F427724

General Info

Members Datasets Scaffolds Average Seq Length
377 227 754 264

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10109811|Ga0207683_101098112
Length 279
Sequence MIELTKLEKTFEQPGGERAVALRGVDLTMPAGEFLTVIGSNGSGKSTILNVIAGTYRPDAGTISVAKTDVTRWPEHRRAKLIGRVFQDPFKGTCPSMTVAENLRMAELRGRRRHLRLGLGRASLERYHALLASLGMRLENRLQASMGTLSGGQRQAVTLLMATLRRPELLLLDEHTAALDPRAAMQVMDVTEQVVRTHSLTTLMVTHSMEQALAFGDRTIMMHRGTVIADLSGEERQGVTEADLLVRFAELRYTAEMHFTMELAAITAQAVPSPGSTGP

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
195 2738541295 Bacillus sp. OK085 Isolate Unclassified
196 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
197 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
198 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
199 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
200 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
201 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
202 2842682962 Bacillus sp. R-72492 Isolate Unclassified
203 2849139964 Bacillus sp. R-71875 Isolate Unclassified
204 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
205 2857581216 Bacillus sp. R-71922 Isolate Unclassified
206 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
207 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
208 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
209 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
210 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
211 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
212 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
213 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
214 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
215 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
216 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
217 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
218 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
219 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
220 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
221 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
222 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
223 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
224 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
225 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
226 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
227 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.62
Metatranscriptomes 5.84
Isolates 9.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0
Rhizoplane 3.45
Rhizosphere 88.33
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10109811 3300026121 Bacteria 2469
2 JGI25151J46595_10015784 3300003187 Bacteria 3316
3 Ga0006562J51391_1026809 3300003578 Bacteria 1182
4 Ga0055538_1000106 3300003751 Bacteria 66606
5 Ga0070683_100017792 3300005329 Bacteria 6280
6 Ga0070683_100033503 3300005329 Bacteria 4684
7 Ga0070683_100127373 3300005329 Bacteria 2407
8 Ga0070683_100213549 3300005329 Bacteria 1833
9 Ga0070683_100567382 3300005329 Bacteria 1085
10 Ga0070670_100007473 3300005331 Bacteria 9280
11 Ga0070670_100016492 3300005331 Bacteria 6342
12 Ga0070677_10094783 3300005333 Bacteria 1305
13 Ga0068869_100007413 3300005334 Bacteria 7009
14 Ga0068869_100082606 3300005334 Unclassified 2401
15 Ga0070666_10082825 3300005335 Bacteria 2194
16 Ga0070682_100005507 3300005337 Bacteria 7047
17 Ga0068868_100006225 3300005338 Bacteria 8445
18 Ga0068868_100007638 3300005338 Bacteria 7712
19 Ga0068868_100030925 3300005338 Bacteria 4108
20 Ga0070660_100041100 3300005339 Bacteria 3523
21 Ga0070661_100048326 3300005344 Bacteria 3115
22 Ga0070661_100074449 3300005344 Bacteria 2501
23 Ga0070661_100226906 3300005344 Bacteria 1434
24 Ga0070692_10035357 3300005345 Bacteria 2529
25 Ga0070669_100528312 3300005353 Bacteria 982
26 Ga0070675_100012951 3300005354 Bacteria 6546
27 Ga0070675_100468945 3300005354 Bacteria 1131
28 Ga0070673_100009419 3300005364 Bacteria 6554
29 Ga0070673_100305095 3300005364 Bacteria 1403
30 Ga0070659_100000921 3300005366 Bacteria 21552
31 Ga0070667_100092776 3300005367 Bacteria 2599
32 Ga0070667_100102876 3300005367 Bacteria 2468
33 Ga0070663_100035697 3300005455 Bacteria 3450
34 Ga0070663_100072028 3300005455 Bacteria 2516
35 Ga0070663_100221942 3300005455 Unclassified 1484
36 Ga0068867_100090333 3300005459 Bacteria 2323
37 Ga0070679_100053832 3300005530 Bacteria 4006
38 Ga0070684_100008325 3300005535 Bacteria 8099
39 Ga0070684_100040755 3300005535 Bacteria 4001
40 Ga0070684_100114701 3300005535 Bacteria 2419
41 Ga0070684_100123050 3300005535 Bacteria 2335
42 Ga0070684_100262972 3300005535 Bacteria 1578
43 Ga0068853_100030927 3300005539 Bacteria 4525
44 Ga0068853_100073837 3300005539 Bacteria 2975
45 Ga0068853_100140508 3300005539 Unclassified 2167
46 Ga0068853_100474279 3300005539 Bacteria 1179
47 Ga0070686_100243296 3300005544 Bacteria 1311
48 Ga0070665_100117283 3300005548 Bacteria 2665
49 Ga0068855_100148412 3300005563 Bacteria 2668
50 Ga0068855_100274205 3300005563 Bacteria 1875
51 Ga0070664_100254750 3300005564 Bacteria 1578
52 Ga0068857_100025854 3300005577 Bacteria 5170
53 Ga0068857_100091883 3300005577 Bacteria 2717
54 Ga0068854_100284290 3300005578 Bacteria 1333
55 Ga0068856_100000947 3300005614 Bacteria 31072
56 Ga0068856_100022160 3300005614 Bacteria 6177
57 Ga0068856_100062230 3300005614 Bacteria 3686
58 Ga0068856_100379279 3300005614 Bacteria 1433
59 Ga0070702_100061769 3300005615 Bacteria 2182
60 Ga0068852_100022182 3300005616 Bacteria 5088
61 Ga0068852_100027075 3300005616 Bacteria 4668
62 Ga0068852_100107410 3300005616 Unclassified 2532
63 Ga0068852_100130888 3300005616 Bacteria 2310
64 Ga0068859_100034181 3300005617 Bacteria 5103
65 Ga0068859_100106834 3300005617 Unclassified 2858
66 Ga0068864_100001102 3300005618 Bacteria 22606
67 Ga0068864_100062934 3300005618 Bacteria 3215
68 Ga0068851_10005359 3300005834 Bacteria 5818
69 Ga0068851_10013306 3300005834 Bacteria 3894
70 Ga0068863_100016806 3300005841 Bacteria 7020
71 Ga0068858_100258628 3300005842 Bacteria 1654
72 Ga0068860_100001072 3300005843 Bacteria 30146
73 Ga0068860_100014372 3300005843 Bacteria 7758
74 Ga0068862_100030597 3300005844 Bacteria 4537
75 Ga0070717_10473854 3300006028 Bacteria 1130
76 Ga0097621_100012290 3300006237 Bacteria 6337
77 Ga0097621_100056025 3300006237 Bacteria 3220
78 Ga0097621_100083327 3300006237 Bacteria 2664
79 Ga0068871_100127808 3300006358 Bacteria 2152
80 Ga0075430_100038880 3300006846 Bacteria 4029
81 Ga0075430_100082686 3300006846 Bacteria 2691
82 Ga0075431_100051866 3300006847 Bacteria 4229
83 Ga0075434_100319118 3300006871 Bacteria 1574
84 Ga0068865_100040562 3300006881 Bacteria 3164
85 Ga0097620_100034182 3300006931 Bacteria 5103
86 Ga0097620_100106830 3300006931 Unclassified 2858
87 Ga0105244_10084149 3300009036 Bacteria 1571
88 Ga0105240_10000584 3300009093 Bacteria 67629
89 Ga0105240_10001989 3300009093 Bacteria 33765
90 Ga0105240_10009936 3300009093 Bacteria 13418
91 Ga0105240_10660966 3300009093 Bacteria 1144
92 Ga0105245_10016488 3300009098 Bacteria 6446
93 Ga0105245_10022313 3300009098 Bacteria 5556
94 Ga0105245_10050324 3300009098 Bacteria 3734
95 Ga0105245_10094793 3300009098 Bacteria 2752
96 Ga0105245_10130935 3300009098 Unclassified 2353
97 Ga0105245_10245089 3300009098 Bacteria 1739
98 Ga0105245_10416557 3300009098 Bacteria 1346
99 Ga0105247_10017910 3300009101 Bacteria 4250
100 Ga0114129_10544593 3300009147 Bacteria 1510
101 Ga0105243_10319136 3300009148 Bacteria 1415
102 Ga0105241_10021516 3300009174 Bacteria 4768
103 Ga0105241_10058191 3300009174 Bacteria 2967
104 Ga0105241_10084375 3300009174 Bacteria 2494
105 Ga0105241_10408776 3300009174 Bacteria 1192
106 Ga0105242_10006038 3300009176 Bacteria 9334
107 Ga0105248_10000541 3300009177 Bacteria 43101
108 Ga0105248_10019093 3300009177 Bacteria 7582
109 Ga0105248_10024778 3300009177 Bacteria 6673
110 Ga0105248_10067656 3300009177 Bacteria 4010
111 Ga0105248_10486754 3300009177 Unclassified 1391
112 Ga0105237_10038902 3300009545 Bacteria 4803
113 Ga0105237_10435856 3300009545 Unclassified 1316
114 Ga0105238_10012965 3300009551 Bacteria 8414
115 Ga0105238_10034402 3300009551 Bacteria 5156
116 Ga0105238_10075379 3300009551 Bacteria 3365
117 Ga0105238_10078936 3300009551 Bacteria 3282
118 Ga0105238_10107475 3300009551 Unclassified 2771
119 Ga0105238_10133647 3300009551 Bacteria 2459
120 Ga0105249_10036132 3300009553 Bacteria 4481
121 Ga0105239_10000929 3300010375 Bacteria 41487
122 Ga0105239_10038019 3300010375 Bacteria 5275
123 Ga0105239_10076620 3300010375 Bacteria 3678
124 Ga0105239_10084150 3300010375 Unclassified 3503
125 Ga0105239_10123575 3300010375 Bacteria 2875
126 Ga0105246_10003771 3300011119 Bacteria 9190
127 Ga0105246_10433275 3300011119 Unclassified 1100
128 Ga0105246_10576943 3300011119 Bacteria 968
129 Ga0157373_10022892 3300013100 Bacteria 4532
130 Ga0157373_10277334 3300013100 Unclassified 1188
131 Ga0157371_10012391 3300013102 Bacteria 6519
132 Ga0157369_10031895 3300013105 Bacteria 5798
133 Ga0157369_10093079 3300013105 Bacteria 3217
134 Ga0157374_10011467 3300013296 Bacteria 7676
135 Ga0157374_10032257 3300013296 Bacteria 4768
136 Ga0157374_10033657 3300013296 Bacteria 4677
137 Ga0157374_10083884 3300013296 Bacteria 3028
138 Ga0157374_10100934 3300013296 Unclassified 2767
139 Ga0157374_10130841 3300013296 Bacteria 2429
140 Ga0157378_10010918 3300013297 Bacteria 7944
141 Ga0157378_10087673 3300013297 Unclassified 2823
142 Ga0163162_10468756 3300013306 Bacteria 1391
143 Ga0157372_10010429 3300013307 Bacteria 9881
144 Ga0157372_10021102 3300013307 Bacteria 7035
145 Ga0157372_10724310 3300013307 Bacteria 1157
146 Ga0157375_10000044 3300013308 Bacteria 155953
147 Ga0157375_10015777 3300013308 Bacteria 6770
148 Ga0157375_10466557 3300013308 Bacteria 1428
149 Ga0157375_11085897 3300013308 Bacteria 936
150 Ga0163163_10004777 3300014325 Bacteria 11625
151 Ga0163163_10068745 3300014325 Bacteria 3525
152 Ga0163163_10718458 3300014325 Bacteria 1063
153 Ga0157377_10002530 3300014745 Bacteria 8106
154 Ga0157379_10000510 3300014968 Bacteria 31398
155 Ga0157376_10222534 3300014969 Bacteria 1749
156 Ga0209784_100051 3300025224 Bacteria 183666
157 Ga0209676_1002006 3300025292 Bacteria 16071
158 Ga0209676_1005739 3300025292 Bacteria 6366
159 Ga0209676_1014450 3300025292 Bacteria 2968
160 Ga0209676_1014501 3300025292 Bacteria 2959
161 Ga0209025_1013478 3300025294 Bacteria 5132
162 Ga0209025_1024568 3300025294 Bacteria 3104
163 Ga0209025_1024769 3300025294 Bacteria 3085
164 Ga0209025_1048373 3300025294 Bacteria 1725
165 Ga0207656_10015268 3300025321 Bacteria 2970
166 Ga0207656_10050492 3300025321 Bacteria 1796
167 Ga0207710_10001808 3300025900 Bacteria 10330
168 Ga0207680_10050153 3300025903 Bacteria 2488
169 Ga0207647_10087446 3300025904 Unclassified 1862
170 Ga0207645_10057157 3300025907 Bacteria 2491
171 Ga0207643_10060242 3300025908 Bacteria 2167
172 Ga0207705_10016583 3300025909 Bacteria 5279
173 Ga0207654_10013373 3300025911 Unclassified 4223
174 Ga0207654_10013747 3300025911 Bacteria 4170
175 Ga0207654_10053173 3300025911 Bacteria 2337
176 Ga0207707_10129537 3300025912 Bacteria 2207
177 Ga0207695_10000140 3300025913 Bacteria 216271
178 Ga0207695_10000353 3300025913 Bacteria 105514
179 Ga0207671_10000302 3300025914 Bacteria 72902
180 Ga0207671_10049058 3300025914 Bacteria 3125
181 Ga0207671_10573633 3300025914 Bacteria 899
182 Ga0207649_10076531 3300025920 Bacteria 2153
183 Ga0207649_10084830 3300025920 Bacteria 2060
184 Ga0207652_10009620 3300025921 Bacteria 7775
185 Ga0207681_10502766 3300025923 Bacteria 992
186 Ga0207694_10000620 3300025924 Bacteria 32258
187 Ga0207694_10004374 3300025924 Bacteria 11032
188 Ga0207694_10095898 3300025924 Bacteria 2346
189 Ga0207694_10405215 3300025924 Bacteria 1134
190 Ga0207650_10004885 3300025925 Bacteria 9159
191 Ga0207650_10018935 3300025925 Bacteria 4837
192 Ga0207659_10433595 3300025926 Bacteria 1104
193 Ga0207687_10078640 3300025927 Unclassified 2375
194 Ga0207687_10253896 3300025927 Bacteria 1399
195 Ga0207687_10290523 3300025927 Bacteria 1314
196 Ga0207687_10314916 3300025927 Bacteria 1265
197 Ga0207690_10096785 3300025932 Bacteria 2099
198 Ga0207706_10002855 3300025933 Bacteria 16771
199 Ga0207706_10048840 3300025933 Bacteria 3742
200 Ga0207669_10141480 3300025937 Bacteria 1671
201 Ga0207704_10196529 3300025938 Bacteria 1472
202 Ga0207711_10002011 3300025941 Bacteria 18396
203 Ga0207711_10097951 3300025941 Bacteria 2590
204 Ga0207711_10186827 3300025941 Bacteria 1887
205 Ga0207711_10340409 3300025941 Unclassified 1388
206 Ga0207689_10001970 3300025942 Bacteria 19394
207 Ga0207689_10002614 3300025942 Bacteria 16674
208 Ga0207661_10037710 3300025944 Bacteria 3782
209 Ga0207661_10067105 3300025944 Unclassified 2916
210 Ga0207661_10184757 3300025944 Bacteria 1824
211 Ga0207679_10474722 3300025945 Bacteria 1112
212 Ga0207667_10082129 3300025949 Bacteria 3338
213 Ga0207667_10268818 3300025949 Bacteria 1743
214 Ga0207651_10020478 3300025960 Bacteria 3993
215 Ga0207677_10013673 3300026023 Bacteria 4712
216 Ga0207677_10049665 3300026023 Bacteria 2832
217 Ga0207639_10004435 3300026041 Bacteria 9472
218 Ga0207639_10039380 3300026041 Bacteria 3521
219 Ga0207639_10366276 3300026041 Unclassified 1291
220 Ga0207678_10017232 3300026067 Bacteria 6342
221 Ga0207678_10110355 3300026067 Bacteria 2347
222 Ga0207678_10325654 3300026067 Unclassified 1322
223 Ga0207702_10001020 3300026078 Bacteria 28742
224 Ga0207702_10038802 3300026078 Bacteria 3989
225 Ga0207702_10045647 3300026078 Bacteria 3686
226 Ga0207702_10072074 3300026078 Bacteria 2976
227 Ga0207702_10421608 3300026078 Bacteria 1291
228 Ga0207641_10001055 3300026088 Bacteria 27824
229 Ga0207648_10177079 3300026089 Bacteria 1886
230 Ga0207676_10007211 3300026095 Bacteria 7869
231 Ga0207676_10008162 3300026095 Bacteria 7446
232 Ga0207674_10000949 3300026116 Bacteria 37834
233 Ga0207674_10001882 3300026116 Bacteria 26733
234 Ga0207674_10018779 3300026116 Bacteria 7502
235 Ga0207674_10034816 3300026116 Bacteria 5260
236 Ga0207674_10118393 3300026116 Bacteria 2619
237 Ga0207683_10112966 3300026121 Bacteria 2433
238 Ga0207683_10311842 3300026121 Bacteria 1440
239 Ga0207698_10016236 3300026142 Bacteria 5013
240 Ga0207698_10019078 3300026142 Bacteria 4686
241 Ga0207698_10047297 3300026142 Bacteria 3258
242 Ga0207698_10048747 3300026142 Bacteria 3218
243 Ga0209974_10029514 3300027876 Bacteria 1817
244 Ga0268266_10091177 3300028379 Bacteria 2672
245 Ga0268264_10000776 3300028381 Bacteria 35208
246 Ga0268264_10010653 3300028381 Bacteria 7598
247 Ga0265762_1008646 3300030760 Bacteria 1811
248 Ga0265327_10147715 3300031251 Bacteria 1094
249 Ga0307408_100049674 3300031548 Bacteria 3013
250 Ga0307408_100385239 3300031548 Bacteria 1200
251 Ga0265342_10048863 3300031712 Bacteria 2534
252 Ga0307412_10080774 3300031911 Bacteria 2247
253 Ga0307409_100010006 3300031995 Bacteria 5863
254 Ga0307416_100266091 3300032002 Bacteria 1679
255 Ga0307416_100575339 3300032002 Bacteria 1203
256 Ga0373943_0110410 3300035170 Bacteria 1450
257 Ga0373946_0089533 3300035171 Bacteria 1361
258 Ga0373931_0007633 3300035691 Bacteria 5100
259 Ga0373947_0017412 3300035725 Bacteria 4132
260 Ga0373925_0020700 3300037068 Bacteria 4792
261 Ga0400483_021269 3300039062 Bacteria 25825
262 Ga0450903_005959 3300042138 Bacteria 2034
263 Ga0439434_0017667 3300042435 Bacteria 2135
264 Ga0451577_0002534 3300042876 Bacteria 21613
265 Ga0451577_0212486 3300042876 Bacteria 1748
266 Ga0451577_0362404 3300042876 Bacteria 1315
267 Ga0451576_0544249 3300045051 Bacteria 1220
268 Ga0466967_0309967 3300045976 Unclassified 1520
269 Ga0495592_0101096 3300046454 Bacteria 2055
270 Ga0495603_0157268 3300046455 Bacteria 1319
271 Ga0495641_0017768 3300046461 Bacteria 3694
272 Ga0495582_0047187 3300046473 Bacteria 2372
273 Ga0495639_0031618 3300046475 Bacteria 2357
274 Ga0495594_0009289 3300046499 Bacteria 5078
275 Ga0495618_0012728 3300046514 Bacteria 5113
276 Ga0495618_0152436 3300046514 Bacteria 1476
277 Ga0495630_0002532 3300046517 Bacteria 12677
278 Ga0495630_0013938 3300046517 Bacteria 5848
279 Ga0495666_0000718 3300046526 Bacteria 15134
280 Ga0495666_0189678 3300046526 Bacteria 947
281 Ga0495665_0021730 3300046531 Bacteria 3451
282 Ga0495640_0028683 3300046533 Bacteria 4004
283 Ga0495586_0058539 3300046535 Bacteria 2092
284 Ga0495586_0083414 3300046535 Bacteria 1758
285 Ga0495622_0059346 3300046557 Bacteria 1771
286 Ga0495622_0098216 3300046557 Bacteria 1343
287 Ga0495634_0014137 3300046642 Bacteria 5762
288 Ga0495661_0195592 3300046665 Bacteria 1062
289 Ga0495647_0004442 3300046681 Bacteria 4559
290 Ga0495658_0015657 3300046683 Bacteria 3892
291 Ga0495613_0002695 3300046689 Bacteria 13332
292 Ga0495613_0190504 3300046689 Bacteria 1449
293 Ga0495624_0049526 3300046690 Bacteria 2664
294 Ga0495670_0183703 3300046691 Bacteria 1105
295 Ga0495649_0145789 3300046694 Bacteria 1245
296 Ga0495589_0091320 3300046794 Bacteria 1479
297 Ga0495600_0083433 3300046809 Bacteria 2086
298 Ga0495581_0208255 3300047315 Bacteria 1144
299 Ga0495674_0020013 3300047319 Bacteria 6204
300 Ga0495676_0100677 3300047321 Bacteria 2139
301 Ga0495680_0065220 3300047322 Bacteria 2789
302 Ga0495684_0146152 3300047471 Bacteria 1771
303 Ga0496101_0185938 3300048904 Bacteria 1602
304 Ga0496101_0686890 3300048904 Unclassified 808
305 Ga0496102_0570075 3300048905 Bacteria 1055
306 Ga0496106_0313036 3300048909 Bacteria 1260
307 Ga0496108_0389373 3300048911 Bacteria 1217
308 Ga0496109_0016454 3300048912 Bacteria 6466
309 Ga0496110_0000084 3300048913 Bacteria 49140
310 Ga0496110_0140274 3300048913 Bacteria 2185
311 Ga0496110_0624010 3300048913 Bacteria 977
312 Ga0496111_0001174 3300048914 Bacteria 14587
313 Ga0496111_0008432 3300048914 Bacteria 6823
314 Ga0496113_0127544 3300048916 Bacteria 1994
315 Ga0496113_0181790 3300048916 Bacteria 1667
316 Ga0496116_0102773 3300048919 Bacteria 1703
317 Ga0496126_0204611 3300048929 Bacteria 1665
318 Ga0501306_010669 3300049127 Bacteria 1160
319 Ga0501343_000231 3300049132 Bacteria 2951
320 Ga0501305_004411 3300049161 Bacteria 1653
321 Ga0501311_003196 3300049527 Bacteria 1649
322 Ga0501311_010512 3300049527 Bacteria 1124
323 Ga0501312_004269 3300049528 Bacteria 1674
324 Ga0501312_019726 3300049528 Bacteria 992
325 Ga0501315_001317 3300049531 Bacteria 2088
326 Ga0501315_034920 3300049531 Bacteria 740
327 Ga0501316_007467 3300049532 Bacteria 1188
328 Ga0501317_000381 3300049533 Bacteria 3014
329 Ga0501318_006332 3300049534 Bacteria 1206
330 Ga0501325_003084 3300049541 Bacteria 1192
331 Ga0501330_001809 3300049546 Bacteria 1157
332 Ga0501331_01360 3300049547 Bacteria 1178
333 Ga0501333_002108 3300049549 Bacteria 1139
334 Ga0501335_001129 3300049551 Bacteria 1984
335 Ga0501336_002122 3300049552 Bacteria 1255
336 Ga0501336_003058 3300049552 Bacteria 1108
337 Ga0501340_001706 3300049556 Bacteria 1215
338 Ga0501217_009348 3300049661 Bacteria 2131
339 Ga0501044_0021941 3300049823 Bacteria 6808
340 nmdc:mga0qj67_250257_c1 3300050509 Bacteria 1438
341 nmdc:mga06r32_74977_c1 3300050510 Bacteria 3281
342 2672336846 2671180330 Bacteria 5521719
343 2738815976 2738541295 Bacteria 5730091
344 2738838693 2738541299 Bacteria 4020721
345 2791211804 2788500588 Bacteria 4584915
346 2808867043 2808606364 Bacteria 4465927
347 2816862694 2816332186 Bacteria 5331395
348 2819626649 2818991451 Bacteria 4697364
349 2831905255 2831905167 Bacteria 3319172
350 2842684383 2842682962 Bacteria 5589973
351 2849144350 2849139964 Bacteria 5613304
352 2852675211 2852673933 Bacteria 3347676
353 2857582429 2857581216 Bacteria 5522813
354 2857604366 2857604169 Bacteria 5111450
355 2857611012 2857609550 Bacteria 3753890
356 2881645231 2881644220 Bacteria 5302661
357 2904608973 2904606771 Bacteria 4684500
358 2919415055 2919414237 Bacteria 5429133
359 2928512076 2928510474 Bacteria 4815308
360 2928512096 2928510474 Bacteria 4815308
361 2936367001 2936361878 Bacteria 5632809
362 2939597810 2939593269 Bacteria 4798695
363 2977257071 2977254563 Bacteria 4828420
364 2990277964 2990275345 Bacteria 4887158
365 3001267112 3001267043 Bacteria 4823521
366 3001272584 3001272096 Bacteria 4729684
367 3001898239 3001892409 Bacteria 6328293
368 3006829080 3006826541 Bacteria 4678913
369 3006970019 3006969106 Bacteria 4739423
370 3006974070 3006973921 Bacteria 4423788
371 3006978758 3006978542 Bacteria 5328100
372 3006979394 3006978542 Bacteria 5328100
373 3006985997 3006984091 Bacteria 4207523
374 3006990064 3006988479 Bacteria 4767936
375 8054282749 8054280661 Bacteria 4232245
376 8055532390 8055531788 Bacteria 5249694
377 8057633794 8057632132 Bacteria 4726859
378 Ga0207683_10109811
379 JGI25151J46595_10015784
380 Ga0006562J51391_1026809
381 Ga0055538_1000106
382 Ga0070683_100017792
383 Ga0070683_100033503
384 Ga0070683_100127373
385 Ga0070683_100213549
386 Ga0070683_100567382
387 Ga0070670_100007473
388 Ga0070670_100016492
389 Ga0070677_10094783
390 Ga0068869_100007413
391 Ga0068869_100082606
392 Ga0070666_10082825
393 Ga0070682_100005507
394 Ga0068868_100006225
395 Ga0068868_100007638
396 Ga0068868_100030925
397 Ga0070660_100041100
398 Ga0070661_100048326
399 Ga0070661_100074449
400 Ga0070661_100226906
401 Ga0070692_10035357
402 Ga0070669_100528312
403 Ga0070675_100012951
404 Ga0070675_100468945
405 Ga0070673_100009419
406 Ga0070673_100305095
407 Ga0070659_100000921
408 Ga0070667_100092776
409 Ga0070667_100102876
410 Ga0070663_100035697
411 Ga0070663_100072028
412 Ga0070663_100221942
413 Ga0068867_100090333
414 Ga0070679_100053832
415 Ga0070684_100008325
416 Ga0070684_100040755
417 Ga0070684_100114701
418 Ga0070684_100123050
419 Ga0070684_100262972
420 Ga0068853_100030927
421 Ga0068853_100073837
422 Ga0068853_100140508
423 Ga0068853_100474279
424 Ga0070686_100243296
425 Ga0070665_100117283
426 Ga0068855_100148412
427 Ga0068855_100274205
428 Ga0070664_100254750
429 Ga0068857_100025854
430 Ga0068857_100091883
431 Ga0068854_100284290
432 Ga0068856_100000947
433 Ga0068856_100022160
434 Ga0068856_100062230
435 Ga0068856_100379279
436 Ga0070702_100061769
437 Ga0068852_100022182
438 Ga0068852_100027075
439 Ga0068852_100107410
440 Ga0068852_100130888
441 Ga0068859_100034181
442 Ga0068859_100106834
443 Ga0068864_100001102
444 Ga0068864_100062934
445 Ga0068851_10005359
446 Ga0068851_10013306
447 Ga0068863_100016806
448 Ga0068858_100258628
449 Ga0068860_100001072
450 Ga0068860_100014372
451 Ga0068862_100030597
452 Ga0070717_10473854
453 Ga0097621_100012290
454 Ga0097621_100056025
455 Ga0097621_100083327
456 Ga0068871_100127808
457 Ga0075430_100038880
458 Ga0075430_100082686
459 Ga0075431_100051866
460 Ga0075434_100319118
461 Ga0068865_100040562
462 Ga0097620_100034182
463 Ga0097620_100106830
464 Ga0105244_10084149
465 Ga0105240_10000584
466 Ga0105240_10001989
467 Ga0105240_10009936
468 Ga0105240_10660966
469 Ga0105245_10016488
470 Ga0105245_10022313
471 Ga0105245_10050324
472 Ga0105245_10094793
473 Ga0105245_10130935
474 Ga0105245_10245089
475 Ga0105245_10416557
476 Ga0105247_10017910
477 Ga0114129_10544593
478 Ga0105243_10319136
479 Ga0105241_10021516
480 Ga0105241_10058191
481 Ga0105241_10084375
482 Ga0105241_10408776
483 Ga0105242_10006038
484 Ga0105248_10000541
485 Ga0105248_10019093
486 Ga0105248_10024778
487 Ga0105248_10067656
488 Ga0105248_10486754
489 Ga0105237_10038902
490 Ga0105237_10435856
491 Ga0105238_10012965
492 Ga0105238_10034402
493 Ga0105238_10075379
494 Ga0105238_10078936
495 Ga0105238_10107475
496 Ga0105238_10133647
497 Ga0105249_10036132
498 Ga0105239_10000929
499 Ga0105239_10038019
500 Ga0105239_10076620
501 Ga0105239_10084150
502 Ga0105239_10123575
503 Ga0105246_10003771
504 Ga0105246_10433275
505 Ga0105246_10576943
506 Ga0157373_10022892
507 Ga0157373_10277334
508 Ga0157371_10012391
509 Ga0157369_10031895
510 Ga0157369_10093079
511 Ga0157374_10011467
512 Ga0157374_10032257
513 Ga0157374_10033657
514 Ga0157374_10083884
515 Ga0157374_10100934
516 Ga0157374_10130841
517 Ga0157378_10010918
518 Ga0157378_10087673
519 Ga0163162_10468756
520 Ga0157372_10010429
521 Ga0157372_10021102
522 Ga0157372_10724310
523 Ga0157375_10000044
524 Ga0157375_10015777
525 Ga0157375_10466557
526 Ga0157375_11085897
527 Ga0163163_10004777
528 Ga0163163_10068745
529 Ga0163163_10718458
530 Ga0157377_10002530
531 Ga0157379_10000510
532 Ga0157376_10222534
533 Ga0209784_100051
534 Ga0209676_1002006
535 Ga0209676_1005739
536 Ga0209676_1014450
537 Ga0209676_1014501
538 Ga0209025_1013478
539 Ga0209025_1024568
540 Ga0209025_1024769
541 Ga0209025_1048373
542 Ga0207656_10015268
543 Ga0207656_10050492
544 Ga0207710_10001808
545 Ga0207680_10050153
546 Ga0207647_10087446
547 Ga0207645_10057157
548 Ga0207643_10060242
549 Ga0207705_10016583
550 Ga0207654_10013373
551 Ga0207654_10013747
552 Ga0207654_10053173
553 Ga0207707_10129537
554 Ga0207695_10000140
555 Ga0207695_10000353
556 Ga0207671_10000302
557 Ga0207671_10049058
558 Ga0207671_10573633
559 Ga0207649_10076531
560 Ga0207649_10084830
561 Ga0207652_10009620
562 Ga0207681_10502766
563 Ga0207694_10000620
564 Ga0207694_10004374
565 Ga0207694_10095898
566 Ga0207694_10405215
567 Ga0207650_10004885
568 Ga0207650_10018935
569 Ga0207659_10433595
570 Ga0207687_10078640
571 Ga0207687_10253896
572 Ga0207687_10290523
573 Ga0207687_10314916
574 Ga0207690_10096785
575 Ga0207706_10002855
576 Ga0207706_10048840
577 Ga0207669_10141480
578 Ga0207704_10196529
579 Ga0207711_10002011
580 Ga0207711_10097951
581 Ga0207711_10186827
582 Ga0207711_10340409
583 Ga0207689_10001970
584 Ga0207689_10002614
585 Ga0207661_10037710
586 Ga0207661_10067105
587 Ga0207661_10184757
588 Ga0207679_10474722
589 Ga0207667_10082129
590 Ga0207667_10268818
591 Ga0207651_10020478
592 Ga0207677_10013673
593 Ga0207677_10049665
594 Ga0207639_10004435
595 Ga0207639_10039380
596 Ga0207639_10366276
597 Ga0207678_10017232
598 Ga0207678_10110355
599 Ga0207678_10325654
600 Ga0207702_10001020
601 Ga0207702_10038802
602 Ga0207702_10045647
603 Ga0207702_10072074
604 Ga0207702_10421608
605 Ga0207641_10001055
606 Ga0207648_10177079
607 Ga0207676_10007211
608 Ga0207676_10008162
609 Ga0207674_10000949
610 Ga0207674_10001882
611 Ga0207674_10018779
612 Ga0207674_10034816
613 Ga0207674_10118393
614 Ga0207683_10112966
615 Ga0207683_10311842
616 Ga0207698_10016236
617 Ga0207698_10019078
618 Ga0207698_10047297
619 Ga0207698_10048747
620 Ga0209974_10029514
621 Ga0268266_10091177
622 Ga0268264_10000776
623 Ga0268264_10010653
624 Ga0265762_1008646
625 Ga0265327_10147715
626 Ga0307408_100049674
627 Ga0307408_100385239
628 Ga0265342_10048863
629 Ga0307412_10080774
630 Ga0307409_100010006
631 Ga0307416_100266091
632 Ga0307416_100575339
633 Ga0373943_0110410
634 Ga0373946_0089533
635 Ga0373931_0007633
636 Ga0373947_0017412
637 Ga0373925_0020700
638 Ga0400483_021269
639 Ga0450903_005959
640 Ga0439434_0017667
641 Ga0451577_0002534
642 Ga0451577_0212486
643 Ga0451577_0362404
644 Ga0451576_0544249
645 Ga0466967_0309967
646 Ga0495592_0101096
647 Ga0495603_0157268
648 Ga0495641_0017768
649 Ga0495582_0047187
650 Ga0495639_0031618
651 Ga0495594_0009289
652 Ga0495618_0012728
653 Ga0495618_0152436
654 Ga0495630_0002532
655 Ga0495630_0013938
656 Ga0495666_0000718
657 Ga0495666_0189678
658 Ga0495665_0021730
659 Ga0495640_0028683
660 Ga0495586_0058539
661 Ga0495586_0083414
662 Ga0495622_0059346
663 Ga0495622_0098216
664 Ga0495634_0014137
665 Ga0495661_0195592
666 Ga0495647_0004442
667 Ga0495658_0015657
668 Ga0495613_0002695
669 Ga0495613_0190504
670 Ga0495624_0049526
671 Ga0495670_0183703
672 Ga0495649_0145789
673 Ga0495589_0091320
674 Ga0495600_0083433
675 Ga0495581_0208255
676 Ga0495674_0020013
677 Ga0495676_0100677
678 Ga0495680_0065220
679 Ga0495684_0146152
680 Ga0496101_0185938
681 Ga0496101_0686890
682 Ga0496102_0570075
683 Ga0496106_0313036
684 Ga0496108_0389373
685 Ga0496109_0016454
686 Ga0496110_0000084
687 Ga0496110_0140274
688 Ga0496110_0624010
689 Ga0496111_0001174
690 Ga0496111_0008432
691 Ga0496113_0127544
692 Ga0496113_0181790
693 Ga0496116_0102773
694 Ga0496126_0204611
695 Ga0501306_010669
696 Ga0501343_000231
697 Ga0501305_004411
698 Ga0501311_003196
699 Ga0501311_010512
700 Ga0501312_004269
701 Ga0501312_019726
702 Ga0501315_001317
703 Ga0501315_034920
704 Ga0501316_007467
705 Ga0501317_000381
706 Ga0501318_006332
707 Ga0501325_003084
708 Ga0501330_001809
709 Ga0501331_01360
710 Ga0501333_002108
711 Ga0501335_001129
712 Ga0501336_002122
713 Ga0501336_003058
714 Ga0501340_001706
715 Ga0501217_009348
716 Ga0501044_0021941
717 nmdc:mga0qj67_250257_c1
718 nmdc:mga06r32_74977_c1
719 2672336846
720 2738815976
721 2738838693
722 2791211804
723 2808867043
724 2816862694
725 2819626649
726 2831905255
727 2842684383
728 2849144350
729 2852675211
730 2857582429
731 2857604366
732 2857611012
733 2881645231
734 2904608973
735 2919415055
736 2928512076
737 2928512096
738 2936367001
739 2939597810
740 2977257071
741 2990277964
742 3001267112
743 3001272584
744 3001898239
745 3006829080
746 3006970019
747 3006974070
748 3006978758
749 3006979394
750 3006985997
751 3006990064
752 8054282749
753 8055532390
754 8057633794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9426 2 235
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9177 1 235
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9116 2 235
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9072 2 234
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9072 2 235
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9516 2 231 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9324 2 231 3.40.50.300
af_Q2FYQ8_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9225 1 235 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9173 1 235 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9158 2 232 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A151AUE1-F1-model_v4 Thiamine import ATP-binding protein ThiQ (EC 3.6.3.-) 0.9692 82 253 GO:0005524
GO:0016887
AF-A0A1H1K509-F1-model_v4 ABC-type uncharacterized transport system, ATPase component 0.962 2 253 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7L9RRY7-F1-model_v4 Ferric enterobactin transport ATP-binding protein FepC 0.9504 1 251 GO:0005524
GO:0016887
AF-A0A7L9RRY7-F1-model_v4 Ferric enterobactin transport ATP-binding protein FepC 0.9283 1 251 GO:0005524
GO:0016887
AF-A0A2E7V6G1-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9261 1 231 GO:0005524
GO:0016887

Map