F427839

General Info

Members Datasets Scaffolds Average Seq Length
377 240 754 201

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0713949|Ga0501071_0713949_57_749
Length 230
Sequence MFTGIVQAVGRIVAVKTGPAAARLEIDPQALPVEDVVIGDSIAVNGCCLTVVELAAHDGARLAFDVSNETLACTVGLEAPGPVNLEKALRLADRLGGHLMTGHVDGVGVVVAHEPIEGARDAGSRRLEVEAPAALARFIASKGSIAVQGVSLTVNAVRGARFEANLIPHTLGATTLGGLRPGDRVNLEIDLVARYVDRLFGGAARQLDEGIPPGVAPATFAPSGRGGGGH

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 12.2
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0713949 3300049587 Bacteria 772
2 rootH2_10175748 3300003320 Bacteria 3006
3 Ga0055530_10029850 3300003791 Unclassified 1452
4 Ga0065715_10005059 3300005293 Bacteria 3775
5 Ga0065715_10104608 3300005293 Unclassified 2949
6 Ga0070676_10013974 3300005328 Bacteria 4406
7 Ga0070670_100009797 3300005331 Bacteria 8185
8 Ga0068869_100000017 3300005334 Bacteria 69630
9 Ga0068869_100000125 3300005334 Bacteria 36982
10 Ga0070666_10161979 3300005335 Unclassified 1564
11 Ga0070666_10707412 3300005335 Bacteria 739
12 Ga0068868_100030722 3300005338 Bacteria 4120
13 Ga0070660_100006846 3300005339 Bacteria 7907
14 Ga0070689_100027954 3300005340 Bacteria 4258
15 Ga0070668_100052716 3300005347 Bacteria 3136
16 Ga0070668_100355982 3300005347 Bacteria 1240
17 Ga0070668_100658015 3300005347 Unclassified 921
18 Ga0070668_100850212 3300005347 Bacteria 813
19 Ga0070669_100504368 3300005353 Unclassified 1004
20 Ga0070671_100021648 3300005355 Bacteria 5251
21 Ga0070671_100043010 3300005355 Bacteria 3756
22 Ga0070659_100021148 3300005366 Bacteria 4950
23 Ga0070659_100158441 3300005366 Bacteria 1850
24 Ga0070667_100032944 3300005367 Bacteria 4325
25 Ga0070703_10184071 3300005406 Bacteria 809
26 Ga0070714_100093314 3300005435 Bacteria 2639
27 Ga0070714_101428826 3300005435 Bacteria 675
28 Ga0070713_101253483 3300005436 Bacteria 718
29 Ga0070700_100139830 3300005441 Bacteria 1644
30 Ga0070678_100423283 3300005456 Unclassified 1161
31 Ga0070662_100185994 3300005457 Bacteria 1640
32 Ga0070662_100199250 3300005457 Bacteria 1588
33 Ga0070662_100309196 3300005457 Bacteria 1286
34 Ga0070662_100667618 3300005457 Bacteria 878
35 Ga0070681_10417238 3300005458 Bacteria 1254
36 Ga0070699_101294198 3300005518 Unclassified 669
37 Ga0070684_100525398 3300005535 Bacteria 1097
38 Ga0070686_100053269 3300005544 Bacteria 2582
39 Ga0070693_100089311 3300005547 Bacteria 1855
40 Ga0070665_100566947 3300005548 Bacteria 1148
41 Ga0070704_100054198 3300005549 Bacteria 2837
42 Ga0068855_100120525 3300005563 Bacteria 3003
43 Ga0068857_100016513 3300005577 Bacteria 6468
44 Ga0068854_100780882 3300005578 Bacteria 831
45 Ga0068856_100460187 3300005614 Bacteria 1293
46 Ga0070702_100206604 3300005615 Bacteria 1304
47 Ga0068852_100146182 3300005616 Bacteria 2193
48 Ga0068859_100089851 3300005617 Bacteria 3122
49 Ga0068864_100001386 3300005618 Bacteria 20083
50 Ga0068864_100111611 3300005618 Bacteria 2436
51 Ga0068861_100004418 3300005719 Bacteria 9427
52 Ga0068861_100040812 3300005719 Bacteria 3473
53 Ga0068870_10004821 3300005840 Bacteria 5831
54 Ga0068863_100044097 3300005841 Bacteria 4234
55 Ga0068863_100302694 3300005841 Bacteria 1551
56 Ga0068858_100013274 3300005842 Bacteria 7765
57 Ga0068858_100477616 3300005842 Bacteria 1203
58 Ga0068860_100067635 3300005843 Bacteria 3394
59 Ga0068862_100120579 3300005844 Bacteria 2311
60 Ga0081455_10046100 3300005937 Bacteria 3786
61 Ga0081455_10085939 3300005937 Bacteria 2563
62 Ga0081539_10055257 3300005985 Bacteria 2210
63 Ga0070717_10003116 3300006028 Bacteria 11832
64 Ga0070716_100247346 3300006173 Bacteria 1213
65 Ga0070716_100497280 3300006173 Bacteria 899
66 Ga0075367_10039197 3300006178 Bacteria 2762
67 Ga0097621_100325101 3300006237 Unclassified 1363
68 Ga0097621_100426762 3300006237 Bacteria 1191
69 Ga0075431_100170906 3300006847 Bacteria 2233
70 Ga0075431_100329678 3300006847 Bacteria 1537
71 Ga0075434_100001635 3300006871 Bacteria 19072
72 Ga0068865_100023171 3300006881 Bacteria 4062
73 Ga0075436_100023796 3300006914 Bacteria 4209
74 Ga0097620_100089841 3300006931 Bacteria 3122
75 Ga0075435_100034793 3300007076 Bacteria 3994
76 Ga0105240_10265116 3300009093 Bacteria 1980
77 Ga0105245_10107695 3300009098 Bacteria 2588
78 Ga0105245_10345559 3300009098 Bacteria 1472
79 Ga0105245_10352700 3300009098 Bacteria 1458
80 Ga0105247_10183205 3300009101 Bacteria 1399
81 Ga0105247_10197880 3300009101 Bacteria 1349
82 Ga0114129_10034040 3300009147 Bacteria 7196
83 Ga0114129_10296668 3300009147 Bacteria 2156
84 Ga0105241_10445471 3300009174 Bacteria 1145
85 Ga0105242_10707655 3300009176 Bacteria 986
86 Ga0105248_10002131 3300009177 Bacteria 21900
87 Ga0105248_10002554 3300009177 Bacteria 20256
88 Ga0105248_10380527 3300009177 Bacteria 1589
89 Ga0105237_10087282 3300009545 Bacteria 3109
90 Ga0105238_10105382 3300009551 Bacteria 2801
91 Ga0105249_10719608 3300009553 Bacteria 1059
92 Ga0105239_10028276 3300010375 Bacteria 6168
93 Ga0105246_10154648 3300011119 Bacteria 1740
94 Ga0157369_10594589 3300013105 Bacteria 1142
95 Ga0157374_10010023 3300013296 Bacteria 8133
96 Ga0157374_10573279 3300013296 Unclassified 1137
97 Ga0157378_10011732 3300013297 Bacteria 7671
98 Ga0157378_10064208 3300013297 Unclassified 3283
99 Ga0163162_10250634 3300013306 Bacteria 1903
100 Ga0163162_10466839 3300013306 Bacteria 1394
101 Ga0163162_10584118 3300013306 Bacteria 1244
102 Ga0157372_10033233 3300013307 Bacteria 5663
103 Ga0157375_10013715 3300013308 Bacteria 7224
104 Ga0157375_10033024 3300013308 Bacteria 4913
105 Ga0157375_10234381 3300013308 Bacteria 1995
106 Ga0157375_10466894 3300013308 Bacteria 1427
107 Ga0163163_10008357 3300014325 Bacteria 9193
108 Ga0163163_10014054 3300014325 Bacteria 7348
109 Ga0157377_10158114 3300014745 Bacteria 1407
110 Ga0157379_10004970 3300014968 Bacteria 11411
111 Ga0157379_10053796 3300014968 Bacteria 3597
112 Ga0224572_1008007 3300024225 Unclassified 1948
113 Ga0209050_1000284 3300025298 Bacteria 107558
114 Ga0207692_10320747 3300025898 Bacteria 948
115 Ga0207692_10686903 3300025898 Bacteria 663
116 Ga0207688_10007423 3300025901 Bacteria 5965
117 Ga0207680_10056464 3300025903 Bacteria 2371
118 Ga0207680_10129056 3300025903 Bacteria 1664
119 Ga0207699_10056556 3300025906 Bacteria 2339
120 Ga0207699_10328040 3300025906 Unclassified 1075
121 Ga0207645_10020339 3300025907 Bacteria 4345
122 Ga0207645_10103292 3300025907 Bacteria 1840
123 Ga0207643_10031777 3300025908 Bacteria 2945
124 Ga0207707_10145892 3300025912 Bacteria 2069
125 Ga0207695_10544403 3300025913 Bacteria 1042
126 Ga0207671_10014863 3300025914 Bacteria 6125
127 Ga0207693_10161617 3300025915 Bacteria 1762
128 Ga0207663_11025531 3300025916 Bacteria 662
129 Ga0207660_10730875 3300025917 Bacteria 808
130 Ga0207662_10065658 3300025918 Bacteria 2185
131 Ga0207662_10235658 3300025918 Bacteria 1197
132 Ga0207657_10018103 3300025919 Bacteria 6740
133 Ga0207657_10667128 3300025919 Unclassified 809
134 Ga0207646_10326638 3300025922 Bacteria 1386
135 Ga0207694_10032892 3300025924 Bacteria 3972
136 Ga0207650_10012867 3300025925 Bacteria 5781
137 Ga0207687_10002364 3300025927 Bacteria 12821
138 Ga0207644_10000862 3300025931 Bacteria 19192
139 Ga0207644_10002671 3300025931 Bacteria 11485
140 Ga0207690_10145064 3300025932 Bacteria 1754
141 Ga0207690_10189040 3300025932 Bacteria 1556
142 Ga0207690_10739597 3300025932 Bacteria 810
143 Ga0207706_10084128 3300025933 Bacteria 2797
144 Ga0207706_10167289 3300025933 Bacteria 1932
145 Ga0207670_10011825 3300025936 Bacteria 5080
146 Ga0207704_10470096 3300025938 Bacteria 1007
147 Ga0207665_10071665 3300025939 Bacteria 2366
148 Ga0207711_10005934 3300025941 Bacteria 10322
149 Ga0207711_10585141 3300025941 Bacteria 1041
150 Ga0207689_10000914 3300025942 Bacteria 28315
151 Ga0207689_11165585 3300025942 Bacteria 649
152 Ga0207651_10159025 3300025960 Bacteria 1769
153 Ga0207712_10941490 3300025961 Bacteria 765
154 Ga0207668_10032742 3300025972 Bacteria 3439
155 Ga0207668_10277539 3300025972 Bacteria 1373
156 Ga0207668_10326610 3300025972 Bacteria 1275
157 Ga0207640_10249949 3300025981 Bacteria 1376
158 Ga0207658_10322231 3300025986 Bacteria 1338
159 Ga0207677_10118026 3300026023 Bacteria 1990
160 Ga0207677_10277391 3300026023 Bacteria 1374
161 Ga0207703_10057701 3300026035 Bacteria 3166
162 Ga0207703_10585158 3300026035 Bacteria 1055
163 Ga0207708_10088691 3300026075 Bacteria 2383
164 Ga0207702_10031530 3300026078 Bacteria 4417
165 Ga0207702_10115182 3300026078 Bacteria 2397
166 Ga0207676_10179702 3300026095 Bacteria 1851
167 Ga0207675_100001801 3300026118 Bacteria 21457
168 Ga0207683_10163156 3300026121 Bacteria 2016
169 Ga0207698_10275082 3300026142 Bacteria 1554
170 Ga0268265_10173868 3300028380 Unclassified 1844
171 Ga0268264_10001784 3300028381 Bacteria 19664
172 Ga0265323_10019573 3300028653 Unclassified 2610
173 Ga0265323_10041501 3300028653 Bacteria 1669
174 Ga0265338_10006901 3300028800 Bacteria 14285
175 Ga0265338_10015677 3300028800 Bacteria 8304
176 Ga0265338_10037816 3300028800 Bacteria 4584
177 Ga0265324_10017748 3300029957 Bacteria 2586
178 Ga0265330_10049858 3300031235 Bacteria 1837
179 Ga0265332_10002545 3300031238 Bacteria 9255
180 Ga0265332_10125800 3300031238 Unclassified 1076
181 Ga0265328_10012987 3300031239 Bacteria 3304
182 Ga0265325_10044667 3300031241 Unclassified 2307
183 Ga0265325_10104902 3300031241 Bacteria 1380
184 Ga0265339_10003602 3300031249 Bacteria 10810
185 Ga0265331_10001092 3300031250 Bacteria 20887
186 Ga0265331_10030861 3300031250 Unclassified 2666
187 Ga0265327_10005274 3300031251 Bacteria 10878
188 Ga0265316_10014960 3300031344 Bacteria 6805
189 Ga0265316_10023025 3300031344 Bacteria 5240
190 Ga0265316_10025306 3300031344 Bacteria 4955
191 Ga0265316_10048279 3300031344 Bacteria 3362
192 Ga0265316_10121856 3300031344 Bacteria 1969
193 Ga0265316_10142432 3300031344 Bacteria 1800
194 Ga0265316_10181591 3300031344 Bacteria 1567
195 Ga0307408_100000032 3300031548 Bacteria 213693
196 Ga0307408_100001146 3300031548 Bacteria 20119
197 Ga0265314_10014862 3300031711 Bacteria 6204
198 Ga0265342_10018187 3300031712 Bacteria 4559
199 Ga0265342_10202133 3300031712 Unclassified 1079
200 Ga0307405_10001776 3300031731 Bacteria 9229
201 Ga0307405_10068586 3300031731 Bacteria 2270
202 Ga0307405_10792433 3300031731 Bacteria 793
203 Ga0307413_10005612 3300031824 Bacteria 5624
204 Ga0307413_10161937 3300031824 Bacteria 1573
205 Ga0307410_10000013 3300031852 Bacteria 76345
206 Ga0307410_10004736 3300031852 Bacteria 7086
207 Ga0307410_10012113 3300031852 Bacteria 4968
208 Ga0307406_10001441 3300031901 Bacteria 13157
209 Ga0307407_10008887 3300031903 Bacteria 4643
210 Ga0307407_10017941 3300031903 Bacteria 3565
211 Ga0307412_10017374 3300031911 Bacteria 4306
212 Ga0307412_10021099 3300031911 Bacteria 3974
213 Ga0307412_10199906 3300031911 Bacteria 1517
214 Ga0307409_100000031 3300031995 Bacteria 48910
215 Ga0307409_100004538 3300031995 Bacteria 7825
216 Ga0307409_100086817 3300031995 Bacteria 2548
217 Ga0307409_100151183 3300031995 Bacteria 2016
218 Ga0307409_100985342 3300031995 Bacteria 860
219 Ga0307416_100000038 3300032002 Bacteria 136704
220 Ga0307416_100019486 3300032002 Bacteria 4811
221 Ga0307416_100080305 3300032002 Bacteria 2752
222 Ga0307411_10005510 3300032005 Bacteria 6227
223 Ga0307411_10146867 3300032005 Bacteria 1747
224 Ga0307415_100054623 3300032126 Bacteria 2728
225 Ga0373926_0204601 3300035083 Bacteria 760
226 Ga0373944_0012217 3300035089 Bacteria 2364
227 Ga0373923_0083099 3300035111 Bacteria 1391
228 Ga0373945_0004958 3300035116 Bacteria 4242
229 Ga0373953_0201935 3300035117 Bacteria 860
230 Ga0373956_0041812 3300035119 Bacteria 2036
231 Ga0373943_0007183 3300035170 Bacteria 4997
232 Ga0373946_0004634 3300035171 Bacteria 4932
233 Ga0373924_0178077 3300035410 Bacteria 935
234 Ga0373931_0052200 3300035691 Bacteria 2179
235 Ga0373931_0558734 3300035691 Bacteria 744
236 Ga0373935_0029320 3300035692 Bacteria 3405
237 Ga0373935_0064758 3300035692 Bacteria 2344
238 Ga0373935_0076820 3300035692 Bacteria 2163
239 Ga0373935_0085417 3300035692 Bacteria 2057
240 Ga0373927_0029251 3300035695 Bacteria 3590
241 Ga0373927_0433673 3300035695 Bacteria 868
242 Ga0373947_0001985 3300035725 Bacteria 12522
243 Ga0373947_0119249 3300035725 Bacteria 1675
244 Ga0373937_0060211 3300036401 Bacteria 3489
245 Ga0373925_0003999 3300037068 Bacteria 11220
246 Ga0451849_1581918 3300041505 Bacteria 720
247 Ga0451577_0008807 3300042876 Bacteria 9775
248 Ga0466972_0072031 3300044658 Bacteria 1648
249 Ga0466966_0328477 3300044684 Bacteria 919
250 Ga0466963_0113920 3300044694 Bacteria 1858
251 Ga0453684_0002506 3300044712 Bacteria 44322
252 Ga0453684_0322390 3300044712 Bacteria 1749
253 Ga0453684_1320137 3300044712 Bacteria 752
254 Ga0466960_0072602 3300044901 Bacteria 1716
255 Ga0451576_0509690 3300045051 Bacteria 1264
256 Ga0466958_0551345 3300045836 Bacteria 749
257 Ga0466967_0518094 3300045976 Bacteria 1172
258 Ga0495592_0340707 3300046454 Bacteria 964
259 Ga0495603_0077654 3300046455 Bacteria 1948
260 Ga0495629_0045769 3300046459 Bacteria 3069
261 Ga0495641_0006154 3300046461 Bacteria 7848
262 Ga0495653_0097152 3300046463 Bacteria 2140
263 Ga0495580_0016846 3300046472 Bacteria 5481
264 Ga0495582_0001452 3300046473 Bacteria 13391
265 Ga0495639_0024939 3300046475 Bacteria 2634
266 Ga0495662_0011470 3300046476 Bacteria 4331
267 Ga0495664_0011104 3300046477 Bacteria 5068
268 Ga0495618_0026611 3300046514 Bacteria 3598
269 Ga0495630_0103739 3300046517 Bacteria 2151
270 Ga0495666_0001478 3300046526 Bacteria 11481
271 Ga0495652_0137974 3300046529 Bacteria 1921
272 Ga0495665_0007439 3300046531 Bacteria 5925
273 Ga0495640_0038407 3300046533 Bacteria 3367
274 Ga0495667_0017969 3300046559 Bacteria 4776
275 Ga0495634_0050216 3300046642 Bacteria 2802
276 Ga0495635_0000984 3300046663 Bacteria 18764
277 Ga0495635_0078118 3300046663 Bacteria 2266
278 Ga0495588_0007504 3300046674 Bacteria 4967
279 Ga0495657_0041210 3300046675 Bacteria 3162
280 Ga0495623_0069096 3300046679 Bacteria 2202
281 Ga0495646_0212040 3300046680 Bacteria 1050
282 Ga0495647_0008100 3300046681 Bacteria 3532
283 Ga0495658_0026955 3300046683 Bacteria 3086
284 Ga0495624_0184820 3300046690 Bacteria 1269
285 Ga0495600_0002275 3300046809 Bacteria 10941
286 Ga0495581_0001192 3300047315 Bacteria 14266
287 Ga0495581_0047557 3300047315 Bacteria 2479
288 Ga0495604_0134983 3300047317 Bacteria 1769
289 Ga0495636_0001824 3300047318 Bacteria 8152
290 Ga0495674_0037452 3300047319 Bacteria 4358
291 Ga0495674_0164538 3300047319 Bacteria 1854
292 Ga0495674_0190009 3300047319 Bacteria 1707
293 Ga0495676_0038774 3300047321 Bacteria 3954
294 Ga0495676_0507973 3300047321 Bacteria 790
295 Ga0495680_0063868 3300047322 Bacteria 2825
296 Ga0495684_0026621 3300047471 Bacteria 4444
297 Ga0495684_0446884 3300047471 Bacteria 899
298 Ga0495684_0636921 3300047471 Bacteria 715
299 Ga0495593_0246033 3300047673 Bacteria 895
300 Ga0495614_0053493 3300048089 Bacteria 1731
301 Ga0496100_0029142 3300048903 Bacteria 3412
302 Ga0496100_0132502 3300048903 Bacteria 1757
303 Ga0496100_0383626 3300048903 Bacteria 1067
304 Ga0496101_0005251 3300048904 Bacteria 8242
305 Ga0496101_0016788 3300048904 Bacteria 4955
306 Ga0496101_0332647 3300048904 Bacteria 1192
307 Ga0496101_0355409 3300048904 Bacteria 1152
308 Ga0496102_0012956 3300048905 Bacteria 7220
309 Ga0496102_0017937 3300048905 Bacteria 6210
310 Ga0496102_0032550 3300048905 Bacteria 4684
311 Ga0496102_0157713 3300048905 Bacteria 2134
312 Ga0496102_0216473 3300048905 Bacteria 1805
313 Ga0496103_0098235 3300048906 Bacteria 1851
314 Ga0496104_0092716 3300048907 Bacteria 2888
315 Ga0496104_0300595 3300048907 Bacteria 1517
316 Ga0496104_0805459 3300048907 Bacteria 845
317 Ga0496105_0127821 3300048908 Bacteria 2095
318 Ga0496105_0144028 3300048908 Bacteria 1960
319 Ga0496105_0867858 3300048908 Bacteria 682
320 Ga0496106_0009750 3300048909 Bacteria 7092
321 Ga0496106_0136079 3300048909 Bacteria 1930
322 Ga0496107_0022320 3300048910 Bacteria 4473
323 Ga0496107_0090807 3300048910 Bacteria 2231
324 Ga0496107_0279621 3300048910 Bacteria 1242
325 Ga0496107_0363788 3300048910 Bacteria 1076
326 Ga0496108_0003301 3300048911 Bacteria 12962
327 Ga0496108_0058063 3300048911 Bacteria 3251
328 Ga0496109_0000933 3300048912 Bacteria 24241
329 Ga0496109_0014256 3300048912 Bacteria 6916
330 Ga0496109_0035130 3300048912 Bacteria 4519
331 Ga0496109_0632019 3300048912 Bacteria 1007
332 Ga0496110_0001058 3300048913 Bacteria 19428
333 Ga0496110_0603034 3300048913 Unclassified 996
334 Ga0496111_0005659 3300048914 Bacteria 8047
335 Ga0496111_0169219 3300048914 Bacteria 1623
336 Ga0496112_0009536 3300048915 Bacteria 8756
337 Ga0496112_0099000 3300048915 Bacteria 2885
338 Ga0496113_0000958 3300048916 Bacteria 15356
339 Ga0496113_0026478 3300048916 Bacteria 4146
340 Ga0496114_0095978 3300048917 Bacteria 2523
341 Ga0496114_0114352 3300048917 Bacteria 2314
342 Ga0496114_0351555 3300048917 Bacteria 1304
343 Ga0496115_0051031 3300048918 Bacteria 3316
344 Ga0496115_0065697 3300048918 Bacteria 2930
345 Ga0496115_0148511 3300048918 Bacteria 1935
346 Ga0496115_0229667 3300048918 Bacteria 1530
347 Ga0496126_0118868 3300048929 Unclassified 2294
348 Ga0501034_0482421 3300049571 Bacteria 1155
349 Ga0501040_0000908 3300049576 Bacteria 18579
350 Ga0501041_0119257 3300049577 Bacteria 1639
351 Ga0501041_0412812 3300049577 Bacteria 856
352 Ga0501042_0001633 3300049578 Bacteria 13348
353 Ga0501071_0068390 3300049587 Bacteria 2584
354 Ga0501072_0329405 3300049588 Bacteria 1213
355 Ga0501073_0021074 3300049589 Bacteria 4701
356 Ga0501074_0376794 3300049590 Bacteria 1007
357 Ga0501079_0323030 3300049741 Bacteria 1208
358 Ga0501080_0000175 3300049742 Bacteria 47153
359 nmdc:mga05p37_9140_c1 3300050507 Bacteria 11715
360 nmdc:mga0n895_126307_c1 3300050512 Bacteria 2582
361 nmdc:mga0n895_416070_c1 3300050512 Bacteria 1359
362 nmdc:mga0n895_809059_c1 3300050512 Bacteria 927
363 nmdc:mga0n895_918115_c1 3300050512 Bacteria 860
364 nmdc:mga0rr50_32182_c1 3300050513 Bacteria 3734
365 nmdc:mga08x19_23534_c1 3300050514 Bacteria 3821
366 nmdc:mga0a205_128069_c1 3300050515 Unclassified 2438
367 nmdc:mga0a205_318593_c1 3300050515 Bacteria 1426
368 Ga0495601_0008638 3300053077 Bacteria 6011
369 Ga0495601_0089231 3300053077 Bacteria 1982
370 Ga0495601_0233502 3300053077 Bacteria 1201
371 Ga0495612_0030342 3300053078 Bacteria 2177
372 Ga0495612_0059989 3300053078 Bacteria 1574
373 Ga0495619_0148498 3300053085 Bacteria 1616
374 Ga0495619_0198778 3300053085 Bacteria 1388
375 Ga0495619_0563235 3300053085 Bacteria 781
376 Ga0500658_0033495 3300053134 Bacteria 2021
377 Ga0530510_0073685 3300061734 Bacteria 2479
378 Ga0501071_0713949
379 rootH2_10175748
380 Ga0055530_10029850
381 Ga0065715_10005059
382 Ga0065715_10104608
383 Ga0070676_10013974
384 Ga0070670_100009797
385 Ga0068869_100000017
386 Ga0068869_100000125
387 Ga0070666_10161979
388 Ga0070666_10707412
389 Ga0068868_100030722
390 Ga0070660_100006846
391 Ga0070689_100027954
392 Ga0070668_100052716
393 Ga0070668_100355982
394 Ga0070668_100658015
395 Ga0070668_100850212
396 Ga0070669_100504368
397 Ga0070671_100021648
398 Ga0070671_100043010
399 Ga0070659_100021148
400 Ga0070659_100158441
401 Ga0070667_100032944
402 Ga0070703_10184071
403 Ga0070714_100093314
404 Ga0070714_101428826
405 Ga0070713_101253483
406 Ga0070700_100139830
407 Ga0070678_100423283
408 Ga0070662_100185994
409 Ga0070662_100199250
410 Ga0070662_100309196
411 Ga0070662_100667618
412 Ga0070681_10417238
413 Ga0070699_101294198
414 Ga0070684_100525398
415 Ga0070686_100053269
416 Ga0070693_100089311
417 Ga0070665_100566947
418 Ga0070704_100054198
419 Ga0068855_100120525
420 Ga0068857_100016513
421 Ga0068854_100780882
422 Ga0068856_100460187
423 Ga0070702_100206604
424 Ga0068852_100146182
425 Ga0068859_100089851
426 Ga0068864_100001386
427 Ga0068864_100111611
428 Ga0068861_100004418
429 Ga0068861_100040812
430 Ga0068870_10004821
431 Ga0068863_100044097
432 Ga0068863_100302694
433 Ga0068858_100013274
434 Ga0068858_100477616
435 Ga0068860_100067635
436 Ga0068862_100120579
437 Ga0081455_10046100
438 Ga0081455_10085939
439 Ga0081539_10055257
440 Ga0070717_10003116
441 Ga0070716_100247346
442 Ga0070716_100497280
443 Ga0075367_10039197
444 Ga0097621_100325101
445 Ga0097621_100426762
446 Ga0075431_100170906
447 Ga0075431_100329678
448 Ga0075434_100001635
449 Ga0068865_100023171
450 Ga0075436_100023796
451 Ga0097620_100089841
452 Ga0075435_100034793
453 Ga0105240_10265116
454 Ga0105245_10107695
455 Ga0105245_10345559
456 Ga0105245_10352700
457 Ga0105247_10183205
458 Ga0105247_10197880
459 Ga0114129_10034040
460 Ga0114129_10296668
461 Ga0105241_10445471
462 Ga0105242_10707655
463 Ga0105248_10002131
464 Ga0105248_10002554
465 Ga0105248_10380527
466 Ga0105237_10087282
467 Ga0105238_10105382
468 Ga0105249_10719608
469 Ga0105239_10028276
470 Ga0105246_10154648
471 Ga0157369_10594589
472 Ga0157374_10010023
473 Ga0157374_10573279
474 Ga0157378_10011732
475 Ga0157378_10064208
476 Ga0163162_10250634
477 Ga0163162_10466839
478 Ga0163162_10584118
479 Ga0157372_10033233
480 Ga0157375_10013715
481 Ga0157375_10033024
482 Ga0157375_10234381
483 Ga0157375_10466894
484 Ga0163163_10008357
485 Ga0163163_10014054
486 Ga0157377_10158114
487 Ga0157379_10004970
488 Ga0157379_10053796
489 Ga0224572_1008007
490 Ga0209050_1000284
491 Ga0207692_10320747
492 Ga0207692_10686903
493 Ga0207688_10007423
494 Ga0207680_10056464
495 Ga0207680_10129056
496 Ga0207699_10056556
497 Ga0207699_10328040
498 Ga0207645_10020339
499 Ga0207645_10103292
500 Ga0207643_10031777
501 Ga0207707_10145892
502 Ga0207695_10544403
503 Ga0207671_10014863
504 Ga0207693_10161617
505 Ga0207663_11025531
506 Ga0207660_10730875
507 Ga0207662_10065658
508 Ga0207662_10235658
509 Ga0207657_10018103
510 Ga0207657_10667128
511 Ga0207646_10326638
512 Ga0207694_10032892
513 Ga0207650_10012867
514 Ga0207687_10002364
515 Ga0207644_10000862
516 Ga0207644_10002671
517 Ga0207690_10145064
518 Ga0207690_10189040
519 Ga0207690_10739597
520 Ga0207706_10084128
521 Ga0207706_10167289
522 Ga0207670_10011825
523 Ga0207704_10470096
524 Ga0207665_10071665
525 Ga0207711_10005934
526 Ga0207711_10585141
527 Ga0207689_10000914
528 Ga0207689_11165585
529 Ga0207651_10159025
530 Ga0207712_10941490
531 Ga0207668_10032742
532 Ga0207668_10277539
533 Ga0207668_10326610
534 Ga0207640_10249949
535 Ga0207658_10322231
536 Ga0207677_10118026
537 Ga0207677_10277391
538 Ga0207703_10057701
539 Ga0207703_10585158
540 Ga0207708_10088691
541 Ga0207702_10031530
542 Ga0207702_10115182
543 Ga0207676_10179702
544 Ga0207675_100001801
545 Ga0207683_10163156
546 Ga0207698_10275082
547 Ga0268265_10173868
548 Ga0268264_10001784
549 Ga0265323_10019573
550 Ga0265323_10041501
551 Ga0265338_10006901
552 Ga0265338_10015677
553 Ga0265338_10037816
554 Ga0265324_10017748
555 Ga0265330_10049858
556 Ga0265332_10002545
557 Ga0265332_10125800
558 Ga0265328_10012987
559 Ga0265325_10044667
560 Ga0265325_10104902
561 Ga0265339_10003602
562 Ga0265331_10001092
563 Ga0265331_10030861
564 Ga0265327_10005274
565 Ga0265316_10014960
566 Ga0265316_10023025
567 Ga0265316_10025306
568 Ga0265316_10048279
569 Ga0265316_10121856
570 Ga0265316_10142432
571 Ga0265316_10181591
572 Ga0307408_100000032
573 Ga0307408_100001146
574 Ga0265314_10014862
575 Ga0265342_10018187
576 Ga0265342_10202133
577 Ga0307405_10001776
578 Ga0307405_10068586
579 Ga0307405_10792433
580 Ga0307413_10005612
581 Ga0307413_10161937
582 Ga0307410_10000013
583 Ga0307410_10004736
584 Ga0307410_10012113
585 Ga0307406_10001441
586 Ga0307407_10008887
587 Ga0307407_10017941
588 Ga0307412_10017374
589 Ga0307412_10021099
590 Ga0307412_10199906
591 Ga0307409_100000031
592 Ga0307409_100004538
593 Ga0307409_100086817
594 Ga0307409_100151183
595 Ga0307409_100985342
596 Ga0307416_100000038
597 Ga0307416_100019486
598 Ga0307416_100080305
599 Ga0307411_10005510
600 Ga0307411_10146867
601 Ga0307415_100054623
602 Ga0373926_0204601
603 Ga0373944_0012217
604 Ga0373923_0083099
605 Ga0373945_0004958
606 Ga0373953_0201935
607 Ga0373956_0041812
608 Ga0373943_0007183
609 Ga0373946_0004634
610 Ga0373924_0178077
611 Ga0373931_0052200
612 Ga0373931_0558734
613 Ga0373935_0029320
614 Ga0373935_0064758
615 Ga0373935_0076820
616 Ga0373935_0085417
617 Ga0373927_0029251
618 Ga0373927_0433673
619 Ga0373947_0001985
620 Ga0373947_0119249
621 Ga0373937_0060211
622 Ga0373925_0003999
623 Ga0451849_1581918
624 Ga0451577_0008807
625 Ga0466972_0072031
626 Ga0466966_0328477
627 Ga0466963_0113920
628 Ga0453684_0002506
629 Ga0453684_0322390
630 Ga0453684_1320137
631 Ga0466960_0072602
632 Ga0451576_0509690
633 Ga0466958_0551345
634 Ga0466967_0518094
635 Ga0495592_0340707
636 Ga0495603_0077654
637 Ga0495629_0045769
638 Ga0495641_0006154
639 Ga0495653_0097152
640 Ga0495580_0016846
641 Ga0495582_0001452
642 Ga0495639_0024939
643 Ga0495662_0011470
644 Ga0495664_0011104
645 Ga0495618_0026611
646 Ga0495630_0103739
647 Ga0495666_0001478
648 Ga0495652_0137974
649 Ga0495665_0007439
650 Ga0495640_0038407
651 Ga0495667_0017969
652 Ga0495634_0050216
653 Ga0495635_0000984
654 Ga0495635_0078118
655 Ga0495588_0007504
656 Ga0495657_0041210
657 Ga0495623_0069096
658 Ga0495646_0212040
659 Ga0495647_0008100
660 Ga0495658_0026955
661 Ga0495624_0184820
662 Ga0495600_0002275
663 Ga0495581_0001192
664 Ga0495581_0047557
665 Ga0495604_0134983
666 Ga0495636_0001824
667 Ga0495674_0037452
668 Ga0495674_0164538
669 Ga0495674_0190009
670 Ga0495676_0038774
671 Ga0495676_0507973
672 Ga0495680_0063868
673 Ga0495684_0026621
674 Ga0495684_0446884
675 Ga0495684_0636921
676 Ga0495593_0246033
677 Ga0495614_0053493
678 Ga0496100_0029142
679 Ga0496100_0132502
680 Ga0496100_0383626
681 Ga0496101_0005251
682 Ga0496101_0016788
683 Ga0496101_0332647
684 Ga0496101_0355409
685 Ga0496102_0012956
686 Ga0496102_0017937
687 Ga0496102_0032550
688 Ga0496102_0157713
689 Ga0496102_0216473
690 Ga0496103_0098235
691 Ga0496104_0092716
692 Ga0496104_0300595
693 Ga0496104_0805459
694 Ga0496105_0127821
695 Ga0496105_0144028
696 Ga0496105_0867858
697 Ga0496106_0009750
698 Ga0496106_0136079
699 Ga0496107_0022320
700 Ga0496107_0090807
701 Ga0496107_0279621
702 Ga0496107_0363788
703 Ga0496108_0003301
704 Ga0496108_0058063
705 Ga0496109_0000933
706 Ga0496109_0014256
707 Ga0496109_0035130
708 Ga0496109_0632019
709 Ga0496110_0001058
710 Ga0496110_0603034
711 Ga0496111_0005659
712 Ga0496111_0169219
713 Ga0496112_0009536
714 Ga0496112_0099000
715 Ga0496113_0000958
716 Ga0496113_0026478
717 Ga0496114_0095978
718 Ga0496114_0114352
719 Ga0496114_0351555
720 Ga0496115_0051031
721 Ga0496115_0065697
722 Ga0496115_0148511
723 Ga0496115_0229667
724 Ga0496126_0118868
725 Ga0501034_0482421
726 Ga0501040_0000908
727 Ga0501041_0119257
728 Ga0501041_0412812
729 Ga0501042_0001633
730 Ga0501071_0068390
731 Ga0501072_0329405
732 Ga0501073_0021074
733 Ga0501074_0376794
734 Ga0501079_0323030
735 Ga0501080_0000175
736 nmdc:mga05p37_9140_c1
737 nmdc:mga0n895_126307_c1
738 nmdc:mga0n895_416070_c1
739 nmdc:mga0n895_809059_c1
740 nmdc:mga0n895_918115_c1
741 nmdc:mga0rr50_32182_c1
742 nmdc:mga08x19_23534_c1
743 nmdc:mga0a205_128069_c1
744 nmdc:mga0a205_318593_c1
745 Ga0495601_0008638
746 Ga0495601_0089231
747 Ga0495601_0233502
748 Ga0495612_0030342
749 Ga0495612_0059989
750 Ga0495619_0148498
751 Ga0495619_0198778
752 Ga0495619_0563235
753 Ga0500658_0033495
754 Ga0530510_0073685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

101

190

0.93

PF00677

Lum_binding

Lumazine binding domain

3

88

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9574 1 86
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9558 1 194
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9509 1 195
1kzl-assembly1.cif.gz_A riboflavin synthase from s.pombe bound to carboxyethyllumazine 0.949 1 196
7wuo-assembly1.cif.gz_C unravelling structure of riboflavin synthase for designing of potential anti-bacterial drug 0.9483 1 196
ID Description Score Start End Superfamily
af_Q9SKU8_64_151_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9846 1 87 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9686 1 88 2.40.30.20
af_Q9SKU8_64_151_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9627 1 87 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9597 101 191 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.958 1 88 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A0R2XA09-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9858 20 193 GO:0004746
GO:0009231
AF-A0A1G1KMC0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9837 1 196 GO:0004746
GO:0009231
AF-A0A7Y2PMZ0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9834 1 193 GO:0004746
GO:0009231
AF-A0A2W5Z1A7-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9826 1 194 GO:0004746
GO:0009231
AF-A0A1G1PES4-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9825 1 169 GO:0004746
GO:0009231

Map