F427913

General Info

Members Datasets Scaffolds Average Seq Length
378 161 372 162

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10316759|Ga0070676_103167591
Length 189
Sequence MADRDITYSFVVARSRNFVIGCENKLPWNLPSDLKKFRELTIGKPVIMGRRTFDSIGRPLPRRLNIVLSRDNGIHDPSVVLVNDKIGAMEQAELQARRLGTAEVMIIGGGQIFAMFSEEVRRVYLTEVHAVVEGDAYFAEDFSGWDEKSREFHSKVGSADDFDYTFIVYGKPVQSASKPFRTRSALEAA

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
76 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
79 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.82
Nodule 0
Rhizoplane 3.97
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005838 3300001989 Bacteria 4662
2 JGI24737J22298_10000420 3300001990 Bacteria 14539
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 JGI24738J21930_10053596 3300002075 Bacteria 824
5 JGI25162J39368_1000017 3300002737 Bacteria 281385
6 JGI25162J39368_1001209 3300002737 Bacteria 15032
7 JGI25164J39214_1001290 3300002772 Bacteria 6390
8 JGI25165J46597_1000615 3300003214 Bacteria 30104
9 rootH1_10019650 3300003316 Bacteria 10648
10 rootH2_10116976 3300003320 Bacteria 2554
11 rootL2_10054465 3300003322 Bacteria 2393
12 rootH1_10017651 3300003323 Bacteria 2257
13 rootH1_10257288 3300003323 Unclassified 1228
14 Ga0065714_10068048 3300005288 Bacteria 5007
15 Ga0070658_10000018 3300005327 Bacteria 200558
16 Ga0070676_10316759 3300005328 Unclassified 1062
17 Ga0070660_100056978 3300005339 Bacteria 3025
18 Ga0070701_10336620 3300005438 Unclassified 938
19 Ga0070684_100589333 3300005535 Bacteria 1033
20 Ga0068853_100095667 3300005539 Bacteria 2619
21 Ga0068853_100146195 3300005539 Bacteria 2125
22 Ga0068855_100011186 3300005563 Bacteria 10837
23 Ga0068855_100020774 3300005563 Bacteria 7874
24 Ga0068855_100112412 3300005563 Bacteria 3125
25 Ga0068855_101469960 3300005563 Bacteria 700
26 Ga0070664_100281089 3300005564 Bacteria 1501
27 Ga0068857_100529486 3300005577 Bacteria 1108
28 Ga0068856_100007535 3300005614 Bacteria 10621
29 Ga0068856_100215803 3300005614 Bacteria 1934
30 Ga0070702_100166936 3300005615 Bacteria 1428
31 Ga0068861_100463225 3300005719 Bacteria 1138
32 Ga0075366_10000697 3300006195 Bacteria 15894
33 Ga0068871_100442193 3300006358 Bacteria 1164
34 Ga0105240_10061674 3300009093 Bacteria 4672
35 Ga0105240_10111508 3300009093 Bacteria 3309
36 Ga0105240_10247960 3300009093 Bacteria 2061
37 Ga0105240_10287803 3300009093 Bacteria 1885
38 Ga0105240_10396808 3300009093 Bacteria 1555
39 Ga0105247_10253103 3300009101 Bacteria 1205
40 Ga0105241_10033059 3300009174 Bacteria 3881
41 Ga0105237_10125101 3300009545 Bacteria 2565
42 Ga0105239_10008149 3300010375 Bacteria 11956
43 Ga0105239_10391925 3300010375 Bacteria 1571
44 Ga0157371_11252914 3300013102 Bacteria 573
45 Ga0157370_10256083 3300013104 Bacteria 1618
46 Ga0157374_10709955 3300013296 Bacteria 1019
47 Ga0157378_10055544 3300013297 Bacteria 3528
48 Ga0163162_10115804 3300013306 Bacteria 2781
49 Ga0163162_11123388 3300013306 Bacteria 891
50 Ga0163162_12999792 3300013306 Bacteria 542
51 Ga0157372_10007668 3300013307 Bacteria 11479
52 Ga0157372_10692192 3300013307 Bacteria 1186
53 Ga0157372_11210545 3300013307 Bacteria 873
54 Ga0157375_10030316 3300013308 Bacteria 5099
55 Ga0163161_10035980 3300017792 Bacteria 3545
56 Ga0209563_106718 3300025230 Bacteria 1954
57 Ga0207427_100172 3300025231 Bacteria 71550
58 Ga0209437_100024 3300025233 Bacteria 592878
59 Ga0209437_100034 3300025233 Bacteria 494007
60 Ga0209148_1022545 3300025254 Unclassified 1011
61 Ga0209129_1011640 3300025258 Bacteria 2086
62 Ga0209233_1000038 3300025261 Bacteria 548972
63 Ga0207647_10000076 3300025904 Bacteria 75824
64 Ga0207647_10065335 3300025904 Bacteria 2209
65 Ga0207647_10193738 3300025904 Bacteria 1177
66 Ga0207705_10000036 3300025909 Bacteria 200787
67 Ga0207695_10020421 3300025913 Bacteria 7588
68 Ga0207695_10185716 3300025913 Bacteria 1998
69 Ga0207695_10189204 3300025913 Bacteria 1976
70 Ga0207695_10195211 3300025913 Bacteria 1940
71 Ga0207671_10003612 3300025914 Bacteria 15280
72 Ga0207690_10028336 3300025932 Bacteria 3550
73 Ga0207667_10058775 3300025949 Bacteria 4031
74 Ga0207667_10133252 3300025949 Bacteria 2560
75 Ga0207640_10154933 3300025981 Bacteria 1688
76 Ga0207639_10131030 3300026041 Bacteria 2076
77 Ga0207639_10233769 3300026041 Bacteria 1595
78 Ga0207708_10372541 3300026075 Bacteria 1176
79 Ga0207702_10000142 3300026078 Bacteria 85850
80 Ga0207702_10010549 3300026078 Bacteria 7724
81 Ga0207702_10014587 3300026078 Bacteria 6522
82 Ga0207702_10186636 3300026078 Bacteria 1913
83 Ga0207702_10649680 3300026078 Bacteria 1037
84 Ga0207674_10142251 3300026116 Bacteria 2358
85 Ga0207674_10556413 3300026116 Bacteria 1108
86 Ga0207675_100330238 3300026118 Bacteria 1491
87 Ga0307515_10005217 3300028794 Bacteria 26401
88 Ga0307515_10011327 3300028794 Bacteria 16927
89 Ga0265320_10046667 3300031240 Bacteria 2122
90 Ga0265314_10022271 3300031711 Bacteria 4855
91 Ga0307518_10034940 3300031838 Bacteria 3649
92 Ga0307412_10362681 3300031911 Bacteria 1167
93 Ga0307507_10000052 3300033179 Bacteria 168303
94 Ga0307510_10224598 3300033180 Bacteria 1386
95 Ga0395899_0099848 3300037312 Bacteria 2096
96 Ga0395899_0395405 3300037312 Bacteria 916
97 Ga0395900_0215037 3300037418 Bacteria 1940
98 Ga0395900_0447689 3300037418 Bacteria 1248
99 Ga0395905_0000727 3300037471 Bacteria 43437
100 Ga0395901_0003544 3300038443 Bacteria 15730
101 Ga0451793_0012038 3300041452 Bacteria 1719
102 Ga0450906_043169 3300042145 Bacteria 796
103 Ga0495627_028030 3300046453 Bacteria 1802
104 Ga0495590_0000206 3300046457 Bacteria 32748
105 Ga0495590_0010257 3300046457 Bacteria 3528
106 Ga0495590_0231987 3300046457 Bacteria 684
107 Ga0495591_000236 3300046458 Bacteria 53618
108 Ga0495638_0090870 3300046460 Bacteria 1840
109 Ga0495638_0178890 3300046460 Bacteria 1212
110 Ga0495638_0251552 3300046460 Bacteria 974
111 Ga0495651_0525228 3300046462 Bacteria 755
112 Ga0495650_0000087 3300046471 Bacteria 234870
113 Ga0495650_0048049 3300046471 Bacteria 1781
114 Ga0495605_0006538 3300046474 Bacteria 6690
115 Ga0495605_0018133 3300046474 Bacteria 3779
116 Ga0495605_0193404 3300046474 Bacteria 889
117 Ga0495605_0317924 3300046474 Bacteria 656
118 Ga0495584_0000452 3300046491 Bacteria 28285
119 Ga0495584_0004915 3300046491 Bacteria 7132
120 Ga0495584_0006776 3300046491 Bacteria 5981
121 Ga0495584_0053128 3300046491 Bacteria 2039
122 Ga0495584_0223299 3300046491 Bacteria 957
123 Ga0495584_0287964 3300046491 Bacteria 834
124 Ga0495585_0000167 3300046492 Bacteria 70874
125 Ga0495585_0001480 3300046492 Bacteria 18341
126 Ga0495585_0003388 3300046492 Bacteria 10792
127 Ga0495585_0026913 3300046492 Bacteria 3284
128 Ga0495585_0035117 3300046492 Bacteria 2835
129 Ga0495585_0042463 3300046492 Bacteria 2546
130 Ga0495585_0091792 3300046492 Bacteria 1634
131 Ga0495585_0409850 3300046492 Bacteria 652
132 Ga0495594_0011002 3300046499 Bacteria 4698
133 Ga0495594_0154580 3300046499 Bacteria 1302
134 Ga0495596_0006828 3300046500 Bacteria 5207
135 Ga0495596_0006977 3300046500 Bacteria 5136
136 Ga0495596_0007249 3300046500 Bacteria 5017
137 Ga0495596_0008987 3300046500 Bacteria 4416
138 Ga0495596_0018122 3300046500 Bacteria 2905
139 Ga0495596_0018558 3300046500 Bacteria 2865
140 Ga0495596_0126858 3300046500 Bacteria 990
141 Ga0495607_0011028 3300046501 Bacteria 6036
142 Ga0495607_0037823 3300046501 Bacteria 2895
143 Ga0495607_0043245 3300046501 Bacteria 2665
144 Ga0495607_0108791 3300046501 Bacteria 1472
145 Ga0495583_0001072 3300046506 Bacteria 30556
146 Ga0495583_0009915 3300046506 Bacteria 5633
147 Ga0495583_0035270 3300046506 Bacteria 2388
148 Ga0495583_0035566 3300046506 Bacteria 2376
149 Ga0495583_0099362 3300046506 Bacteria 1243
150 Ga0495606_0000052 3300046507 Bacteria 201529
151 Ga0495606_0001127 3300046507 Bacteria 38097
152 Ga0495606_0023693 3300046507 Bacteria 4441
153 Ga0495606_0025556 3300046507 Bacteria 4226
154 Ga0495606_0045779 3300046507 Bacteria 2896
155 Ga0495606_0152545 3300046507 Bacteria 1355
156 Ga0495606_0245111 3300046507 Bacteria 997
157 Ga0495610_0008832 3300046512 Bacteria 6462
158 Ga0495610_0010358 3300046512 Bacteria 5802
159 Ga0495616_0001634 3300046513 Bacteria 15368
160 Ga0495616_0002385 3300046513 Bacteria 12503
161 Ga0495616_0090309 3300046513 Bacteria 1451
162 Ga0495616_0091160 3300046513 Bacteria 1443
163 Ga0495616_0142599 3300046513 Bacteria 1089
164 Ga0495618_0073225 3300046514 Bacteria 2181
165 Ga0495628_0606910 3300046516 Bacteria 781
166 Ga0495631_0000366 3300046518 Bacteria 31016
167 Ga0495631_0001045 3300046518 Bacteria 17172
168 Ga0495631_0017157 3300046518 Bacteria 3431
169 Ga0495631_0033431 3300046518 Bacteria 2310
170 Ga0495631_0034185 3300046518 Bacteria 2280
171 Ga0495631_0119477 3300046518 Bacteria 1133
172 Ga0495631_0120092 3300046518 Bacteria 1130
173 Ga0495631_0158155 3300046518 Bacteria 972
174 Ga0495632_0002399 3300046519 Bacteria 14292
175 Ga0495632_0011507 3300046519 Bacteria 5158
176 Ga0495632_0035337 3300046519 Bacteria 2550
177 Ga0495632_0045520 3300046519 Bacteria 2185
178 Ga0495632_0248820 3300046519 Bacteria 797
179 Ga0495637_0000891 3300046520 Bacteria 19260
180 Ga0495637_0043319 3300046520 Bacteria 1922
181 Ga0495637_0133575 3300046520 Bacteria 946
182 Ga0495643_0018075 3300046522 Bacteria 4105
183 Ga0495643_0027941 3300046522 Bacteria 3166
184 Ga0495643_0031913 3300046522 Bacteria 2928
185 Ga0495643_0090993 3300046522 Bacteria 1573
186 Ga0495643_0152028 3300046522 Bacteria 1145
187 Ga0495643_0209681 3300046522 Bacteria 930
188 Ga0495644_0009568 3300046523 Bacteria 3734
189 Ga0495644_0012345 3300046523 Bacteria 3284
190 Ga0495644_0019525 3300046523 Bacteria 2587
191 Ga0495644_0066751 3300046523 Bacteria 1351
192 Ga0495644_0209388 3300046523 Bacteria 752
193 Ga0495648_0005217 3300046524 Bacteria 10870
194 Ga0495648_0039528 3300046524 Bacteria 3001
195 Ga0495648_0076561 3300046524 Bacteria 1920
196 Ga0495648_0214904 3300046524 Bacteria 952
197 Ga0495648_0273896 3300046524 Bacteria 803
198 Ga0495666_0015613 3300046526 Bacteria 3780
199 Ga0495642_0054002 3300046528 Bacteria 1656
200 Ga0495642_0164940 3300046528 Bacteria 961
201 Ga0495642_0178967 3300046528 Bacteria 922
202 Ga0495642_0277569 3300046528 Bacteria 733
203 Ga0495652_0098993 3300046529 Bacteria 2369
204 Ga0495652_0356677 3300046529 Bacteria 1046
205 Ga0495654_0045011 3300046530 Bacteria 2178
206 Ga0495665_0018165 3300046531 Bacteria 3779
207 Ga0495665_0055380 3300046531 Bacteria 2094
208 Ga0495665_0403848 3300046531 Bacteria 693
209 Ga0495609_0030082 3300046538 Bacteria 2471
210 Ga0495609_0034536 3300046538 Bacteria 2292
211 Ga0495609_0051534 3300046538 Bacteria 1832
212 Ga0495609_0055732 3300046538 Bacteria 1753
213 Ga0495609_0084030 3300046538 Bacteria 1389
214 Ga0495609_0134102 3300046538 Bacteria 1059
215 Ga0495609_0272542 3300046538 Bacteria 693
216 Ga0495597_0000488 3300046542 Bacteria 33250
217 Ga0495597_0017841 3300046542 Bacteria 3334
218 Ga0495597_0030835 3300046542 Bacteria 2441
219 Ga0495597_0057795 3300046542 Bacteria 1696
220 Ga0495597_0118453 3300046542 Bacteria 1105
221 Ga0495597_0153018 3300046542 Bacteria 945
222 Ga0495597_0177051 3300046542 Bacteria 863
223 Ga0495597_0234334 3300046542 Bacteria 725
224 Ga0495622_0004802 3300046557 Bacteria 6261
225 Ga0495622_0044911 3300046557 Bacteria 2054
226 Ga0495622_0157200 3300046557 Bacteria 1026
227 Ga0495622_0353400 3300046557 Bacteria 636
228 Ga0495633_0000029 3300046558 Bacteria 200381
229 Ga0495633_0018059 3300046558 Bacteria 3588
230 Ga0495633_0038622 3300046558 Bacteria 2279
231 Ga0495633_0117196 3300046558 Bacteria 1234
232 Ga0495633_0415259 3300046558 Bacteria 608
233 Ga0495668_0000070 3300046616 Bacteria 174051
234 Ga0495668_0000848 3300046616 Bacteria 34526
235 Ga0495668_0234285 3300046616 Bacteria 1005
236 Ga0495611_0000960 3300046648 Bacteria 15368
237 Ga0495611_0005301 3300046648 Bacteria 5520
238 Ga0495611_0011437 3300046648 Bacteria 3762
239 Ga0495625_0000008 3300046660 Bacteria 536165
240 Ga0495625_0001373 3300046660 Bacteria 29924
241 Ga0495625_0004000 3300046660 Bacteria 14117
242 Ga0495625_0007834 3300046660 Bacteria 9206
243 Ga0495625_0011379 3300046660 Bacteria 7260
244 Ga0495625_0017052 3300046660 Bacteria 5692
245 Ga0495625_0064781 3300046660 Bacteria 2577
246 Ga0495625_0188803 3300046660 Bacteria 1366
247 Ga0495625_0372680 3300046660 Bacteria 897
248 Ga0495659_0193044 3300046664 Bacteria 833
249 Ga0495659_0351427 3300046664 Bacteria 630
250 Ga0495661_0002168 3300046665 Bacteria 15344
251 Ga0495661_0002934 3300046665 Bacteria 12885
252 Ga0495661_0005217 3300046665 Bacteria 9246
253 Ga0495661_0006865 3300046665 Bacteria 7965
254 Ga0495661_0045912 3300046665 Bacteria 2669
255 Ga0495661_0060506 3300046665 Bacteria 2249
256 Ga0495661_0064576 3300046665 Bacteria 2159
257 Ga0495661_0125883 3300046665 Bacteria 1410
258 Ga0495661_0158596 3300046665 Bacteria 1216
259 Ga0495661_0186287 3300046665 Bacteria 1096
260 Ga0495588_0047753 3300046674 Bacteria 2198
261 Ga0495588_0111712 3300046674 Bacteria 1439
262 Ga0495588_0475842 3300046674 Bacteria 655
263 Ga0495623_0165872 3300046679 Bacteria 1294
264 Ga0495658_0022983 3300046683 Bacteria 3305
265 Ga0495669_0015027 3300046684 Bacteria 3311
266 Ga0495669_0025414 3300046684 Bacteria 2583
267 Ga0495669_0098632 3300046684 Bacteria 1355
268 Ga0495670_0001696 3300046691 Bacteria 10823
269 Ga0495670_0026280 3300046691 Bacteria 2881
270 Ga0495670_0058439 3300046691 Bacteria 1936
271 Ga0495671_0008192 3300046692 Bacteria 5895
272 Ga0495671_0041598 3300046692 Bacteria 2313
273 Ga0495671_0062657 3300046692 Bacteria 1832
274 Ga0495671_0134315 3300046692 Bacteria 1206
275 Ga0495671_0185363 3300046692 Bacteria 1010
276 Ga0495671_0255803 3300046692 Bacteria 845
277 Ga0495649_0000018 3300046694 Bacteria 220586
278 Ga0495649_0001788 3300046694 Bacteria 15827
279 Ga0495649_0187511 3300046694 Bacteria 1077
280 Ga0495589_0000354 3300046794 Bacteria 35716
281 Ga0495589_0009736 3300046794 Bacteria 4992
282 Ga0495589_0022860 3300046794 Bacteria 3187
283 Ga0495600_0178230 3300046809 Bacteria 1370
284 Ga0495660_0010359 3300046810 Bacteria 5422
285 Ga0495660_0018048 3300046810 Bacteria 4057
286 Ga0495660_0034741 3300046810 Bacteria 2819
287 Ga0495660_0119963 3300046810 Bacteria 1331
288 Ga0495660_0178340 3300046810 Bacteria 1029
289 Ga0495581_0159519 3300047315 Bacteria 1318
290 Ga0495604_0080357 3300047317 Bacteria 2443
291 Ga0495672_0000258 3300047320 Bacteria 73971
292 Ga0495672_0002537 3300047320 Bacteria 16653
293 Ga0495672_0034006 3300047320 Bacteria 3154
294 Ga0495676_0000352 3300047321 Bacteria 37571
295 Ga0495683_0000446 3300047323 Bacteria 32629
296 Ga0495683_0012760 3300047323 Bacteria 4408
297 Ga0495683_0015742 3300047323 Bacteria 3927
298 Ga0495683_0030033 3300047323 Bacteria 2775
299 Ga0495683_0095419 3300047323 Bacteria 1436
300 Ga0495683_0135930 3300047323 Bacteria 1155
301 Ga0495683_0137483 3300047323 Bacteria 1147
302 Ga0495683_0285967 3300047323 Bacteria 712
303 Ga0495687_000034 3300047443 Bacteria 257321
304 Ga0495687_000081 3300047443 Bacteria 147362
305 Ga0495687_001763 3300047443 Bacteria 19137
306 Ga0495687_002017 3300047443 Bacteria 17187
307 Ga0495687_022506 3300047443 Bacteria 3024
308 Ga0495677_0000195 3300047445 Bacteria 27965
309 Ga0495677_0006543 3300047445 Bacteria 4401
310 Ga0495677_0141613 3300047445 Bacteria 923
311 Ga0495679_009181 3300047446 Bacteria 3976
312 Ga0495679_016971 3300047446 Bacteria 2617
313 Ga0495679_059030 3300047446 Bacteria 1130
314 Ga0495685_013948 3300047447 Bacteria 2727
315 Ga0495685_036381 3300047447 Bacteria 1690
316 Ga0495685_052175 3300047447 Bacteria 1385
317 Ga0495673_0035088 3300047469 Bacteria 2314
318 Ga0495681_0000144 3300047470 Bacteria 60089
319 Ga0495681_0024964 3300047470 Bacteria 3134
320 Ga0495681_0116789 3300047470 Bacteria 1149
321 Ga0495681_0123233 3300047470 Bacteria 1110
322 Ga0495686_0000052 3300047472 Bacteria 262622
323 Ga0495686_0001101 3300047472 Bacteria 32108
324 Ga0495686_0001661 3300047472 Bacteria 23172
325 Ga0495686_0179734 3300047472 Bacteria 1226
326 Ga0495593_0032167 3300047673 Bacteria 2861
327 Ga0495626_0013934 3300048091 Bacteria 4163
328 Ga0495626_0014200 3300048091 Bacteria 4115
329 Ga0495626_0067380 3300048091 Bacteria 1616
330 Ga0495626_0080630 3300048091 Bacteria 1446
331 Ga0495626_0128954 3300048091 Bacteria 1081
332 Ga0495626_0137851 3300048091 Bacteria 1036
333 Ga0495626_0165769 3300048091 Bacteria 923
334 Ga0495626_0175067 3300048091 Bacteria 892
335 Ga0495626_0225125 3300048091 Bacteria 761
336 Ga0495626_0319896 3300048091 Bacteria 610
337 Ga0496101_0066030 3300048904 Bacteria 2638
338 Ga0496102_0000058 3300048905 Bacteria 168714
339 Ga0496102_0041246 3300048905 Bacteria 4178
340 Ga0496104_0053929 3300048907 Bacteria 3800
341 Ga0496109_0137698 3300048912 Bacteria 2282
342 Ga0496109_0382663 3300048912 Bacteria 1329
343 Ga0496110_0000251 3300048913 Bacteria 34859
344 Ga0496111_0799188 3300048914 Bacteria 683
345 Ga0496112_0087257 3300048915 Bacteria 3087
346 Ga0496112_0928410 3300048915 Bacteria 792
347 Ga0496113_0002669 3300048916 Bacteria 10454
348 Ga0496114_0127861 3300048917 Bacteria 2192
349 Ga0496115_0148888 3300048918 Bacteria 1932
350 Ga0496122_0000255 3300048925 Bacteria 120384
351 Ga0496123_0000138 3300048926 Bacteria 151844
352 Ga0496123_0130370 3300048926 Bacteria 1394
353 Ga0496124_0111574 3300048927 Bacteria 2200
354 Ga0496124_0264895 3300048927 Bacteria 1262
355 Ga0496125_0002620 3300048928 Bacteria 23073
356 Ga0495678_000110 3300049459 Bacteria 97228
357 Ga0495678_000294 3300049459 Bacteria 54947
358 Ga0495678_005399 3300049459 Bacteria 7065
359 Ga0495678_041000 3300049459 Bacteria 1856
360 Ga0495678_072936 3300049459 Bacteria 1253
361 Ga0495682_0029325 3300049460 Bacteria 2038
362 Ga0495682_0090426 3300049460 Bacteria 1099
363 nmdc:mga0k408_13898_c1 3300050493 Bacteria 4424
364 nmdc:mga0k408_2799_c1 3300050493 Bacteria 9267
365 nmdc:mga0k408_778_c1 3300050493 Bacteria 17529
366 Ga0500608_054534 3300053122 Bacteria 1918
367 Ga0500614_012628 3300053123 Bacteria 1847
368 Ga0500618_000037 3300053125 Bacteria 117320
369 Ga0500618_078408 3300053125 Bacteria 741
370 Ga0500579_157154 3300053143 Bacteria 971
371 Ga0500616_0071013 3300053153 Bacteria 1775
372 Ga0500624_000134 3300053157 Bacteria 31729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10068048 Ga0065714_100680482 143
2 3300046542 Ga0495597_0118453 Ga0495597_0118453_642_1091 145
3 3300046692 Ga0495671_0185363 Ga0495671_0185363_393_845 149
4 3300046531 Ga0495665_0055380 Ga0495665_0055380_532_990 150
5 3300046692 Ga0495671_0134315 Ga0495671_0134315_16_474 150
6 3300013307 Ga0157372_11210545 Ga0157372_112105452 151
7 3300046665 Ga0495661_0006865 Ga0495661_0006865_502_975 152
8 3300046538 Ga0495609_0034536 Ga0495609_0034536_1818_2282 154
9 iso_pu_bacteria 2599185184 2599478295 156
10 iso_pu_bacteria 2919437846 2919438981 156
11 iso_pu_bacteria 2928078545 2928080655 156
12 iso_pu_bacteria 2928147474 2928150879 156
13 iso_pu_bacteria 2932082852 2932082960 156
14 iso_pu_bacteria 2977232053 2977232838 156
15 3300031838 Ga0307518_10034940 Ga0307518_100349402 157
16 3300037312 Ga0395899_0395405 Ga0395899_0395405_301_786 157
17 3300046453 Ga0495627_028030 Ga0495627_028030_938_1420 157
18 3300046457 Ga0495590_0000206 Ga0495590_0000206_3346_3831 157
19 3300046457 Ga0495590_0010257 Ga0495590_0010257_1722_2222 157
20 3300046457 Ga0495590_0231987 Ga0495590_0231987_151_648 157
21 3300046458 Ga0495591_000236 Ga0495591_000236_46407_46892 157
22 3300046460 Ga0495638_0090870 Ga0495638_0090870_955_1455 157
23 3300046460 Ga0495638_0178890 Ga0495638_0178890_279_767 157
24 3300046460 Ga0495638_0251552 Ga0495638_0251552_255_740 157
25 3300046471 Ga0495650_0048049 Ga0495650_0048049_1026_1511 157
26 3300046474 Ga0495605_0006538 Ga0495605_0006538_4556_5041 157
27 3300046474 Ga0495605_0018133 Ga0495605_0018133_1654_2139 157
28 3300046474 Ga0495605_0193404 Ga0495605_0193404_311_796 157
29 3300046474 Ga0495605_0317924 Ga0495605_0317924_81_563 157
30 3300046491 Ga0495584_0000452 Ga0495584_0000452_3005_3490 157
31 3300046491 Ga0495584_0004915 Ga0495584_0004915_3963_4448 157
32 3300046491 Ga0495584_0006776 Ga0495584_0006776_1244_1726 157
33 3300046491 Ga0495584_0053128 Ga0495584_0053128_1297_1782 157
34 3300046491 Ga0495584_0223299 Ga0495584_0223299_241_723 157
35 3300046491 Ga0495584_0287964 Ga0495584_0287964_272_754 157
36 3300046492 Ga0495585_0001480 Ga0495585_0001480_15960_16442 157
37 3300046492 Ga0495585_0026913 Ga0495585_0026913_910_1395 157
38 3300046492 Ga0495585_0035117 Ga0495585_0035117_579_1064 157
39 3300046492 Ga0495585_0042463 Ga0495585_0042463_1737_2222 157
40 3300046499 Ga0495594_0011002 Ga0495594_0011002_1309_1791 157
41 3300046499 Ga0495594_0154580 Ga0495594_0154580_531_1013 157
42 3300046500 Ga0495596_0006828 Ga0495596_0006828_1423_1905 157
43 3300046500 Ga0495596_0006977 Ga0495596_0006977_1240_1734 157
44 3300046500 Ga0495596_0007249 Ga0495596_0007249_3589_4086 157
45 3300046500 Ga0495596_0008987 Ga0495596_0008987_3409_3894 157
46 3300046500 Ga0495596_0018122 Ga0495596_0018122_1827_2315 157
47 3300046500 Ga0495596_0018558 Ga0495596_0018558_357_851 157
48 3300046500 Ga0495596_0126858 Ga0495596_0126858_156_650 157
49 3300046501 Ga0495607_0011028 Ga0495607_0011028_3190_3675 157
50 3300046501 Ga0495607_0108791 Ga0495607_0108791_348_833 157
51 3300046506 Ga0495583_0001072 Ga0495583_0001072_27416_27901 157
52 3300046506 Ga0495583_0035270 Ga0495583_0035270_491_976 157
53 3300046506 Ga0495583_0035566 Ga0495583_0035566_1725_2210 157
54 3300046506 Ga0495583_0099362 Ga0495583_0099362_374_874 157
55 3300046507 Ga0495606_0023693 Ga0495606_0023693_1867_2361 157
56 3300046512 Ga0495610_0010358 Ga0495610_0010358_2956_3441 157
57 3300046513 Ga0495616_0090309 Ga0495616_0090309_873_1373 157
58 3300046513 Ga0495616_0091160 Ga0495616_0091160_273_758 157
59 3300046513 Ga0495616_0142599 Ga0495616_0142599_404_880 157
60 3300046518 Ga0495631_0000366 Ga0495631_0000366_1455_1955 157
61 3300046518 Ga0495631_0001045 Ga0495631_0001045_13895_14380 157
62 3300046518 Ga0495631_0017157 Ga0495631_0017157_2936_3421 157
63 3300046518 Ga0495631_0033431 Ga0495631_0033431_1619_2101 157
64 3300046518 Ga0495631_0034185 Ga0495631_0034185_433_918 157
65 3300046518 Ga0495631_0120092 Ga0495631_0120092_251_736 157
66 3300046519 Ga0495632_0035337 Ga0495632_0035337_1107_1592 157
67 3300046519 Ga0495632_0248820 Ga0495632_0248820_258_743 157
68 3300046520 Ga0495637_0000891 Ga0495637_0000891_10102_10587 157
69 3300046520 Ga0495637_0043319 Ga0495637_0043319_525_1010 157
70 3300046522 Ga0495643_0027941 Ga0495643_0027941_12_497 157
71 3300046522 Ga0495643_0031913 Ga0495643_0031913_1006_1488 157
72 3300046522 Ga0495643_0090993 Ga0495643_0090993_859_1344 157
73 3300046522 Ga0495643_0152028 Ga0495643_0152028_43_525 157
74 3300046522 Ga0495643_0209681 Ga0495643_0209681_349_849 157
75 3300046523 Ga0495644_0012345 Ga0495644_0012345_2293_2778 157
76 3300046523 Ga0495644_0019525 Ga0495644_0019525_1546_2028 157
77 3300046523 Ga0495644_0066751 Ga0495644_0066751_151_636 157
78 3300046523 Ga0495644_0209388 Ga0495644_0209388_117_602 157
79 3300046524 Ga0495648_0039528 Ga0495648_0039528_397_882 157
80 3300046524 Ga0495648_0076561 Ga0495648_0076561_572_1072 157
81 3300046524 Ga0495648_0214904 Ga0495648_0214904_349_849 157
82 3300046526 Ga0495666_0015613 Ga0495666_0015613_501_986 157
83 3300046528 Ga0495642_0164940 Ga0495642_0164940_340_825 157
84 3300046528 Ga0495642_0178967 Ga0495642_0178967_374_859 157
85 3300046528 Ga0495642_0277569 Ga0495642_0277569_235_717 157
86 3300046530 Ga0495654_0045011 Ga0495654_0045011_1233_1733 157
87 3300046531 Ga0495665_0018165 Ga0495665_0018165_2635_3120 157
88 3300046538 Ga0495609_0030082 Ga0495609_0030082_1823_2308 157
89 3300046538 Ga0495609_0051534 Ga0495609_0051534_231_716 157
90 3300046538 Ga0495609_0084030 Ga0495609_0084030_111_596 157
91 3300046538 Ga0495609_0134102 Ga0495609_0134102_97_579 157
92 3300046538 Ga0495609_0272542 Ga0495609_0272542_176_661 157
93 3300046542 Ga0495597_0000488 Ga0495597_0000488_1853_2338 157
94 3300046542 Ga0495597_0017841 Ga0495597_0017841_972_1457 157
95 3300046542 Ga0495597_0030835 Ga0495597_0030835_1878_2360 157
96 3300046542 Ga0495597_0057795 Ga0495597_0057795_954_1454 157
97 3300046542 Ga0495597_0153018 Ga0495597_0153018_19_513 157
98 3300046542 Ga0495597_0177051 Ga0495597_0177051_296_778 157
99 3300046542 Ga0495597_0234334 Ga0495597_0234334_73_555 157
100 3300046557 Ga0495622_0004802 Ga0495622_0004802_3157_3639 157
101 3300046558 Ga0495633_0018059 Ga0495633_0018059_387_872 157
102 3300046558 Ga0495633_0038622 Ga0495633_0038622_1532_2017 157
103 3300046558 Ga0495633_0117196 Ga0495633_0117196_734_1219 157
104 3300046616 Ga0495668_0000848 Ga0495668_0000848_1797_2279 157
105 3300046616 Ga0495668_0234285 Ga0495668_0234285_81_563 157
106 3300046648 Ga0495611_0000960 Ga0495611_0000960_12228_12713 157
107 3300046648 Ga0495611_0005301 Ga0495611_0005301_4378_4863 157
108 3300046648 Ga0495611_0011437 Ga0495611_0011437_2047_2529 157
109 3300046660 Ga0495625_0007834 Ga0495625_0007834_8553_9047 157
110 3300046660 Ga0495625_0188803 Ga0495625_0188803_548_1033 157
111 3300046660 Ga0495625_0372680 Ga0495625_0372680_133_633 157
112 3300046664 Ga0495659_0193044 Ga0495659_0193044_293_775 157
113 3300046665 Ga0495661_0002934 Ga0495661_0002934_10528_11013 157
114 3300046665 Ga0495661_0045912 Ga0495661_0045912_204_686 157
115 3300046665 Ga0495661_0060506 Ga0495661_0060506_1107_1592 157
116 3300046665 Ga0495661_0125883 Ga0495661_0125883_601_1086 157
117 3300046665 Ga0495661_0158596 Ga0495661_0158596_588_1073 157
118 3300046674 Ga0495588_0047753 Ga0495588_0047753_1648_2130 157
119 3300046679 Ga0495623_0165872 Ga0495623_0165872_217_702 157
120 3300046684 Ga0495669_0015027 Ga0495669_0015027_497_979 157
121 3300046684 Ga0495669_0025414 Ga0495669_0025414_1726_2211 157
122 3300046684 Ga0495669_0098632 Ga0495669_0098632_559_1044 157
123 3300046691 Ga0495670_0001696 Ga0495670_0001696_1742_2227 157
124 3300046691 Ga0495670_0026280 Ga0495670_0026280_264_749 157
125 3300046692 Ga0495671_0008192 Ga0495671_0008192_146_640 157
126 3300046692 Ga0495671_0062657 Ga0495671_0062657_439_939 157
127 3300046692 Ga0495671_0255803 Ga0495671_0255803_75_560 157
128 3300046694 Ga0495649_0187511 Ga0495649_0187511_287_763 157
129 3300046794 Ga0495589_0000354 Ga0495589_0000354_34038_34523 157
130 3300046794 Ga0495589_0009736 Ga0495589_0009736_3215_3700 157
131 3300046794 Ga0495589_0022860 Ga0495589_0022860_2678_3163 157
132 3300046810 Ga0495660_0018048 Ga0495660_0018048_1587_2072 157
133 3300046810 Ga0495660_0034741 Ga0495660_0034741_1788_2273 157
134 3300046810 Ga0495660_0119963 Ga0495660_0119963_392_892 157
135 3300046810 Ga0495660_0178340 Ga0495660_0178340_371_859 157
136 3300047317 Ga0495604_0080357 Ga0495604_0080357_287_772 157
137 3300047320 Ga0495672_0000258 Ga0495672_0000258_3203_3688 157
138 3300047320 Ga0495672_0002537 Ga0495672_0002537_14539_15024 157
139 3300047320 Ga0495672_0034006 Ga0495672_0034006_187_669 157
140 3300047321 Ga0495676_0000352 Ga0495676_0000352_3483_3965 157
141 3300047323 Ga0495683_0000446 Ga0495683_0000446_3424_3909 157
142 3300047323 Ga0495683_0012760 Ga0495683_0012760_1601_2083 157
143 3300047323 Ga0495683_0030033 Ga0495683_0030033_230_724 157
144 3300047323 Ga0495683_0135930 Ga0495683_0135930_284_769 157
145 3300047323 Ga0495683_0137483 Ga0495683_0137483_43_525 157
146 3300047323 Ga0495683_0285967 Ga0495683_0285967_92_577 157
147 3300047443 Ga0495687_000034 Ga0495687_000034_62448_62933 157
148 3300047443 Ga0495687_000081 Ga0495687_000081_1443_1928 157
149 3300047443 Ga0495687_002017 Ga0495687_002017_910_1407 157
150 3300047445 Ga0495677_0000195 Ga0495677_0000195_2445_2930 157
151 3300047446 Ga0495679_009181 Ga0495679_009181_2490_2975 157
152 3300047446 Ga0495679_059030 Ga0495679_059030_221_703 157
153 3300047447 Ga0495685_013948 Ga0495685_013948_271_756 157
154 3300047447 Ga0495685_036381 Ga0495685_036381_814_1314 157
155 3300047447 Ga0495685_052175 Ga0495685_052175_143_628 157
156 3300047470 Ga0495681_0000144 Ga0495681_0000144_57707_58192 157
157 3300047470 Ga0495681_0024964 Ga0495681_0024964_2301_2786 157
158 3300047470 Ga0495681_0116789 Ga0495681_0116789_547_1032 157
159 3300047472 Ga0495686_0001101 Ga0495686_0001101_29207_29695 157
160 3300048091 Ga0495626_0067380 Ga0495626_0067380_1065_1550 157
161 3300048091 Ga0495626_0128954 Ga0495626_0128954_135_620 157
162 3300048091 Ga0495626_0137851 Ga0495626_0137851_366_860 157
163 3300048091 Ga0495626_0165769 Ga0495626_0165769_392_892 157
164 3300048091 Ga0495626_0175067 Ga0495626_0175067_341_826 157
165 3300048091 Ga0495626_0225125 Ga0495626_0225125_70_552 157
166 3300048091 Ga0495626_0319896 Ga0495626_0319896_62_544 157
167 3300048904 Ga0496101_0066030 Ga0496101_0066030_1814_2299 157
168 3300048905 Ga0496102_0000058 Ga0496102_0000058_126726_127208 157
169 3300048912 Ga0496109_0382663 Ga0496109_0382663_546_1031 157
170 3300048913 Ga0496110_0000251 Ga0496110_0000251_1389_1874 157
171 3300048914 Ga0496111_0799188 Ga0496111_0799188_94_579 157
172 3300048915 Ga0496112_0928410 Ga0496112_0928410_26_511 157
173 3300048916 Ga0496113_0002669 Ga0496113_0002669_9423_9908 157
174 3300048918 Ga0496115_0148888 Ga0496115_0148888_222_704 157
175 3300048925 Ga0496122_0000255 Ga0496122_0000255_118639_119124 157
176 3300048926 Ga0496123_0000138 Ga0496123_0000138_32761_33246 157
177 3300048926 Ga0496123_0130370 Ga0496123_0130370_339_824 157
178 3300048927 Ga0496124_0111574 Ga0496124_0111574_1327_1812 157
179 3300048928 Ga0496125_0002620 Ga0496125_0002620_22206_22691 157
180 3300049459 Ga0495678_000110 Ga0495678_000110_3094_3579 157
181 3300049459 Ga0495678_000294 Ga0495678_000294_53592_54077 157
182 3300049459 Ga0495678_005399 Ga0495678_005399_4360_4857 157
183 3300049459 Ga0495678_072936 Ga0495678_072936_658_1143 157
184 3300049460 Ga0495682_0029325 Ga0495682_0029325_1258_1743 157
185 3300049460 Ga0495682_0090426 Ga0495682_0090426_326_814 157
186 3300005564 Ga0070664_100281089 Ga0070664_1002810892 158
187 3300046507 Ga0495606_0001127 Ga0495606_0001127_1033_1518 158
188 3300046507 Ga0495606_0245111 Ga0495606_0245111_66_551 158
189 3300046518 Ga0495631_0119477 Ga0495631_0119477_171_656 158
190 3300046519 Ga0495632_0045520 Ga0495632_0045520_1156_1644 158
191 3300046522 Ga0495643_0018075 Ga0495643_0018075_3484_3972 158
192 3300046528 Ga0495642_0054002 Ga0495642_0054002_570_1055 158
193 3300046531 Ga0495665_0403848 Ga0495665_0403848_72_557 158
194 3300046557 Ga0495622_0157200 Ga0495622_0157200_369_854 158
195 3300046558 Ga0495633_0415259 Ga0495633_0415259_89_574 158
196 3300046660 Ga0495625_0017052 Ga0495625_0017052_4239_4724 158
197 3300046664 Ga0495659_0351427 Ga0495659_0351427_78_563 158
198 3300046665 Ga0495661_0064576 Ga0495661_0064576_865_1350 158
199 3300046665 Ga0495661_0186287 Ga0495661_0186287_321_806 158
200 3300046674 Ga0495588_0111712 Ga0495588_0111712_805_1290 158
201 3300046691 Ga0495670_0058439 Ga0495670_0058439_156_641 158
202 3300046692 Ga0495671_0041598 Ga0495671_0041598_389_874 158
203 3300046694 Ga0495649_0001788 Ga0495649_0001788_3252_3740 158
204 3300047315 Ga0495581_0159519 Ga0495581_0159519_315_800 158
205 3300047323 Ga0495683_0095419 Ga0495683_0095419_304_789 158
206 3300047470 Ga0495681_0123233 Ga0495681_0123233_448_933 158
207 3300047673 Ga0495593_0032167 Ga0495593_0032167_127_612 158
208 3300048091 Ga0495626_0013934 Ga0495626_0013934_3225_3722 158
209 3300048091 Ga0495626_0014200 Ga0495626_0014200_367_855 158
210 3300048091 Ga0495626_0080630 Ga0495626_0080630_28_516 158
211 3300048927 Ga0496124_0264895 Ga0496124_0264895_338_826 158
212 3300005328 Ga0070676_10316759 Ga0070676_103167591 159
213 3300005438 Ga0070701_10336620 Ga0070701_103366201 159
214 3300005563 Ga0068855_100020774 Ga0068855_1000207742 159
215 3300005615 Ga0070702_100166936 Ga0070702_1001669362 159
216 3300005719 Ga0068861_100463225 Ga0068861_1004632252 159
217 3300009093 Ga0105240_10111508 Ga0105240_101115082 159
218 3300009101 Ga0105247_10253103 Ga0105247_102531031 159
219 3300010375 Ga0105239_10391925 Ga0105239_103919251 159
220 3300025913 Ga0207695_10189204 Ga0207695_101892042 159
221 3300025949 Ga0207667_10133252 Ga0207667_101332523 159
222 3300026075 Ga0207708_10372541 Ga0207708_103725411 159
223 3300026078 Ga0207702_10649680 Ga0207702_106496802 159
224 3300026118 Ga0207675_100330238 Ga0207675_1003302382 159
225 3300042145 Ga0450906_043169 Ga0450906_043169_30_530 159
226 3300046492 Ga0495585_0091792 Ga0495585_0091792_351_851 159
227 3300046492 Ga0495585_0409850 Ga0495585_0409850_48_545 159
228 3300046501 Ga0495607_0037823 Ga0495607_0037823_2221_2718 159
229 3300046501 Ga0495607_0043245 Ga0495607_0043245_256_756 159
230 3300046513 Ga0495616_0001634 Ga0495616_0001634_12497_12997 159
231 3300046519 Ga0495632_0002399 Ga0495632_0002399_11594_12094 159
232 3300046519 Ga0495632_0011507 Ga0495632_0011507_1479_1979 159
233 3300046523 Ga0495644_0009568 Ga0495644_0009568_3206_3706 159
234 3300046538 Ga0495609_0055732 Ga0495609_0055732_560_1060 159
235 3300046665 Ga0495661_0005217 Ga0495661_0005217_6080_6577 159
236 3300047323 Ga0495683_0015742 Ga0495683_0015742_1309_1809 159
237 3300047445 Ga0495677_0006543 Ga0495677_0006543_2910_3410 159
238 3300047445 Ga0495677_0141613 Ga0495677_0141613_248_745 159
239 3300047446 Ga0495679_016971 Ga0495679_016971_1431_1931 159
240 3300048905 Ga0496102_0041246 Ga0496102_0041246_2205_2774 159
241 3300048907 Ga0496104_0053929 Ga0496104_0053929_3043_3612 159
242 3300048912 Ga0496109_0137698 Ga0496109_0137698_50_619 159
243 3300048915 Ga0496112_0087257 Ga0496112_0087257_1689_2258 159
244 3300048917 Ga0496114_0127861 Ga0496114_0127861_1185_1754 159
245 3300001989 JGI24739J22299_10005838 JGI24739J22299_100058383 160
246 3300001990 JGI24737J22298_10000420 JGI24737J22298_1000042011 160
247 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004145 160
248 3300002075 JGI24738J21930_10053596 JGI24738J21930_100535961 160
249 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001753 160
250 3300002737 JGI25162J39368_1001209 JGI25162J39368_10012095 160
251 3300002772 JGI25164J39214_1001290 JGI25164J39214_10012905 160
252 3300003214 JGI25165J46597_1000615 JGI25165J46597_100061529 160
253 3300003316 rootH1_10019650 rootH1_100196506 160
254 3300003320 rootH2_10116976 rootH2_101169761 160
255 3300003322 rootL2_10054465 rootL2_100544654 160
256 3300003323 rootH1_10017651 rootH1_100176512 160
257 3300003323 rootH1_10257288 rootH1_102572882 160
258 3300005327 Ga0070658_10000018 Ga0070658_1000001872 160
259 3300005339 Ga0070660_100056978 Ga0070660_1000569782 160
260 3300005535 Ga0070684_100589333 Ga0070684_1005893331 160
261 3300005539 Ga0068853_100095667 Ga0068853_1000956671 160
262 3300005539 Ga0068853_100146195 Ga0068853_1001461951 160
263 3300005563 Ga0068855_100011186 Ga0068855_1000111862 160
264 3300005563 Ga0068855_100112412 Ga0068855_1001124122 160
265 3300005563 Ga0068855_101469960 Ga0068855_1014699602 160
266 3300005577 Ga0068857_100529486 Ga0068857_1005294861 160
267 3300005614 Ga0068856_100007535 Ga0068856_1000075357 160
268 3300005614 Ga0068856_100215803 Ga0068856_1002158034 160
269 3300006195 Ga0075366_10000697 Ga0075366_1000069714 160
270 3300006358 Ga0068871_100442193 Ga0068871_1004421932 160
271 3300009093 Ga0105240_10061674 Ga0105240_100616744 160
272 3300009093 Ga0105240_10247960 Ga0105240_102479603 160
273 3300009093 Ga0105240_10287803 Ga0105240_102878032 160
274 3300009093 Ga0105240_10396808 Ga0105240_103968082 160
275 3300009174 Ga0105241_10033059 Ga0105241_100330592 160
276 3300009545 Ga0105237_10125101 Ga0105237_101251012 160
277 3300010375 Ga0105239_10008149 Ga0105239_100081495 160
278 3300013102 Ga0157371_11252914 Ga0157371_112529141 160
279 3300013104 Ga0157370_10256083 Ga0157370_102560832 160
280 3300013296 Ga0157374_10709955 Ga0157374_107099551 160
281 3300013297 Ga0157378_10055544 Ga0157378_100555443 160
282 3300013306 Ga0163162_10115804 Ga0163162_101158042 160
283 3300013306 Ga0163162_11123388 Ga0163162_111233881 160
284 3300013306 Ga0163162_12999792 Ga0163162_129997921 160
285 3300013307 Ga0157372_10007668 Ga0157372_100076683 160
286 3300013307 Ga0157372_10692192 Ga0157372_106921922 160
287 3300013308 Ga0157375_10030316 Ga0157375_100303164 160
288 3300017792 Ga0163161_10035980 Ga0163161_100359802 160
289 3300025230 Ga0209563_106718 Ga0209563_1067183 160
290 3300025231 Ga0207427_100172 Ga0207427_10017233 160
291 3300025233 Ga0209437_100024 Ga0209437_100024262 160
292 3300025233 Ga0209437_100034 Ga0209437_100034138 160
293 3300025254 Ga0209148_1022545 Ga0209148_10225451 160
294 3300025258 Ga0209129_1011640 Ga0209129_10116402 160
295 3300025261 Ga0209233_1000038 Ga0209233_1000038138 160
296 3300025904 Ga0207647_10000076 Ga0207647_1000007632 160
297 3300025904 Ga0207647_10065335 Ga0207647_100653352 160
298 3300025904 Ga0207647_10193738 Ga0207647_101937382 160
299 3300025909 Ga0207705_10000036 Ga0207705_10000036123 160
300 3300025913 Ga0207695_10020421 Ga0207695_100204211 160
301 3300025913 Ga0207695_10185716 Ga0207695_101857162 160
302 3300025913 Ga0207695_10195211 Ga0207695_101952113 160
303 3300025914 Ga0207671_10003612 Ga0207671_1000361211 160
304 3300025932 Ga0207690_10028336 Ga0207690_100283362 160
305 3300025949 Ga0207667_10058775 Ga0207667_100587752 160
306 3300025981 Ga0207640_10154933 Ga0207640_101549332 160
307 3300026041 Ga0207639_10131030 Ga0207639_101310302 160
308 3300026041 Ga0207639_10233769 Ga0207639_102337692 160
309 3300026078 Ga0207702_10000142 Ga0207702_1000014268 160
310 3300026078 Ga0207702_10010549 Ga0207702_100105494 160
311 3300026078 Ga0207702_10014587 Ga0207702_100145871 160
312 3300026078 Ga0207702_10186636 Ga0207702_101866362 160
313 3300026116 Ga0207674_10142251 Ga0207674_101422511 160
314 3300026116 Ga0207674_10556413 Ga0207674_105564132 160
315 3300028794 Ga0307515_10005217 Ga0307515_1000521723 160
316 3300028794 Ga0307515_10011327 Ga0307515_1001132713 160
317 3300031240 Ga0265320_10046667 Ga0265320_100466673 160
318 3300031711 Ga0265314_10022271 Ga0265314_100222712 160
319 3300031911 Ga0307412_10362681 Ga0307412_103626812 160
320 3300033179 Ga0307507_10000052 Ga0307507_1000005244 160
321 3300033180 Ga0307510_10224598 Ga0307510_102245982 160
322 3300037312 Ga0395899_0099848 Ga0395899_0099848_992_1474 160
323 3300037418 Ga0395900_0215037 Ga0395900_0215037_960_1442 160
324 3300037418 Ga0395900_0447689 Ga0395900_0447689_413_895 160
325 3300037471 Ga0395905_0000727 Ga0395905_0000727_19152_19634 160
326 3300038443 Ga0395901_0003544 Ga0395901_0003544_603_1085 160
327 3300041452 Ga0451793_0012038 Ga0451793_0012038_433_915 160
328 3300046462 Ga0495651_0525228 Ga0495651_0525228_122_640 160
329 3300046471 Ga0495650_0000087 Ga0495650_0000087_61132_61614 160
330 3300046492 Ga0495585_0000167 Ga0495585_0000167_5659_6141 160
331 3300046492 Ga0495585_0003388 Ga0495585_0003388_5844_6326 160
332 3300046506 Ga0495583_0009915 Ga0495583_0009915_1689_2171 160
333 3300046507 Ga0495606_0000052 Ga0495606_0000052_134430_134912 160
334 3300046507 Ga0495606_0025556 Ga0495606_0025556_715_1197 160
335 3300046507 Ga0495606_0045779 Ga0495606_0045779_1918_2400 160
336 3300046507 Ga0495606_0152545 Ga0495606_0152545_491_973 160
337 3300046512 Ga0495610_0008832 Ga0495610_0008832_193_675 160
338 3300046513 Ga0495616_0002385 Ga0495616_0002385_7681_8163 160
339 3300046514 Ga0495618_0073225 Ga0495618_0073225_270_752 160
340 3300046516 Ga0495628_0606910 Ga0495628_0606910_274_756 160
341 3300046518 Ga0495631_0158155 Ga0495631_0158155_164_646 160
342 3300046520 Ga0495637_0133575 Ga0495637_0133575_184_666 160
343 3300046524 Ga0495648_0005217 Ga0495648_0005217_6029_6511 160
344 3300046524 Ga0495648_0273896 Ga0495648_0273896_78_560 160
345 3300046529 Ga0495652_0098993 Ga0495652_0098993_1464_1946 160
346 3300046529 Ga0495652_0356677 Ga0495652_0356677_339_821 160
347 3300046557 Ga0495622_0044911 Ga0495622_0044911_153_635 160
348 3300046557 Ga0495622_0353400 Ga0495622_0353400_40_522 160
349 3300046558 Ga0495633_0000029 Ga0495633_0000029_180966_181448 160
350 3300046616 Ga0495668_0000070 Ga0495668_0000070_47928_48410 160
351 3300046660 Ga0495625_0000008 Ga0495625_0000008_499126_499608 160
352 3300046660 Ga0495625_0001373 Ga0495625_0001373_21870_22388 160
353 3300046660 Ga0495625_0004000 Ga0495625_0004000_13517_13999 160
354 3300046660 Ga0495625_0011379 Ga0495625_0011379_2462_2944 160
355 3300046660 Ga0495625_0064781 Ga0495625_0064781_805_1287 160
356 3300046665 Ga0495661_0002168 Ga0495661_0002168_13838_14320 160
357 3300046674 Ga0495588_0475842 Ga0495588_0475842_147_629 160
358 3300046683 Ga0495658_0022983 Ga0495658_0022983_2695_3177 160
359 3300046694 Ga0495649_0000018 Ga0495649_0000018_36558_37040 160
360 3300046809 Ga0495600_0178230 Ga0495600_0178230_61_543 160
361 3300046810 Ga0495660_0010359 Ga0495660_0010359_36_518 160
362 3300047443 Ga0495687_001763 Ga0495687_001763_3327_3809 160
363 3300047443 Ga0495687_022506 Ga0495687_022506_116_604 160
364 3300047469 Ga0495673_0035088 Ga0495673_0035088_1430_1912 160
365 3300047472 Ga0495686_0000052 Ga0495686_0000052_210762_211244 160
366 3300047472 Ga0495686_0001661 Ga0495686_0001661_5870_6352 160
367 3300047472 Ga0495686_0179734 Ga0495686_0179734_234_716 160
368 3300049459 Ga0495678_041000 Ga0495678_041000_728_1210 160
369 3300050493 nmdc:mga0k408_13898_c1 nmdc:mga0k408_13898_c1_3175_3657 160
370 3300050493 nmdc:mga0k408_2799_c1 nmdc:mga0k408_2799_c1_7793_8275 160
371 3300050493 nmdc:mga0k408_778_c1 nmdc:mga0k408_778_c1_10981_11499 160
372 3300053122 Ga0500608_054534 Ga0500608_054534_635_1117 160
373 3300053123 Ga0500614_012628 Ga0500614_012628_1093_1575 160
374 3300053125 Ga0500618_000037 Ga0500618_000037_58589_59071 160
375 3300053125 Ga0500618_078408 Ga0500618_078408_15_497 160
376 3300053143 Ga0500579_157154 Ga0500579_157154_321_803 160
377 3300053153 Ga0500616_0071013 Ga0500616_0071013_740_1222 160
378 3300053157 Ga0500624_000134 Ga0500624_000134_4256_4738 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

7

171

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.9839 2 160
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.9825 1 159
4p68-assembly1.cif.gz_A electrostatics of active site microenvironments for e. coli dhfr 0.9823 2 160
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.9819 2 160
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.9778 2 160
ID Description Score Start End Superfamily
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9825 1 159 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9763 1 159 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9747 2 160 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9646 1 160 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9629 2 160 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A520AFY5-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9989 1 160 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A6B9ZAS5-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9984 1 160 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A520DBD6-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.998 2 113 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A4Q5LLI2-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9976 1 160 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A4Q5ZRL7-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9972 1 112 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Feature Viewer

pLDDT pTM Quality
96.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map