F427650

General Info

Members Datasets Scaffolds Average Seq Length
377 320 162 405

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100009938|Ga0075428_10000993810
Length 419
Sequence LSTGALIVGAGQAGAQIAISLREIGYREPITLIGEEPYAPYQRPPLSKSVLLGDRDVLELHIKGPNYFAEKSIRVITGERVESIEVDTDGVGGRASTSSGQVIEFEKLALATGAGARRLDVEGADLDGVHCLRGIDDAVTLRDRLRADQRIVVVGGGFIGLEFAAAARSRGADVTVLQSTDRLLSRAVGPAISDFYLDAHTRRGVTVLLESDLVAIHGDPHSRAVNAVELADGTRLAADLVVVGIGAKPNVELAEHLGLECDGGIVVDAQARTSRTQIVAAGDCTVSLDPLTETRVRLESVQNAVNQGRCAAASLAGSMGIKPAVPYFWSDQYDLTLQIAGLSQGYDKVVIRGDRGSEQFAALYYRGSRLIAIDAVNCPRDYAAVLSALRSGAHIPAELAVQGALSLRDMMKAPIPAER

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
25 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
26 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
27 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
28 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
29 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
30 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
31 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
32 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
33 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
34 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
35 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
36 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
37 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
38 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
39 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
40 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
41 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
42 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
43 2643221558 Rhizobium sp. Root149 Isolate Unclassified
44 2643221599 Rhizobium sp. Root708 Isolate Unclassified
45 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
46 2718217882 Rhizobium sp. N741 Isolate Nodule
47 2718217927 Rhizobium sp. N324 Isolate Nodule
48 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
49 2718218009 Rhizobium sp. N561 Isolate Nodule
50 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
51 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
52 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
53 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
54 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
55 2718218363 Rhizobium sp. N113 Isolate Nodule
56 2718218365 Rhizobium sp. N731 Isolate Nodule
57 2718218366 Rhizobium sp. N621 Isolate Nodule
58 2718218423 Rhizobium sp. N941 Isolate Nodule
59 2721755514 Rhizobium sp. N6212 Isolate Nodule
60 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
61 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
62 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
63 2721755809 Rhizobium sp. N541 Isolate Nodule
64 2721755810 Rhizobium sp. N871 Isolate Nodule
65 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
66 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
67 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
68 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
69 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
70 2728369365 Rhizobium sp. N1341 Isolate Nodule
71 2728369397 Rhizobium sp. N1314 Isolate Nodule
72 2738541293 Rhizobium sp. GV031 Isolate Unclassified
73 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
74 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
75 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
76 2791355260 Rhizobium sp. L9 Isolate Nodule
77 2791355261 Rhizobium sp. J15 Isolate Nodule
78 2791355262 Rhizobium sp. M1 Isolate Nodule
79 2791355263 Rhizobium chutanense C5 Isolate Nodule
80 2791355264 Rhizobium sp. S9 Isolate Nodule
81 2791355266 Rhizobium sp. L43 Isolate Nodule
82 2791355267 Rhizobium sp. L18 Isolate Nodule
83 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
84 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
85 2802429633 Rhizobium anhuiense J3 Isolate Nodule
86 2802429634 Rhizobium anhuiense S10 Isolate Nodule
87 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
88 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
89 2802429637 Rhizobium anhuiense C15 Isolate Nodule
90 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
91 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
92 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
93 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
94 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
95 2838048938 Rhizobium pisi 27/80 Isolate Nodule
96 2838061910 Rhizobium phaseoli L15 Isolate Nodule
97 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
98 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
99 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
100 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
101 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
102 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
103 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
104 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
105 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
106 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
107 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
108 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
109 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
110 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
111 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
112 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
113 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
114 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
115 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
116 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
117 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
118 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
119 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
120 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
121 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
122 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
123 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
124 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
125 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
126 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
127 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
128 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
129 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
130 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
131 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
132 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
133 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
134 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
135 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
136 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
137 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
138 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
139 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
140 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
141 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
142 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
143 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
144 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
145 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
146 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
147 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
148 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
149 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
150 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
151 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
152 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
153 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
154 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
155 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
156 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
157 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
158 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
159 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
160 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
161 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
162 2933599457 Rhizobium phaseoli M3 Isolate Nodule
163 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
164 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
165 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
166 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
167 2936381700 Rhizobium chutanense C16 Isolate Unclassified
168 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
169 2996893221 Rhizobium sp. R635 Isolate Nodule
170 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
171 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
172 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
173 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
174 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
175 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
176 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
177 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
178 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
179 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
180 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
181 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
182 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
183 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
184 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
185 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
186 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
187 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
188 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
189 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
190 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
191 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
192 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
193 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
194 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
195 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
196 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
197 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
198 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
199 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
200 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
201 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
202 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
204 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
205 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
206 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
207 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
208 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
209 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
210 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
211 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
213 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
214 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
216 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
218 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
220 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
234 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
239 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
240 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
280 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
286 8005275841 Rhizobium sp. N4311 Isolate Nodule
287 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
288 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
289 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
290 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
291 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
292 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
293 8005382845 Rhizobium sp. R634 Isolate Nodule
294 8005395548 Rhizobium sp. R339 Isolate Nodule
295 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
296 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
297 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
298 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
299 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
300 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
301 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
302 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
303 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
304 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
305 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
306 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
307 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
308 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
309 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
310 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
311 8018176218 Rhizobium sp. N122 Isolate Nodule
312 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
313 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
314 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
315 8024501048 Rhizobium sp. H4 Isolate Nodule
316 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
317 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
318 8056382006 Rhizobium croatiense 13T Isolate Nodule
319 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
320 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.97
Metatranscriptomes 0
Isolates 57.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.71
Nodule 44.56
Rhizoplane 0.8
Rhizosphere 23.34
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000365 3300002737 Bacteria 38564
2 JGI25152J39213_1001841 3300002773 Bacteria 8561
3 JGI25151J46595_10000508 3300003187 Bacteria 36520
4 JGI25151J46595_10009496 3300003187 Bacteria 4599
5 JGI25165J46597_1001675 3300003214 Bacteria 10066
6 JGI25165J46597_1003343 3300003214 Bacteria 4078
7 JGI25153J46596_10006031 3300003215 Bacteria 6228
8 rootH1_10016241 3300003316 Bacteria 9812
9 rootH2_10063918 3300003320 Bacteria 13931
10 rootL2_10027409 3300003322 Bacteria 17052
11 rootL2_10032165 3300003322 Bacteria 1881
12 rootL2_10061222 3300003322 Bacteria 11605
13 rootH1_10013822 3300003323 Bacteria 3375
14 rootH1_10243441 3300003323 Bacteria 1899
15 JGI25160J50197_1000014 3300003354 Bacteria 259862
16 JGI25160J50197_1005949 3300003354 Bacteria 5011
17 JGI25161J50226_1000061 3300003374 Bacteria 101391
18 JGI25161J50226_1008166 3300003374 Bacteria 1642
19 Ga0055526_1000991 3300003771 Bacteria 20837
20 Ga0055526_1004842 3300003771 Bacteria 7943
21 Ga0055526_1013723 3300003771 Bacteria 3400
22 Ga0055526_1023639 3300003771 Bacteria 2045
23 Ga0055524_1002762 3300003775 Bacteria 8828
24 Ga0055528_1000109 3300003790 Bacteria 66661
25 Ga0055528_1000206 3300003790 Bacteria 49816
26 Ga0055528_1019456 3300003790 Bacteria 2250
27 Ga0055540_1000197 3300003792 Bacteria 58449
28 Ga0055543_1000005 3300004625 Bacteria 223621
29 Ga0055543_1000578 3300004625 Bacteria 20193
30 Ga0065165_1000126 3300005262 Bacteria 129946
31 Ga0065165_1010980 3300005262 Bacteria 3840
32 Ga0070669_100026661 3300005353 Bacteria 4159
33 Ga0070674_100004659 3300005356 Bacteria 7835
34 Ga0068866_10020742 3300005718 Bacteria 3016
35 Ga0068851_10070460 3300005834 Bacteria 1808
36 Ga0068862_100171839 3300005844 Bacteria 1941
37 Ga0081538_10000693 3300005981 Bacteria 37007
38 Ga0081540_1036168 3300005983 Bacteria 2637
39 Ga0075368_10017504 3300006042 Bacteria 2683
40 Ga0075370_10007207 3300006353 Bacteria 5651
41 Ga0075428_100009938 3300006844 Bacteria 10570
42 Ga0075428_100152221 3300006844 Bacteria 2513
43 Ga0075428_100300195 3300006844 Bacteria 1727
44 Ga0068865_100053657 3300006881 Bacteria 2797
45 Ga0105240_10000012 3300009093 Bacteria 496639
46 Ga0105240_10344134 3300009093 Bacteria 1693
47 Ga0105240_10437099 3300009093 Bacteria 1467
48 Ga0111539_10000167 3300009094 Bacteria 75742
49 Ga0114129_10064305 3300009147 Bacteria 5119
50 Ga0105248_10240742 3300009177 Bacteria 2037
51 Ga0105237_10001333 3300009545 Bacteria 32755
52 Ga0123341_1000056 3300009765 Bacteria 48113
53 Ga0123342_1024749 3300009766 Bacteria 3714
54 Ga0157370_10019121 3300013104 Bacteria 6887
55 Ga0182005_1000879 3300015265 Bacteria 13296
56 Ga0209437_100040 3300025233 Bacteria 448096
57 Ga0207425_1005570 3300025245 Bacteria 3570
58 Ga0209677_100948 3300025253 Bacteria 14158
59 Ga0209129_1000016 3300025258 Bacteria 485491
60 Ga0209129_1001027 3300025258 Bacteria 16608
61 Ga0209233_1000051 3300025261 Bacteria 447617
62 Ga0209233_1000146 3300025261 Bacteria 187269
63 Ga0209233_1000216 3300025261 Bacteria 108123
64 Ga0209673_1000005 3300025273 Bacteria 692788
65 Ga0209673_1000023 3300025273 Bacteria 411385
66 Ga0209673_1000797 3300025273 Bacteria 41846
67 Ga0209673_1010190 3300025273 Bacteria 3985
68 Ga0209130_1000013 3300025284 Bacteria 412810
69 Ga0209675_1011924 3300025291 Bacteria 2841
70 Ga0209025_1002393 3300025294 Bacteria 20037
71 Ga0209025_1004618 3300025294 Bacteria 11782
72 Ga0209564_1000112 3300025295 Bacteria 211939
73 Ga0209564_1007010 3300025295 Bacteria 5910
74 Ga0209758_1001534 3300025297 Bacteria 26574
75 Ga0209758_1003167 3300025297 Bacteria 15436
76 Ga0209050_1022077 3300025298 Bacteria 2294
77 Ga0209256_1000485 3300025299 Bacteria 58920
78 Ga0209256_1000549 3300025299 Bacteria 53852
79 Ga0209256_1018319 3300025299 Bacteria 2282
80 Ga0207426_1000022 3300025302 Bacteria 547377
81 Ga0207426_1000355 3300025302 Bacteria 83450
82 Ga0209051_1000119 3300025303 Bacteria 148746
83 Ga0209257_1023179 3300025304 Bacteria 2190
84 Ga0207656_10034827 3300025321 Bacteria 2104
85 Ga0207642_10022489 3300025899 Bacteria 2502
86 Ga0207695_10000120 3300025913 Bacteria 234247
87 Ga0207695_10012471 3300025913 Bacteria 10200
88 Ga0207695_10295760 3300025913 Bacteria 1511
89 Ga0207671_10000755 3300025914 Bacteria 41010
90 Ga0207669_10018687 3300025937 Bacteria 3590
91 Ga0207704_10035457 3300025938 Bacteria 2859
92 Ga0207428_10000055 3300027907 Bacteria 166460
93 Ga0268265_10150630 3300028380 Bacteria 1961
94 Ga0265318_10003621 3300028577 Bacteria 7718
95 Ga0307515_10007811 3300028794 Bacteria 21042
96 Ga0307515_10238826 3300028794 Bacteria 1593
97 Ga0307513_10008730 3300031456 Bacteria 12909
98 Ga0265314_10024925 3300031711 Bacteria 4523
99 Ga0307415_100115609 3300032126 Bacteria 2000
100 Ga0451841_0267452 3300041498 Bacteria 1966
101 Ga0451847_0653548 3300041503 Bacteria 1518
102 Ga0451851_0227649 3300041507 Bacteria 2165
103 Ga0451843_0244535 3300041509 Bacteria 1609
104 Ga0451855_0274739 3300041511 Bacteria 1553
105 Ga0466963_0008728 3300044694 Bacteria 6085
106 Ga0466970_0001801 3300044765 Bacteria 10325
107 Ga0466957_0049471 3300044842 Bacteria 2556
108 Ga0466967_0160702 3300045976 Bacteria 2108
109 Ga0466967_0258718 3300045976 Bacteria 1665
110 Ga0495638_0000221 3300046460 Bacteria 79300
111 Ga0495662_0006894 3300046476 Bacteria 5643
112 Ga0495662_0009308 3300046476 Bacteria 4819
113 Ga0495583_0002418 3300046506 Bacteria 16034
114 Ga0495606_0005405 3300046507 Bacteria 12245
115 Ga0495606_0125236 3300046507 Bacteria 1533
116 Ga0495648_0046794 3300046524 Bacteria 2679
117 Ga0495648_0060867 3300046524 Bacteria 2244
118 Ga0495609_0038382 3300046538 Bacteria 2159
119 Ga0495625_0059707 3300046660 Bacteria 2704
120 Ga0495672_0031605 3300047320 Bacteria 3304
121 Ga0495686_0000547 3300047472 Bacteria 53728
122 Ga0495686_0046323 3300047472 Bacteria 2749
123 Ga0495626_0029582 3300048091 Bacteria 2650
124 Ga0496101_0047738 3300048904 Bacteria 3075
125 Ga0496101_0186586 3300048904 Bacteria 1599
126 Ga0496116_0026027 3300048919 Bacteria 4287
127 Ga0496116_0046446 3300048919 Bacteria 2931
128 Ga0496117_0022658 3300048920 Bacteria 5033
129 Ga0496117_0071649 3300048920 Bacteria 2321
130 Ga0496118_0000678 3300048921 Bacteria 55390
131 Ga0496118_0025744 3300048921 Bacteria 5033
132 Ga0496121_0006740 3300048924 Bacteria 14095
133 Ga0496121_0040375 3300048924 Bacteria 4095
134 Ga0496121_0041028 3300048924 Bacteria 4052
135 Ga0496122_0013405 3300048925 Bacteria 8026
136 Ga0496123_0030462 3300048926 Bacteria 3949
137 Ga0496124_0006040 3300048927 Bacteria 13343
138 Ga0496125_0019854 3300048928 Bacteria 6322
139 Ga0496126_0049046 3300048929 Bacteria 3856
140 Ga0496126_0112746 3300048929 Bacteria 2367
141 Ga0496126_0243400 3300048929 Bacteria 1502
142 Ga0501033_0048227 3300049570 Bacteria 3164
143 Ga0501034_0041533 3300049571 Bacteria 4654
144 Ga0501034_0118885 3300049571 Bacteria 2629
145 Ga0501067_0153425 3300049583 Unclassified 1283
146 Ga0501068_0068263 3300049584 Bacteria 2167
147 Ga0501070_0005092 3300049586 Bacteria 11201
148 Ga0501073_0093721 3300049589 Bacteria 2086
149 Ga0501073_0111525 3300049589 Bacteria 1897
150 Ga0501080_0104183 3300049742 Bacteria 2631
151 Ga0501044_0190620 3300049823 Bacteria 2013
152 nmdc:mga03683_53143_c1 3300050489 Bacteria 1695
153 nmdc:mga06r32_534738_c1 3300050510 Bacteria 1147
154 nmdc:mga08y16_37_c1 3300050511 Bacteria 150340
155 Ga0500594_0024308 3300053118 Bacteria 1543
156 Ga0500607_106364 3300053121 Bacteria 1384
157 Ga0500618_002873 3300053125 Bacteria 6177
158 Ga0500658_0001270 3300053134 Bacteria 10234
159 Ga0500568_0005923 3300053139 Bacteria 6223
160 Ga0500590_000016 3300053148 Bacteria 47232
161 Ga0500616_0000852 3300053153 Bacteria 33854
162 Ga0500616_0030779 3300053153 Bacteria 2944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10008730 Ga0307513_100087302 334
2 3300050510 nmdc:mga06r32_534738_c1 nmdc:mga06r32_534738_c1_50_1135 359
3 3300048929 Ga0496126_0243400 Ga0496126_0243400_249_1484 372
4 3300049583 Ga0501067_0153425 Ga0501067_0153425_78_1229 373
5 3300028794 Ga0307515_10238826 Ga0307515_102388261 383
6 iso_pu_bacteria 2889790730 2889792034 390
7 iso_pu_bacteria 2889914905 2889918337 390
8 3300049571 Ga0501034_0041533 Ga0501034_0041533_2758_3960 398
9 3300003316 rootH1_10016241 rootH1_100162413 399
10 3300003322 rootL2_10027409 rootL2_1002740916 399
11 3300003323 rootH1_10013822 rootH1_100138223 399
12 3300009093 Ga0105240_10344134 Ga0105240_103441341 399
13 3300009093 Ga0105240_10437099 Ga0105240_104370991 399
14 iso_pu_bacteria 2510461069 2510843599 399
15 3300046506 Ga0495583_0002418 Ga0495583_0002418_11927_13132 401
16 3300049586 Ga0501070_0005092 Ga0501070_0005092_7732_8991 401
17 3300049589 Ga0501073_0093721 Ga0501073_0093721_44_1303 401
18 3300006844 Ga0075428_100009938 Ga0075428_10000993810 402
19 3300009147 Ga0114129_10064305 Ga0114129_100643055 402
20 3300025913 Ga0207695_10012471 Ga0207695_1001247117 402
21 3300025913 Ga0207695_10295760 Ga0207695_102957602 402
22 iso_pu_bacteria 2643221558 2643810930 402
23 iso_pu_bacteria 2838074704 2838075571 402
24 iso_pu_bacteria 2896384573 2896388865 402
25 iso_pu_bacteria 2529292951 2530644835 403
26 iso_pu_bacteria 2718217927 2719388718 403
27 iso_pu_bacteria 2718218423 2721403345 403
28 iso_pu_bacteria 2721755809 2724035702 403
29 iso_pu_bacteria 2791355262 2793332859 403
30 iso_pu_bacteria 2791355267 2793366759 403
31 iso_pu_bacteria 2841859092 2841862943 403
32 iso_pu_bacteria 2842395702 2842396666 403
33 iso_pu_bacteria 2842515876 2842519540 403
34 iso_pu_bacteria 2933011516 2933011853 403
35 iso_pu_bacteria 8005275841 8005277441 403
36 iso_pu_bacteria 8005289223 8005289411 403
37 iso_pu_bacteria 8005695170 8005696853 403
38 iso_pu_bacteria 8018176218 8018182948 403
39 iso_pu_bacteria 8056375014 8056375381 403
40 iso_pu_bacteria 8056382006 8056383092 403
41 iso_pu_bacteria 2509276021 2509385766 404
42 iso_pu_bacteria 2509276033 2509448180 404
43 iso_pu_bacteria 2510065019 2510136751 404
44 iso_pu_bacteria 2510461076 2510899984 404
45 iso_pu_bacteria 2510461076 2510900580 404
46 iso_pu_bacteria 2510917022 2511132953 404
47 iso_pu_bacteria 2513237084 2513569374 404
48 iso_pu_bacteria 2513237085 2513576695 404
49 iso_pu_bacteria 2513237093 2513631625 404
50 iso_pu_bacteria 2513237103 2513710040 404
51 iso_pu_bacteria 2513237144 2513910014 404
52 iso_pu_bacteria 2513237162 2514021443 404
53 iso_pu_bacteria 2515075009 2515115326 404
54 iso_pu_bacteria 2515154113 2515635946 404
55 iso_pu_bacteria 2515154114 2515644789 404
56 iso_pu_bacteria 2515154116 2515658088 404
57 iso_pu_bacteria 2515154134 2515742187 404
58 iso_pu_bacteria 2516653077 2517041679 404
59 iso_pu_bacteria 2516653085 2517080738 404
60 iso_pu_bacteria 2517093000 2517099136 404
61 iso_pu_bacteria 2517287029 2517411035 404
62 iso_pu_bacteria 2524023209 2524461626 404
63 iso_pu_bacteria 2524023209 2524461764 404
64 iso_pu_bacteria 2582581299 2585233668 404
65 iso_pu_bacteria 2582581307 2585272332 404
66 iso_pu_bacteria 2582581308 2585278400 404
67 iso_pu_bacteria 2582581315 2585324756 404
68 iso_pu_bacteria 2582581316 2585332189 404
69 iso_pu_bacteria 2585427526 2585524420 404
70 iso_pu_bacteria 2585427527 2585531944 404
71 iso_pu_bacteria 2585427528 2585538674 404
72 iso_pu_bacteria 2585427530 2585552303 404
73 iso_pu_bacteria 2585427531 2585561604 404
74 iso_pu_bacteria 2585427593 2585836627 404
75 iso_pu_bacteria 2585427594 2585847911 404
76 iso_pu_bacteria 2585427609 2585906832 404
77 iso_pu_bacteria 2585428125 2587982253 404
78 iso_pu_bacteria 2615840624 2616295018 404
79 iso_pu_bacteria 2615840626 2616307918 404
80 iso_pu_bacteria 2615840698 2616553153 404
81 iso_pu_bacteria 2617270742 2617381768 404
82 iso_pu_bacteria 2617270742 2617382397 404
83 iso_pu_bacteria 2643221599 2644003673 404
84 iso_pu_bacteria 2667528174 2671112913 404
85 iso_pu_bacteria 2718217882 2719183956 404
86 iso_pu_bacteria 2718217997 2719668242 404
87 iso_pu_bacteria 2718218009 2719728397 404
88 iso_pu_bacteria 2718218199 2720495005 404
89 iso_pu_bacteria 2718218232 2720611324 404
90 iso_pu_bacteria 2718218233 2720616494 404
91 iso_pu_bacteria 2718218235 2720629579 404
92 iso_pu_bacteria 2718218269 2720772152 404
93 iso_pu_bacteria 2718218363 2721145258 404
94 iso_pu_bacteria 2718218365 2721156002 404
95 iso_pu_bacteria 2718218366 2721167345 404
96 iso_pu_bacteria 2721755514 2722838323 404
97 iso_pu_bacteria 2721755556 2723029576 404
98 iso_pu_bacteria 2721755684 2723563182 404
99 iso_pu_bacteria 2721755685 2723571177 404
100 iso_pu_bacteria 2721755810 2724042591 404
101 iso_pu_bacteria 2721755819 2724086972 404
102 iso_pu_bacteria 2721755822 2724107128 404
103 iso_pu_bacteria 2721755823 2724107934 404
104 iso_pu_bacteria 2724679232 2725951570 404
105 iso_pu_bacteria 2728369352 2730105890 404
106 iso_pu_bacteria 2728369365 2730162096 404
107 iso_pu_bacteria 2728369397 2730301109 404
108 iso_pu_bacteria 2738541293 2738803445 404
109 iso_pu_bacteria 2738541333 2739034099 404
110 iso_pu_bacteria 2765235942 2766068619 404
111 iso_pu_bacteria 2791355259 2793314827 404
112 iso_pu_bacteria 2791355260 2793321484 404
113 iso_pu_bacteria 2791355261 2793325855 404
114 iso_pu_bacteria 2791355263 2793340347 404
115 iso_pu_bacteria 2791355264 2793345960 404
116 iso_pu_bacteria 2791355266 2793357998 404
117 iso_pu_bacteria 2802429605 2805927862 404
118 iso_pu_bacteria 2802429606 2805933709 404
119 iso_pu_bacteria 2802429633 2806042896 404
120 iso_pu_bacteria 2802429633 2806043284 404
121 iso_pu_bacteria 2802429634 2806050849 404
122 iso_pu_bacteria 2802429635 2806057983 404
123 iso_pu_bacteria 2802429636 2806065304 404
124 iso_pu_bacteria 2802429637 2806076787 404
125 iso_pu_bacteria 2818991448 2819608015 404
126 iso_pu_bacteria 2818991448 2819613402 404
127 iso_pu_bacteria 2818991453 2819640187 404
128 iso_pu_bacteria 2838016132 2838019268 404
129 iso_pu_bacteria 2838022645 2838026667 404
130 iso_pu_bacteria 2838029111 2838033755 404
131 iso_pu_bacteria 2838048938 2838050334 404
132 iso_pu_bacteria 2838061910 2838063037 404
133 iso_pu_bacteria 2838068647 2838071598 404
134 iso_pu_bacteria 2838668709 2838673667 404
135 iso_pu_bacteria 2838680041 2838684187 404
136 iso_pu_bacteria 2838686498 2838692293 404
137 iso_pu_bacteria 2838694306 2838699677 404
138 iso_pu_bacteria 2838701080 2838705300 404
139 iso_pu_bacteria 2838707686 2838712037 404
140 iso_pu_bacteria 2838729681 2838734289 404
141 iso_pu_bacteria 2838742623 2838746741 404
142 iso_pu_bacteria 2841851746 2841853432 404
143 iso_pu_bacteria 2841864319 2841869186 404
144 iso_pu_bacteria 2842077413 2842081653 404
145 iso_pu_bacteria 2842110456 2842114649 404
146 iso_pu_bacteria 2842118031 2842122229 404
147 iso_pu_bacteria 2842146304 2842150210 404
148 iso_pu_bacteria 2842156927 2842161483 404
149 iso_pu_bacteria 2842163707 2842167312 404
150 iso_pu_bacteria 2842180545 2842185716 404
151 iso_pu_bacteria 2842192696 2842195453 404
152 iso_pu_bacteria 2842198810 2842202270 404
153 iso_pu_bacteria 2842217011 2842223136 404
154 iso_pu_bacteria 2842229732 2842234113 404
155 iso_pu_bacteria 2842237096 2842241449 404
156 iso_pu_bacteria 2842243621 2842246414 404
157 iso_pu_bacteria 2842250916 2842254896 404
158 iso_pu_bacteria 2842257432 2842260726 404
159 iso_pu_bacteria 2842264693 2842269376 404
160 iso_pu_bacteria 2842271015 2842276015 404
161 iso_pu_bacteria 2842291075 2842295309 404
162 iso_pu_bacteria 2842298080 2842303206 404
163 iso_pu_bacteria 2842298080 2842303238 404
164 iso_pu_bacteria 2842304105 2842308666 404
165 iso_pu_bacteria 2842311132 2842311996 404
166 iso_pu_bacteria 2842317721 2842319215 404
167 iso_pu_bacteria 2842341865 2842344272 404
168 iso_pu_bacteria 2842357229 2842363681 404
169 iso_pu_bacteria 2842363717 2842368177 404
170 iso_pu_bacteria 2842370503 2842375852 404
171 iso_pu_bacteria 2842377471 2842381916 404
172 iso_pu_bacteria 2842384541 2842388778 404
173 iso_pu_bacteria 2842422224 2842425231 404
174 iso_pu_bacteria 2842428310 2842432667 404
175 iso_pu_bacteria 2842434925 2842438885 404
176 iso_pu_bacteria 2842441272 2842445515 404
177 iso_pu_bacteria 2842447887 2842449969 404
178 iso_pu_bacteria 2842462802 2842467760 404
179 iso_pu_bacteria 2842469257 2842473500 404
180 iso_pu_bacteria 2842475841 2842480502 404
181 iso_pu_bacteria 2842482326 2842484075 404
182 iso_pu_bacteria 2842489311 2842491662 404
183 iso_pu_bacteria 2842495871 2842499732 404
184 iso_pu_bacteria 2842502639 2842507217 404
185 iso_pu_bacteria 2844454524 2844460846 404
186 iso_pu_bacteria 2852387548 2852394441 404
187 iso_pu_bacteria 2857516855 2857519455 404
188 iso_pu_bacteria 2919408235 2919412701 404
189 iso_pu_bacteria 2933570622 2933575203 404
190 iso_pu_bacteria 2933586486 2933590495 404
191 iso_pu_bacteria 2933599457 2933602397 404
192 iso_pu_bacteria 2935894831 2935898472 404
193 iso_pu_bacteria 2935901341 2935906904 404
194 iso_pu_bacteria 2936367885 2936370430 404
195 iso_pu_bacteria 2936375103 2936378095 404
196 iso_pu_bacteria 2936381700 2936385489 404
197 iso_pu_bacteria 2996893221 2996896761 404
198 iso_pu_bacteria 3005416602 3005421130 404
199 iso_pu_bacteria 3005452660 3005458304 404
200 iso_pu_bacteria 639633055 639651970 404
201 iso_pu_bacteria 8005282627 8005288042 404
202 iso_pu_bacteria 8005301065 8005305257 404
203 iso_pu_bacteria 8005307578 8005313361 404
204 iso_pu_bacteria 8005314921 8005319135 404
205 iso_pu_bacteria 8005376324 8005382104 404
206 iso_pu_bacteria 8005382845 8005388647 404
207 iso_pu_bacteria 8005395548 8005397992 404
208 iso_pu_bacteria 8005430974 8005431265 404
209 iso_pu_bacteria 8005460587 8005467054 404
210 iso_pu_bacteria 8005484373 8005489542 404
211 iso_pu_bacteria 8005497431 8005503258 404
212 iso_pu_bacteria 8005556819 8005561928 404
213 iso_pu_bacteria 8005563573 8005567333 404
214 iso_pu_bacteria 8005570704 8005575749 404
215 iso_pu_bacteria 8005619151 8005625403 404
216 iso_pu_bacteria 8005626139 8005630385 404
217 iso_pu_bacteria 8005645114 8005645473 404
218 iso_pu_bacteria 8005645114 8005650408 404
219 iso_pu_bacteria 8005668836 8005675177 404
220 iso_pu_bacteria 8005682033 8005683448 404
221 iso_pu_bacteria 8005688590 8005689279 404
222 iso_pu_bacteria 8018127388 8018127790 404
223 iso_pu_bacteria 8018163183 8018166155 404
224 iso_pu_bacteria 8023680758 8023688318 404
225 iso_pu_bacteria 8024479707 8024483954 404
226 iso_pu_bacteria 8024486573 8024487325 404
227 iso_pu_bacteria 8024486573 8024488935 404
228 iso_pu_bacteria 8024501048 8024504011 404
229 iso_pu_bacteria 8046767195 8046774731 404
230 iso_pu_bacteria 8057575449 8057578646 404
231 iso_pu_bacteria 8057874678 8057880840 404
232 3300009094 Ga0111539_10000167 Ga0111539_1000016716 405
233 3300027907 Ga0207428_10000055 Ga0207428_10000055126 405
234 3300028794 Ga0307515_10007811 Ga0307515_1000781116 405
235 3300050511 nmdc:mga08y16_37_c1 nmdc:mga08y16_37_c1_36552_37775 405
236 iso_pu_bacteria 2582581306 2585266048 405
237 3300002773 JGI25152J39213_1001841 JGI25152J39213_10018414 407
238 3300003187 JGI25151J46595_10009496 JGI25151J46595_100094963 407
239 3300003322 rootL2_10032165 rootL2_100321651 407
240 3300003771 Ga0055526_1023639 Ga0055526_10236393 407
241 3300003775 Ga0055524_1002762 Ga0055524_10027629 407
242 3300003790 Ga0055528_1000109 Ga0055528_100010953 407
243 3300003790 Ga0055528_1019456 Ga0055528_10194563 407
244 3300003792 Ga0055540_1000197 Ga0055540_100019715 407
245 3300005262 Ga0065165_1010980 Ga0065165_10109802 407
246 3300025258 Ga0209129_1000016 Ga0209129_100001687 407
247 3300025273 Ga0209673_1000005 Ga0209673_1000005479 407
248 3300025273 Ga0209673_1000797 Ga0209673_10007977 407
249 3300025294 Ga0209025_1002393 Ga0209025_100239316 407
250 3300025294 Ga0209025_1004618 Ga0209025_100461812 407
251 3300025295 Ga0209564_1007010 Ga0209564_10070104 407
252 3300025298 Ga0209050_1022077 Ga0209050_10220772 407
253 3300025299 Ga0209256_1000549 Ga0209256_100054918 407
254 3300025303 Ga0209051_1000119 Ga0209051_100011985 407
255 3300025304 Ga0209257_1023179 Ga0209257_10231793 407
256 3300048925 Ga0496122_0013405 Ga0496122_0013405_188_1411 407
257 3300048926 Ga0496123_0030462 Ga0496123_0030462_1882_3105 407
258 3300049570 Ga0501033_0048227 Ga0501033_0048227_577_1812 407
259 iso_pu_bacteria 2939669807 2939671727 407
260 3300002737 JGI25162J39368_1000365 JGI25162J39368_100036529 408
261 3300003187 JGI25151J46595_10000508 JGI25151J46595_1000050812 408
262 3300003214 JGI25165J46597_1001675 JGI25165J46597_100167512 408
263 3300003214 JGI25165J46597_1003343 JGI25165J46597_10033434 408
264 3300003215 JGI25153J46596_10006031 JGI25153J46596_100060312 408
265 3300003320 rootH2_10063918 rootH2_1006391820 408
266 3300003322 rootL2_10061222 rootL2_1006122215 408
267 3300003323 rootH1_10243441 rootH1_102434412 408
268 3300003354 JGI25160J50197_1000014 JGI25160J50197_100001477 408
269 3300003354 JGI25160J50197_1005949 JGI25160J50197_10059493 408
270 3300003374 JGI25161J50226_1000061 JGI25161J50226_100006177 408
271 3300003374 JGI25161J50226_1008166 JGI25161J50226_10081661 408
272 3300003771 Ga0055526_1000991 Ga0055526_100099120 408
273 3300003771 Ga0055526_1004842 Ga0055526_10048427 408
274 3300003771 Ga0055526_1013723 Ga0055526_10137233 408
275 3300003790 Ga0055528_1000206 Ga0055528_100020634 408
276 3300004625 Ga0055543_1000005 Ga0055543_1000005156 408
277 3300004625 Ga0055543_1000578 Ga0055543_100057818 408
278 3300005262 Ga0065165_1000126 Ga0065165_100012668 408
279 3300005353 Ga0070669_100026661 Ga0070669_1000266613 408
280 3300005356 Ga0070674_100004659 Ga0070674_1000046592 408
281 3300005718 Ga0068866_10020742 Ga0068866_100207421 408
282 3300005834 Ga0068851_10070460 Ga0068851_100704601 408
283 3300005844 Ga0068862_100171839 Ga0068862_1001718393 408
284 3300005981 Ga0081538_10000693 Ga0081538_1000069318 408
285 3300005983 Ga0081540_1036168 Ga0081540_10361681 408
286 3300006042 Ga0075368_10017504 Ga0075368_100175042 408
287 3300006353 Ga0075370_10007207 Ga0075370_100072075 408
288 3300006844 Ga0075428_100152221 Ga0075428_1001522212 408
289 3300006844 Ga0075428_100300195 Ga0075428_1003001953 408
290 3300006881 Ga0068865_100053657 Ga0068865_1000536572 408
291 3300009093 Ga0105240_10000012 Ga0105240_1000001294 408
292 3300009177 Ga0105248_10240742 Ga0105248_102407422 408
293 3300009545 Ga0105237_10001333 Ga0105237_100013335 408
294 3300009765 Ga0123341_1000056 Ga0123341_100005614 408
295 3300009766 Ga0123342_1024749 Ga0123342_10247494 408
296 3300013104 Ga0157370_10019121 Ga0157370_100191215 408
297 3300015265 Ga0182005_1000879 Ga0182005_10008797 408
298 3300025233 Ga0209437_100040 Ga0209437_100040286 408
299 3300025245 Ga0207425_1005570 Ga0207425_10055704 408
300 3300025253 Ga0209677_100948 Ga0209677_1009486 408
301 3300025258 Ga0209129_1001027 Ga0209129_10010272 408
302 3300025261 Ga0209233_1000051 Ga0209233_1000051287 408
303 3300025261 Ga0209233_1000146 Ga0209233_1000146118 408
304 3300025261 Ga0209233_1000216 Ga0209233_100021666 408
305 3300025273 Ga0209673_1000023 Ga0209673_100002358 408
306 3300025273 Ga0209673_1010190 Ga0209673_10101903 408
307 3300025284 Ga0209130_1000013 Ga0209130_1000013228 408
308 3300025291 Ga0209675_1011924 Ga0209675_10119242 408
309 3300025295 Ga0209564_1000112 Ga0209564_100011275 408
310 3300025297 Ga0209758_1001534 Ga0209758_100153414 408
311 3300025297 Ga0209758_1003167 Ga0209758_10031674 408
312 3300025299 Ga0209256_1000485 Ga0209256_100048543 408
313 3300025299 Ga0209256_1018319 Ga0209256_10183192 408
314 3300025302 Ga0207426_1000022 Ga0207426_1000022153 408
315 3300025302 Ga0207426_1000355 Ga0207426_100035578 408
316 3300025321 Ga0207656_10034827 Ga0207656_100348272 408
317 3300025899 Ga0207642_10022489 Ga0207642_100224892 408
318 3300025913 Ga0207695_10000120 Ga0207695_10000120120 408
319 3300025914 Ga0207671_10000755 Ga0207671_1000075517 408
320 3300025937 Ga0207669_10018687 Ga0207669_100186872 408
321 3300025938 Ga0207704_10035457 Ga0207704_100354572 408
322 3300028380 Ga0268265_10150630 Ga0268265_101506302 408
323 3300028577 Ga0265318_10003621 Ga0265318_100036212 408
324 3300031711 Ga0265314_10024925 Ga0265314_100249254 408
325 3300032126 Ga0307415_100115609 Ga0307415_1001156092 408
326 3300041498 Ga0451841_0267452 Ga0451841_0267452_182_1408 408
327 3300041503 Ga0451847_0653548 Ga0451847_0653548_146_1372 408
328 3300041507 Ga0451851_0227649 Ga0451851_0227649_540_1766 408
329 3300041509 Ga0451843_0244535 Ga0451843_0244535_91_1317 408
330 3300041511 Ga0451855_0274739 Ga0451855_0274739_157_1383 408
331 3300044694 Ga0466963_0008728 Ga0466963_0008728_594_1820 408
332 3300044765 Ga0466970_0001801 Ga0466970_0001801_4828_6054 408
333 3300044842 Ga0466957_0049471 Ga0466957_0049471_596_1822 408
334 3300045976 Ga0466967_0160702 Ga0466967_0160702_667_1893 408
335 3300045976 Ga0466967_0258718 Ga0466967_0258718_370_1632 408
336 3300046460 Ga0495638_0000221 Ga0495638_0000221_45223_46449 408
337 3300046476 Ga0495662_0006894 Ga0495662_0006894_3209_4435 408
338 3300046476 Ga0495662_0009308 Ga0495662_0009308_326_1576 408
339 3300046507 Ga0495606_0005405 Ga0495606_0005405_9957_11183 408
340 3300046507 Ga0495606_0125236 Ga0495606_0125236_86_1312 408
341 3300046524 Ga0495648_0046794 Ga0495648_0046794_915_2141 408
342 3300046524 Ga0495648_0060867 Ga0495648_0060867_92_1318 408
343 3300046538 Ga0495609_0038382 Ga0495609_0038382_608_1834 408
344 3300046660 Ga0495625_0059707 Ga0495625_0059707_801_2027 408
345 3300047320 Ga0495672_0031605 Ga0495672_0031605_565_1791 408
346 3300047472 Ga0495686_0000547 Ga0495686_0000547_26815_28041 408
347 3300047472 Ga0495686_0046323 Ga0495686_0046323_59_1285 408
348 3300048091 Ga0495626_0029582 Ga0495626_0029582_1319_2545 408
349 3300048904 Ga0496101_0047738 Ga0496101_0047738_380_1606 408
350 3300048904 Ga0496101_0186586 Ga0496101_0186586_338_1564 408
351 3300048919 Ga0496116_0026027 Ga0496116_0026027_1873_3099 408
352 3300048919 Ga0496116_0046446 Ga0496116_0046446_460_1686 408
353 3300048920 Ga0496117_0022658 Ga0496117_0022658_969_2195 408
354 3300048920 Ga0496117_0071649 Ga0496117_0071649_204_1445 408
355 3300048921 Ga0496118_0000678 Ga0496118_0000678_41351_42592 408
356 3300048921 Ga0496118_0025744 Ga0496118_0025744_2839_4065 408
357 3300048924 Ga0496121_0006740 Ga0496121_0006740_6307_7533 408
358 3300048924 Ga0496121_0040375 Ga0496121_0040375_879_2105 408
359 3300048924 Ga0496121_0041028 Ga0496121_0041028_387_1613 408
360 3300048927 Ga0496124_0006040 Ga0496124_0006040_10700_11926 408
361 3300048928 Ga0496125_0019854 Ga0496125_0019854_3340_4566 408
362 3300048929 Ga0496126_0049046 Ga0496126_0049046_404_1642 408
363 3300048929 Ga0496126_0112746 Ga0496126_0112746_825_2051 408
364 3300049571 Ga0501034_0118885 Ga0501034_0118885_1192_2418 408
365 3300049584 Ga0501068_0068263 Ga0501068_0068263_257_1483 408
366 3300049589 Ga0501073_0111525 Ga0501073_0111525_244_1470 408
367 3300049742 Ga0501080_0104183 Ga0501080_0104183_1261_2487 408
368 3300049823 Ga0501044_0190620 Ga0501044_0190620_691_1917 408
369 3300050489 nmdc:mga03683_53143_c1 nmdc:mga03683_53143_c1_106_1332 408
370 3300053118 Ga0500594_0024308 Ga0500594_0024308_180_1406 408
371 3300053121 Ga0500607_106364 Ga0500607_106364_55_1281 408
372 3300053125 Ga0500618_002873 Ga0500618_002873_3062_4288 408
373 3300053134 Ga0500658_0001270 Ga0500658_0001270_1664_2890 408
374 3300053139 Ga0500568_0005923 Ga0500568_0005923_662_1888 408
375 3300053148 Ga0500590_000016 Ga0500590_000016_26017_27243 408
376 3300053153 Ga0500616_0000852 Ga0500616_0000852_4320_5546 408
377 3300053153 Ga0500616_0030779 Ga0500616_0030779_126_1352 408

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14759

Reductase_C

Reductase C-terminal

327

411

0.98

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

4

308

0.94

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

150

233

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ef6-assembly1.cif.gz_A crystal structure of toluene 2,3-dioxygenase reductase 0.9389 2 405
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.9382 1 404
3ef6-assembly1.cif.gz_A crystal structure of toluene 2,3-dioxygenase reductase 0.9344 2 405
4h4u-assembly1.cif.gz_A-2 crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form) 0.9343 4 408
4h4x-assembly1.cif.gz_A crystal structure of ferredoxin reductase, bpha4 e175a/t176r/q177g mutant (oxidized form) 0.9335 4 408
ID Description Score Start End Superfamily
4k8dA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9561 142 233 3.50.50.60
2yquB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9554 142 235 3.50.50.60
5x1yA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9432 142 233 3.50.50.60
2rabB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9431 142 232 3.50.50.60
3lb8B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9428 124 235 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A527XJR8-F1-model_v4 Ferredoxin reductase 0.9936 296 380
AF-K0VW54-F1-model_v4 FAD-dependent pyridine nucleotide-disulfide oxidoreductase 0.976 1 248 GO:0005737
GO:0016651
GO:0046872
GO:0051537
AF-A0A529WZ47-F1-model_v4 Ferredoxin reductase 0.9754 1 354 GO:0005737
GO:0016651
AF-A0A3S2PDA6-F1-model_v4 deleted 0.9718 36 408
AF-A0A527XJR8-F1-model_v4 Ferredoxin reductase 0.9709 296 380

Feature Viewer

pLDDT pTM Quality
93.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map