Ga0207690_10306108 3300025932 Bacteria 1245
221 Ga0207706_10000171 3300025933 Bacteria 72122
222 Ga0207706_10005076 3300025933 Bacteria 12297
223 Ga0207706_10037286 3300025933 Bacteria 4317
224 Ga0207706_10099531 3300025933 Bacteria 2558
225 Ga0207669_10052650 3300025937 Bacteria 2447
226 Ga0207704_10006692 3300025938 Bacteria 5398
227 Ga0207691_10007857 3300025940 Bacteria 10275
228 Ga0207691_10013013 3300025940 Bacteria 7967
229 Ga0207691_10072963 3300025940 Bacteria 3095
230 Ga0207691_10247648 3300025940 Bacteria 1539
231 Ga0207711_10000100 3300025941 Bacteria 91024
232 Ga0207711_10002836 3300025941 Bacteria 15230
233 Ga0207711_10005966 3300025941 Bacteria 10298
234 Ga0207711_10019246 3300025941 Bacteria 5684
235 Ga0207711_10039426 3300025941 Bacteria 4018
236 Ga0207711_10155599 3300025941 Bacteria 2066
237 Ga0207689_10000092 3300025942 Bacteria 73254
238 Ga0207689_10140378 3300025942 Bacteria 1990
239 Ga0207679_10002034 3300025945 Bacteria 12542
240 Ga0207679_10038823 3300025945 Bacteria 3396
241 Ga0207679_10052960 3300025945 Bacteria 2979
242 Ga0207679_10164693 3300025945 Bacteria 1819
243 Ga0207679_10194197 3300025945 Bacteria 1690
244 Ga0207679_10287068 3300025945 Bacteria 1413
245 Ga0207667_10053034 3300025949 Bacteria 4268
246 Ga0207651_10000176 3300025960 Bacteria 27858
247 Ga0207651_10024847 3300025960 Bacteria 3713
248 Ga0207651_10073858 3300025960 Bacteria 2426
249 Ga0207712_10000269 3300025961 Bacteria 50416
250 Ga0207712_10021247 3300025961 Bacteria 4260
251 Ga0207712_10059127 3300025961 Bacteria 2712
252 Ga0207668_10000080 3300025972 Bacteria 72198
253 Ga0207668_10054143 3300025972 Bacteria 2784
254 Ga0207668_10152046 3300025972 Bacteria 1793
255 Ga0207640_10000922 3300025981 Bacteria 16485
256 Ga0207640_10037390 3300025981 Bacteria 3054
257 Ga0207658_10003101 3300025986 Bacteria 11895
258 Ga0207658_10005467 3300025986 Bacteria 8714
259 Ga0207658_10006798 3300025986 Bacteria 7792
260 Ga0207658_10024502 3300025986 Bacteria 4223
261 Ga0207658_10422571 3300025986 Unclassified 1175
262 Ga0207677_10009881 3300026023 Bacteria 5380
263 Ga0207677_10033134 3300026023 Bacteria 3329
264 Ga0207703_10009105 3300026035 Bacteria 7817
265 Ga0207703_10019609 3300026035 Bacteria 5285
266 Ga0207703_10030942 3300026035 Bacteria 4231
267 Ga0207703_10066349 3300026035 Bacteria 2969
268 Ga0207639_10003016 3300026041 Bacteria 11334
269 Ga0207639_10064641 3300026041 Bacteria 2837
270 Ga0207639_10069797 3300026041 Bacteria 2742
271 Ga0207678_10012673 3300026067 Bacteria 7409
272 Ga0207678_10015898 3300026067 Bacteria 6611
273 Ga0207678_10026121 3300026067 Bacteria 5095
274 Ga0207678_10056232 3300026067 Bacteria 3387
275 Ga0207702_10135236 3300026078 Bacteria 2223
276 Ga0207641_10000221 3300026088 Bacteria 74390
277 Ga0207641_10005042 3300026088 Bacteria 11314
278 Ga0207641_10098381 3300026088 Bacteria 2572
279 Ga0207641_10103810 3300026088 Bacteria 2508
280 Ga0207648_10008297 3300026089 Bacteria 10086
281 Ga0207648_10008887 3300026089 Bacteria 9672
282 Ga0207676_10002026 3300026095 Bacteria 14724
283 Ga0207676_10003162 3300026095 Bacteria 11751
284 Ga0207676_10004385 3300026095 Bacteria 9979
285 Ga0207676_10008426 3300026095 Bacteria 7329
286 Ga0207674_10002023 3300026116 Bacteria 25726
287 Ga0207674_10018937 3300026116 Bacteria 7464
288 Ga0207674_10053575 3300026116 Bacteria 4111
289 Ga0207675_100078086 3300026118 Bacteria 3101
290 Ga0207675_100116048 3300026118 Bacteria 2530
291 Ga0207675_100314833 3300026118 Bacteria 1527
292 Ga0207683_10013330 3300026121 Bacteria 7009
293 Ga0207683_10145051 3300026121 Bacteria 2140
294 Ga0207698_10100364 3300026142 Bacteria 2397
295 Ga0207698_10169334 3300026142 Bacteria 1921
296 Ga0207698_10438677 3300026142 Bacteria 1258
297 Ga0268266_10040393 3300028379 Bacteria 3976
298 Ga0268266_10047306 3300028379 Bacteria 3685
299 Ga0268266_10142791 3300028379 Bacteria 2150
300 Ga0268266_10221293 3300028379 Bacteria 1740
301 Ga0268265_10057547 3300028380 Bacteria 2963
302 Ga0268265_10124891 3300028380 Bacteria 2127
303 Ga0268265_10530191 3300028380 Bacteria 1114
304 Ga0268264_10000567 3300028381 Bacteria 45270
305 Ga0268264_10001272 3300028381 Bacteria 23913
306 Ga0268264_10005259 3300028381 Bacteria 10956
307 Ga0268264_10049208 3300028381 Bacteria 3506
308 Ga0268264_10073966 3300028381 Bacteria 2893
309 Ga0373935_0002341 3300035692 Bacteria 10815
310 Ga0395900_0006151 3300037418 Bacteria 12530
311 Ga0395900_0008912 3300037418 Bacteria 10293
312 Ga0395900_0040833 3300037418 Bacteria 4782
313 Ga0395900_0060690 3300037418 Bacteria 3890
314 Ga0395900_0222758 3300037418 Bacteria 1900
315 Ga0395905_0000104 3300037471 Bacteria 141965
316 Ga0395905_0011304 3300037471 Bacteria 8632
317 Ga0395905_0028956 3300037471 Bacteria 5220
318 Ga0395905_0044081 3300037471 Bacteria 4185
319 Ga0395905_0081425 3300037471 Bacteria 3034
320 Ga0395905_0135624 3300037471 Bacteria 2315
321 Ga0395905_0160153 3300037471 Bacteria 2115
322 Ga0395905_0239731 3300037471 Bacteria 1695
323 Ga0395905_0306238 3300037471 Bacteria 1477
324 Ga0395901_0100974 3300038443 Bacteria 3027
325 Ga0395901_0111248 3300038443 Bacteria 2876
326 Ga0395901_0219229 3300038443 Bacteria 1989
327 Ga0395901_0221920 3300038443 Bacteria 1975
328 Ga0395901_0224454 3300038443 Bacteria 1963
329 Ga0395901_0311024 3300038443 Bacteria 1631
330 Ga0436365_0788426 3300039437 Bacteria 5946
331 Ga0436363_0219213 3300039450 Bacteria 1426
332 Ga0466972_0041387 3300044658 Bacteria 2243
333 Ga0466966_0142801 3300044684 Bacteria 1462
334 Ga0466961_0007560 3300044693 Bacteria 6917
335 Ga0466961_0064560 3300044693 Bacteria 2327
336 Ga0466963_0009670 3300044694 Bacteria 5813
337 Ga0466963_0082993 3300044694 Bacteria 2173
338 Ga0466960_0025187 3300044901 Bacteria 2690
339 Ga0466959_0079068 3300045049 Bacteria 2371
340 Ga0466958_0061652 3300045836 Bacteria 2285
341 Ga0466967_0047831 3300045976 Bacteria 3731
342 Ga0466967_0079527 3300045976 Bacteria 2956
343 Ga0495621_0071459 3300046539 Unclassified 1279
344 Ga0495668_0021512 3300046616 Bacteria 3697
345 Ga0495669_0011202 3300046684 Bacteria 3804
346 Ga0496100_0064545 3300048903 Bacteria 2423
347 Ga0496101_0085317 3300048904 Bacteria 2340
348 Ga0496107_0011089 3300048910 Bacteria 6270
349 Ga0496108_0013082 3300048911 Bacteria 6763
350 Ga0496109_0229489 3300048912 Bacteria 1746
351 Ga0496109_0242773 3300048912 Bacteria 1695
352 Ga0496109_0313811 3300048912 Bacteria 1479
353 Ga0496109_0331430 3300048912 Bacteria 1437
354 Ga0496111_0029000 3300048914 Bacteria 3926
355 Ga0496112_0018585 3300048915 Bacteria 6549
356 Ga0496112_0116106 3300048915 Bacteria 2647
357 Ga0496114_0250316 3300048917 Bacteria 1559
358 Ga0496115_0000691 3300048918 Bacteria 25050
359 Ga0496115_0063398 3300048918 Bacteria 2982
360 Ga0501292_000035 3300049515 Bacteria 33554
361 Ga0501294_000145 3300049517 Bacteria 8361
362 Ga0501206_001668 3300049653 Bacteria 2780
363 Ga0501222_001052 3300049662 Bacteria 3915
364 Ga0501224_000065 3300049664 Bacteria 11865
365 Ga0501227_002342 3300049665 Bacteria 4196
366 Ga0501233_000527 3300049668 Bacteria 6145
367 Ga0501257_032043 3300049686 Bacteria 1270
368 Ga0501259_000065 3300049688 Bacteria 14592
369 Ga0501261_000039 3300049690 Bacteria 25955
370 Ga0501225_0000627 3300049705 Bacteria 11003
371 Ga0501245_008034 3300049708 Bacteria 1498
372 Ga0501279_000033 3300049775 Bacteria 33688
373 Ga0501280_000826 3300049776 Bacteria 6705
374 Ga0501281_00024 3300049777 Bacteria 18869
375 Ga0501282_000686 3300049778 Bacteria 3884
376 Ga0501283_000175 3300049779 Bacteria 8357
377 Ga0501284_00438 3300050005 Bacteria 2136
378 nmdc:mga0n895_179327_c1 3300050512 Bacteria 2149
379 Ga0500658_0000173 3300053134 Bacteria 30720
380 Ga0070692_10095343
381 JGI24740J21852_10001942
382 JGI24739J22299_10000129
383 JGI24737J22298_10001447
384 JGI24737J22298_10063072
385 JGI24738J21930_10001003
386 rootH1_10012391
387 rootH1_10091511
388 Ga0070658_10007918
389 Ga0070683_100536787
390 Ga0070690_100131427
391 Ga0070670_100000265
392 Ga0070670_100014114
393 Ga0068869_100000331
394 Ga0068869_100291936
395 Ga0070666_10000924
396 Ga0070666_10024131
397 Ga0070682_100169901
398 Ga0068868_100000156
399 Ga0068868_100012563
400 Ga0068868_100041958
401 Ga0070660_100011417
402 Ga0070660_100015863
403 Ga0070660_100081053
404 Ga0070660_100103236
405 Ga0070660_100168756
406 Ga0070661_100035368
407 Ga0070661_100177191
408 Ga0070692_10004588
409 Ga0070668_100007660
410 Ga0070668_100214905
411 Ga0070669_100000383
412 Ga0070669_100040262
413 Ga0070675_100025854
414 Ga0070675_100201231
415 Ga0070671_100008552
416 Ga0070671_100031062
417 Ga0070671_100160172
418 Ga0070674_100072960
419 Ga0070674_100076490
420 Ga0070673_100000249
421 Ga0070673_100016074
422 Ga0070673_100017746
423 Ga0070673_100172043
424 Ga0070673_100337447
425 Ga0070659_100000814
426 Ga0070659_100001062
427 Ga0070659_100028049
428 Ga0070659_100060457
429 Ga0070659_100224972
430 Ga0070659_100274245
431 Ga0070667_100001760
432 Ga0070667_100003528
433 Ga0070667_100006388
434 Ga0070667_100043255
435 Ga0070714_100019248
436 Ga0070663_100006862
437 Ga0070663_100061799
438 Ga0070663_100132580
439 Ga0070678_100002527
440 Ga0070678_100275684
441 Ga0070662_100001186
442 Ga0070662_100001575
443 Ga0070662_100030731
444 Ga0070662_100125975
445 Ga0068867_100007188
446 Ga0070685_10033313
447 Ga0068853_100001793
448 Ga0068853_100199212
449 Ga0070672_100004771
450 Ga0070672_100006526
451 Ga0070672_100038689
452 Ga0070672_100362733
453 Ga0070695_100090071
454 Ga0070696_100006403
455 Ga0070665_100014720
456 Ga0070665_100016127
457 Ga0070665_100201850
458 Ga0070665_100391156
459 Ga0068855_100035645
460 Ga0068855_100106172
461 Ga0070664_100002185
462 Ga0070664_100003024
463 Ga0070664_100031827
464 Ga0070664_100052331
465 Ga0070664_100079535
466 Ga0070664_100257545
467 Ga0068857_100000282
468 Ga0068854_100001188
469 Ga0068854_100109581
470 Ga0068852_100005039
471 Ga0068852_100010367
472 Ga0068852_100033435
473 Ga0068852_100476982
474 Ga0068859_100000778
475 Ga0068859_100022894
476 Ga0068859_100114018
477 Ga0068859_100345590
478 Ga0068864_100000291
479 Ga0068864_100001458
480 Ga0068864_100006305
481 Ga0068864_100006905
482 Ga0068864_100073582
483 Ga0068866_10177184
484 Ga0068861_100055034
485 Ga0068861_100072766
486 Ga0068851_10003637
487 Ga0068863_100000816
488 Ga0068863_100000921
489 Ga0068863_100003770
490 Ga0068863_100073917
491 Ga0068858_100002150
492 Ga0068858_100005521
493 Ga0068858_100019092
494 Ga0068858_100044690
495 Ga0068858_100066580
496 Ga0068860_100001926
497 Ga0068860_100006472
498 Ga0068860_100169361
499 Ga0068860_100292779
500 Ga0068862_100014186
501 Ga0068862_100016468
502 Ga0068862_100059859
503 Ga0097621_100128876
504 Ga0068871_100083382
505 Ga0068871_100140425
506 Ga0075434_100245377
507 Ga0068865_100003247
508 Ga0097620_100000778
509 Ga0097620_100022895
510 Ga0097620_100114022
511 Ga0097620_100345590
512 Ga0105240_10363334
513 Ga0105245_10000326
514 Ga0105245_10024639
515 Ga0105241_10112882
516 Ga0105242_10023363
517 Ga0105248_10000123
518 Ga0105248_10000159
519 Ga0105248_10028455
520 Ga0105248_10041228
521 Ga0105249_10044637
522 Ga0105249_10117060
523 Ga0105249_10598487
524 Ga0105239_10110933
525 Ga0105246_10027780
526 Ga0105246_10037164
527 Ga0105246_10151161
528 Ga0157373_10016885
529 Ga0157373_10044155
530 Ga0157373_10063783
531 Ga0157371_10101186
532 Ga0157371_10112589
533 Ga0157371_10155519
534 Ga0157370_10040402
535 Ga0157370_10141272
536 Ga0157369_10001821
537 Ga0157374_10140292
538 Ga0157378_10008535
539 Ga0157378_10236782
540 Ga0157378_10577494
541 Ga0163162_10000839
542 Ga0163162_10116320
543 Ga0163162_10124191
544 Ga0163162_10492875
545 Ga0157375_10003764
546 Ga0157375_10042592
547 Ga0157375_10118328
548 Ga0157375_10251517
549 Ga0163163_10002107
550 Ga0163163_10006126
551 Ga0182008_10089327
552 Ga0157377_10011474
553 Ga0157379_10218636
554 Ga0207697_10000584
555 Ga0207656_10012882
556 Ga0207710_10174683
557 Ga0207688_10004411
558 Ga0207688_10007152
559 Ga0207688_10089586
560 Ga0207647_10000575
561 Ga0207647_10002145
562 Ga0207645_10001233
563 Ga0207645_10016623
564 Ga0207705_10007767
565 Ga0207705_10011481
566 Ga0207705_10016829
567 Ga0207705_10090152
568 Ga0207654_10094237
569 Ga0207657_10003334
570 Ga0207657_10009316
571 Ga0207657_10018947
572 Ga0207657_10024861
573 Ga0207657_10115198
574 Ga0207657_10324496
575 Ga0207649_10064128
576 Ga0207649_10070426
577 Ga0207649_10209957
578 Ga0207681_10001333
579 Ga0207681_10071445
580 Ga0207681_10074785
581 Ga0207681_10111637
582 Ga0207694_10223907
583 Ga0207650_10007278
584 Ga0207650_10471248
585 Ga0207659_10150691
586 Ga0207659_10384056
587 Ga0207687_10007615
588 Ga0207687_10138272
589 Ga0207664_10077268
590 Ga0207644_10004200
591 Ga0207644_10020085
592 Ga0207644_10125652
593 Ga0207644_10138404
594 Ga0207690_10003206
595 Ga0207690_10026340
596 Ga0207690_10054436
597 Ga0207690_10192450
598 Ga0207690_10306108
599 Ga0207706_10000171
600 Ga0207706_10005076
601 Ga0207706_10037286
602 Ga0207706_10099531
603 Ga0207669_10052650
604 Ga0207704_10006692
605 Ga0207691_10007857
606 Ga0207691_10013013
607 Ga0207691_10072963
608 Ga0207691_10247648
609 Ga0207711_10000100
610 Ga0207711_10002836
611 Ga0207711_10005966
612 Ga0207711_10019246
613 Ga0207711_10039426
614 Ga0207711_10155599
615 Ga0207689_10000092
616 Ga0207689_10140378
617 Ga0207679_10002034
618 Ga0207679_10038823
619 Ga0207679_10052960
620 Ga0207679_10164693
621 Ga0207679_10194197
622 Ga0207679_10287068
623 Ga0207667_10053034
624 Ga0207651_10000176
625 Ga0207651_10024847
626 Ga0207651_10073858
627 Ga0207712_10000269
628 Ga0207712_10021247
629 Ga0207712_10059127
630 Ga0207668_10000080
631 Ga0207668_10054143
632 Ga0207668_10152046
633 Ga0207640_10000922
634 Ga0207640_10037390
635 Ga0207658_10003101
636 Ga0207658_10005467
637 Ga0207658_10006798
638 Ga0207658_10024502
639 Ga0207658_10422571
640 Ga0207677_10009881
641 Ga0207677_10033134
642 Ga0207703_10009105
643 Ga0207703_10019609
644 Ga0207703_10030942
645 Ga0207703_10066349
646 Ga0207639_10003016
647 Ga0207639_10064641
648 Ga0207639_10069797
649 Ga0207678_10012673
650 Ga0207678_10015898
651 Ga0207678_10026121
652 Ga0207678_10056232
653 Ga0207702_10135236
654 Ga0207641_10000221
655 Ga0207641_10005042
656 Ga0207641_10098381
657 Ga0207641_10103810
658 Ga0207648_10008297
659 Ga0207648_10008887
660 Ga0207676_10002026
661 Ga0207676_10003162
662 Ga0207676_10004385
663 Ga0207676_10008426
664 Ga0207674_10002023
665 Ga0207674_10018937
666 Ga0207674_10053575
667 Ga0207675_100078086
668 Ga0207675_100116048
669 Ga0207675_100314833
670 Ga0207683_10013330
671 Ga0207683_10145051
672 Ga0207698_10100364
673 Ga0207698_10169334
674 Ga0207698_10438677
675 Ga0268266_10040393
676 Ga0268266_10047306
677 Ga0268266_10142791
678 Ga0268266_10221293
679 Ga0268265_10057547
680 Ga0268265_10124891
681 Ga0268265_10530191
682 Ga0268264_10000567
683 Ga0268264_10001272
684 Ga0268264_10005259
685 Ga0268264_10049208
686 Ga0268264_10073966
687 Ga0373935_0002341
688 Ga0395900_0006151
689 Ga0395900_0008912
690 Ga0395900_0040833
691 Ga0395900_0060690
692 Ga0395900_0222758
693 Ga0395905_0000104
694 Ga0395905_0011304
695 Ga0395905_0028956
696 Ga0395905_0044081
697 Ga0395905_0081425
698 Ga0395905_0135624
699 Ga0395905_0160153
700 Ga0395905_0239731
701 Ga0395905_0306238
702 Ga0395901_0100974
703 Ga0395901_0111248
704 Ga0395901_0219229
705 Ga0395901_0221920
706 Ga0395901_0224454
707 Ga0395901_0311024
708 Ga0436365_0788426
709 Ga0436363_0219213
710 Ga0466972_0041387
711 Ga0466966_0142801
712 Ga0466961_0007560
713 Ga0466961_0064560
714 Ga0466963_0009670
715 Ga0466963_0082993
716 Ga0466960_0025187
717 Ga0466959_0079068
718 Ga0466958_0061652
719 Ga0466967_0047831
720 Ga0466967_0079527
721 Ga0495621_0071459
722 Ga0495668_0021512
723 Ga0495669_0011202
724 Ga0496100_0064545
725 Ga0496101_0085317
726 Ga0496107_0011089
727 Ga0496108_0013082
728 Ga0496109_0229489
729 Ga0496109_0242773
730 Ga0496109_0313811
731 Ga0496109_0331430
732 Ga0496111_0029000
733 Ga0496112_0018585
734 Ga0496112_0116106
735 Ga0496114_0250316
736 Ga0496115_0000691
737 Ga0496115_0063398
738 Ga0501292_000035
739 Ga0501294_000145
740 Ga0501206_001668
741 Ga0501222_001052
742 Ga0501224_000065
743 Ga0501227_002342
744 Ga0501233_000527
745 Ga0501257_032043
746 Ga0501259_000065
747 Ga0501261_000039
748 Ga0501225_0000627
749 Ga0501245_008034
750 Ga0501279_000033
751 Ga0501280_000826
752 Ga0501281_00024
753 Ga0501282_000686
754 Ga0501283_000175
755 Ga0501284_00438
756 nmdc:mga0n895_179327_c1
757 Ga0500658_0000173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05035

DGOK

2-keto-3-deoxy-galactonokinase

15

292

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t69-assembly1.cif.gz_A crystal structure of a putative 2-dehydro-3-deoxygalactonokinase protein from sinorhizobium meliloti 0.9293 7 291
3t69-assembly1.cif.gz_B crystal structure of a putative 2-dehydro-3-deoxygalactonokinase protein from sinorhizobium meliloti 0.9168 7 291
3t69-assembly1.cif.gz_A crystal structure of a putative 2-dehydro-3-deoxygalactonokinase protein from sinorhizobium meliloti 0.8992 7 291
3r1x-assembly1.cif.gz_A crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae 0.8955 1 290
3t69-assembly1.cif.gz_B crystal structure of a putative 2-dehydro-3-deoxygalactonokinase protein from sinorhizobium meliloti 0.8871 7 291
ID Description Score Start End Superfamily
3t69A02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;2-keto-3-deoxy-galactonokinase, C-terminal domain 0.9205 79 291 3.30.420.310
af_K7KQ43_71_310_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9094 6 35 3.60.21.10
3nuwA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;2-keto-3-deoxy-galactonokinase, C-terminal domain 0.9059 78 291 3.30.420.310
3t69B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;2-keto-3-deoxy-galactonokinase, substrate binding domain 0.8889 7 77 3.30.420.300
af_A0A1D6L052_103_280_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8888 6 34 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7H0GC52-F1-model_v4 deleted 0.9859 1 294
AF-A0A7H0GC52-F1-model_v4 deleted 0.9826 1 294
AF-A0A386C7P7-F1-model_v4 Uncharacterized protein 0.9742 163 293 GO:0008671
GO:0034194
AF-A0A2N4X091-F1-model_v4 2-oxo-3-deoxygalactonate kinase 0.9651 2 294 GO:0008671
GO:0034194
AF-A0A552UFH1-F1-model_v4 2-dehydro-3-deoxygalactonokinase 0.9643 6 294 GO:0008671
GO:0034194

Map