F427562

General Info

Members Datasets Scaffolds Average Seq Length
377 218 754 241

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10020315|JGI24751J29686_100203152
Length 269
Sequence MSGHPAAANGTRAGARALXPVAVVSLLLLMTAQDAAAAQLKVLAGSAIEPAMAVLVPQFEQASGHRIVFDSDGAIGAMTERVRRGEAADVVIVSGAQIDLLQNEGKVIPGSRADIAKVGVGVFVRKGAPKPDISSVDAFRRTMLAARSIGWNDPAAGAPVSLYLIGLLERLGIADAMKPKTTAFKQRSERFAAVARGDVEIGFNQISEIIAAPGVDLVGPLPAPIQNHTLFAGGIAAASKEQGAAKTLLRFLSSPAAQATWKAKGFEAP

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.77
Nodule 0.27
Rhizoplane 5.84
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10020315 3300002459 Bacteria 1375
2 rootH2_10312241 3300003320 Bacteria 1171
3 rootL2_10105744 3300003322 Bacteria 2306
4 JGI25404J52841_10000752 3300003659 Bacteria 5085
5 Ga0070676_10340536 3300005328 Bacteria 1028
6 Ga0070670_100013544 3300005331 Bacteria 6989
7 Ga0068869_100238993 3300005334 Bacteria 1446
8 Ga0070666_10111664 3300005335 Bacteria 1891
9 Ga0070680_100139770 3300005336 Bacteria 2030
10 Ga0070680_100617986 3300005336 Bacteria 930
11 Ga0070691_10061940 3300005341 Bacteria 1801
12 Ga0070668_100203683 3300005347 Bacteria 1625
13 Ga0070669_100778958 3300005353 Bacteria 812
14 Ga0070671_100132158 3300005355 Bacteria 2102
15 Ga0070674_100114739 3300005356 Bacteria 1984
16 Ga0070673_100419668 3300005364 Bacteria 1199
17 Ga0070709_10216567 3300005434 Bacteria 1364
18 Ga0070714_100254806 3300005435 Bacteria 1624
19 Ga0070713_100317301 3300005436 Bacteria 1438
20 Ga0070713_100709383 3300005436 Bacteria 961
21 Ga0070710_10437754 3300005437 Bacteria 883
22 Ga0070711_100214014 3300005439 Bacteria 1494
23 Ga0070711_100260717 3300005439 Bacteria 1363
24 Ga0070708_100159829 3300005445 Bacteria 2099
25 Ga0070708_100542052 3300005445 Bacteria 1098
26 Ga0070663_100038589 3300005455 Bacteria 3332
27 Ga0070662_100199026 3300005457 Bacteria 1588
28 Ga0070707_100002826 3300005468 Bacteria 16514
29 Ga0070707_100281212 3300005468 Bacteria 1617
30 Ga0070698_100459979 3300005471 Unclassified 1208
31 Ga0070698_100594025 3300005471 Bacteria 1047
32 Ga0070679_100492850 3300005530 Bacteria 1169
33 Ga0070684_100410032 3300005535 Bacteria 1250
34 Ga0070686_100075002 3300005544 Bacteria 2224
35 Ga0070686_100111226 3300005544 Bacteria 1867
36 Ga0070695_100309338 3300005545 Bacteria 1171
37 Ga0070665_100073605 3300005548 Bacteria 3422
38 Ga0070704_100065771 3300005549 Bacteria 2611
39 Ga0068855_100927184 3300005563 Unclassified 919
40 Ga0068852_100419873 3300005616 Unclassified 1319
41 Ga0068859_100022826 3300005617 Bacteria 6273
42 Ga0068859_100439632 3300005617 Bacteria 1400
43 Ga0068861_100115020 3300005719 Bacteria 2161
44 Ga0068863_100114190 3300005841 Bacteria 2573
45 Ga0068858_100513597 3300005842 Bacteria 1158
46 Ga0068860_100398511 3300005843 Bacteria 1361
47 Ga0068860_100570528 3300005843 Unclassified 1135
48 Ga0081455_10000031 3300005937 Bacteria 146486
49 Ga0081455_10056126 3300005937 Bacteria 3346
50 Ga0081540_1000078 3300005983 Bacteria 105731
51 Ga0075368_10015168 3300006042 Bacteria 2854
52 Ga0075363_100006929 3300006048 Bacteria 5182
53 Ga0075363_100072606 3300006048 Bacteria 1871
54 Ga0075363_100081640 3300006048 Bacteria 1769
55 Ga0075364_10078680 3300006051 Bacteria 2178
56 Ga0075364_10156204 3300006051 Bacteria 1539
57 Ga0075367_10003679 3300006178 Bacteria 7363
58 Ga0075367_10058091 3300006178 Bacteria 2302
59 Ga0097621_100189759 3300006237 Bacteria 1779
60 Ga0075370_10032684 3300006353 Bacteria 2910
61 Ga0068871_100303472 3300006358 Bacteria 1402
62 Ga0068871_100312101 3300006358 Bacteria 1382
63 Ga0075428_100083109 3300006844 Bacteria 3494
64 Ga0075431_100340392 3300006847 Bacteria 1510
65 Ga0075433_10244978 3300006852 Bacteria 1591
66 Ga0075434_100683561 3300006871 Bacteria 1044
67 Ga0075434_101125932 3300006871 Unclassified 798
68 Ga0075429_100490030 3300006880 Bacteria 1077
69 Ga0075436_100207312 3300006914 Bacteria 1389
70 Ga0097620_100022825 3300006931 Bacteria 6273
71 Ga0097620_100439630 3300006931 Bacteria 1400
72 Ga0099794_10031535 3300007265 Bacteria 2482
73 Ga0111539_10014069 3300009094 Bacteria 10000
74 Ga0111539_10119627 3300009094 Bacteria 3086
75 Ga0111539_10343888 3300009094 Bacteria 1736
76 Ga0111539_10376921 3300009094 Bacteria 1652
77 Ga0111539_10686773 3300009094 Bacteria 1192
78 Ga0105245_10132729 3300009098 Bacteria 2337
79 Ga0105247_10013836 3300009101 Bacteria 4837
80 Ga0105247_10034321 3300009101 Bacteria 3090
81 Ga0114129_10017522 3300009147 Bacteria 10198
82 Ga0114129_10040644 3300009147 Bacteria 6554
83 Ga0105243_10147051 3300009148 Bacteria 2017
84 Ga0105243_10238654 3300009148 Bacteria 1616
85 Ga0105243_10464943 3300009148 Bacteria 1190
86 Ga0105241_10169998 3300009174 Bacteria 1800
87 Ga0105242_10257455 3300009176 Bacteria 1575
88 Ga0105242_10773265 3300009176 Unclassified 948
89 Ga0105248_10241999 3300009177 Bacteria 2031
90 Ga0105237_10318868 3300009545 Bacteria 1558
91 Ga0105238_10077997 3300009551 Bacteria 3304
92 Ga0105249_10229081 3300009553 Bacteria 1832
93 Ga0099796_10015330 3300010159 Bacteria 2238
94 Ga0105239_10904074 3300010375 Bacteria 1013
95 Ga0105246_10152559 3300011119 Bacteria 1750
96 Ga0157370_10011664 3300013104 Bacteria 9176
97 Ga0157374_10115795 3300013296 Bacteria 2582
98 Ga0157374_10151943 3300013296 Bacteria 2251
99 Ga0157378_10420431 3300013297 Unclassified 1321
100 Ga0157378_11117082 3300013297 Bacteria 826
101 Ga0163162_10835418 3300013306 Unclassified 1037
102 Ga0157375_10295695 3300013308 Bacteria 1782
103 Ga0163163_10384455 3300014325 Bacteria 1461
104 Ga0157380_10386235 3300014326 Bacteria 1323
105 Ga0157380_10843168 3300014326 Unclassified 937
106 Ga0157379_10060216 3300014968 Bacteria 3394
107 Ga0157376_10323293 3300014969 Bacteria 1467
108 Ga0207642_10050168 3300025899 Bacteria 1881
109 Ga0207710_10022295 3300025900 Bacteria 2718
110 Ga0207688_10049686 3300025901 Unclassified 2345
111 Ga0207680_10034442 3300025903 Bacteria 2898
112 Ga0207699_10323171 3300025906 Bacteria 1083
113 Ga0207645_10209780 3300025907 Bacteria 1283
114 Ga0207654_10047311 3300025911 Bacteria 2457
115 Ga0207707_10361015 3300025912 Bacteria 1251
116 Ga0207707_10652846 3300025912 Bacteria 887
117 Ga0207671_10165364 3300025914 Bacteria 1715
118 Ga0207663_10211744 3300025916 Bacteria 1405
119 Ga0207657_10027255 3300025919 Bacteria 5234
120 Ga0207646_10027344 3300025922 Bacteria 5202
121 Ga0207650_10011509 3300025925 Bacteria 6091
122 Ga0207687_10112287 3300025927 Bacteria 2025
123 Ga0207700_10626468 3300025928 Bacteria 958
124 Ga0207690_10198641 3300025932 Unclassified 1521
125 Ga0207706_10041220 3300025933 Bacteria 4094
126 Ga0207686_10188875 3300025934 Bacteria 1467
127 Ga0207709_10329413 3300025935 Bacteria 1146
128 Ga0207669_10140210 3300025937 Bacteria 1677
129 Ga0207711_10160516 3300025941 Bacteria 2034
130 Ga0207679_10230041 3300025945 Bacteria 1565
131 Ga0207712_10131917 3300025961 Bacteria 1905
132 Ga0207658_10394278 3300025986 Bacteria 1215
133 Ga0207678_10036272 3300026067 Bacteria 4292
134 Ga0207641_10363163 3300026088 Unclassified 1383
135 Ga0207676_10013492 3300026095 Bacteria 5869
136 Ga0207675_100206815 3300026118 Bacteria 1886
137 Ga0207683_10169952 3300026121 Unclassified 1974
138 Ga0207683_10747660 3300026121 Bacteria 907
139 Ga0268266_10034595 3300028379 Bacteria 4297
140 Ga0268266_10050742 3300028379 Bacteria 3559
141 Ga0268264_10337720 3300028381 Bacteria 1430
142 Ga0268264_10364847 3300028381 Bacteria 1379
143 Ga0265325_10000036 3300031241 Bacteria 96858
144 Ga0307412_10382377 3300031911 Bacteria 1140
145 Ga0307416_100277986 3300032002 Bacteria 1649
146 Ga0373926_0026751 3300035083 Bacteria 2020
147 Ga0373929_0098085 3300035085 Unclassified 735
148 Ga0373934_0001802 3300035086 Bacteria 7868
149 Ga0373934_0003581 3300035086 Bacteria 5712
150 Ga0373944_0051253 3300035089 Bacteria 1301
151 Ga0373923_0030342 3300035111 Bacteria 2174
152 Ga0373932_0113821 3300035112 Unclassified 895
153 Ga0373936_0041086 3300035113 Bacteria 1854
154 Ga0373945_0007743 3300035116 Bacteria 3484
155 Ga0373945_0099090 3300035116 Bacteria 1138
156 Ga0373953_0026232 3300035117 Bacteria 2231
157 Ga0373954_0000040 3300035118 Bacteria 47568
158 Ga0373954_0000957 3300035118 Bacteria 11297
159 Ga0373954_0004892 3300035118 Bacteria 5781
160 Ga0373954_0140003 3300035118 Unclassified 1180
161 Ga0373956_0005196 3300035119 Bacteria 5212
162 Ga0373957_0000662 3300035120 Bacteria 8857
163 Ga0373957_0288483 3300035120 Unclassified 695
164 Ga0373943_0014185 3300035170 Bacteria 3604
165 Ga0373943_0031211 3300035170 Bacteria 2527
166 Ga0373943_0138437 3300035170 Bacteria 1309
167 Ga0373943_0207186 3300035170 Bacteria 1087
168 Ga0373946_0035576 3300035171 Bacteria 2016
169 Ga0373946_0090020 3300035171 Bacteria 1358
170 Ga0373946_0169276 3300035171 Unclassified 1030
171 Ga0373955_0004777 3300035172 Bacteria 6031
172 Ga0373955_0008029 3300035172 Bacteria 4879
173 Ga0373955_0018153 3300035172 Bacteria 3494
174 Ga0373955_0055214 3300035172 Bacteria 2174
175 Ga0373955_0071407 3300035172 Bacteria 1942
176 Ga0373955_0119420 3300035172 Bacteria 1531
177 Ga0373955_0243996 3300035172 Bacteria 1076
178 Ga0373955_0263161 3300035172 Bacteria 1036
179 Ga0373924_0005662 3300035410 Bacteria 4432
180 Ga0373924_0113825 3300035410 Unclassified 1171
181 Ga0373924_0220886 3300035410 Bacteria 837
182 Ga0373931_0069790 3300035691 Bacteria 1915
183 Ga0373935_0038636 3300035692 Bacteria 2989
184 Ga0373935_0086950 3300035692 Bacteria 2040
185 Ga0373935_0219022 3300035692 Bacteria 1321
186 Ga0373927_0110456 3300035695 Bacteria 1791
187 Ga0373927_0283239 3300035695 Bacteria 1090
188 Ga0373933_0004047 3300035724 Bacteria 8078
189 Ga0373933_0005174 3300035724 Bacteria 7119
190 Ga0373933_0041019 3300035724 Bacteria 2730
191 Ga0373933_0089428 3300035724 Bacteria 1898
192 Ga0373933_0193190 3300035724 Bacteria 1301
193 Ga0373947_0186220 3300035725 Unclassified 1353
194 Ga0373937_0014098 3300036401 Bacteria 7049
195 Ga0373937_0014481 3300036401 Bacteria 6964
196 Ga0373937_0015787 3300036401 Bacteria 6691
197 Ga0373937_0024894 3300036401 Bacteria 5402
198 Ga0373937_0398063 3300036401 Bacteria 1306
199 Ga0373937_0445507 3300036401 Bacteria 1229
200 Ga0373937_0473890 3300036401 Bacteria 1189
201 Ga0373925_0012731 3300037068 Bacteria 6094
202 Ga0373925_0014286 3300037068 Bacteria 5745
203 Ga0373925_0014436 3300037068 Bacteria 5710
204 Ga0373925_0125489 3300037068 Bacteria 1996
205 Ga0395900_0534471 3300037418 Unclassified 1119
206 Ga0436364_0691115 3300037853 Unclassified 1079
207 Ga0436365_0249247 3300039437 Bacteria 1080
208 Ga0466963_0005907 3300044694 Bacteria 7209
209 Ga0466967_0035123 3300045976 Bacteria 4263
210 Ga0466967_1082888 3300045976 Unclassified 798
211 Ga0495592_0001425 3300046454 Bacteria 16601
212 Ga0495592_0004298 3300046454 Bacteria 10416
213 Ga0495603_0081210 3300046455 Bacteria 1899
214 Ga0495629_0001317 3300046459 Bacteria 19520
215 Ga0495629_0416888 3300046459 Unclassified 911
216 Ga0495641_0013719 3300046461 Bacteria 4430
217 Ga0495641_0022234 3300046461 Bacteria 3176
218 Ga0495641_0100754 3300046461 Unclassified 1289
219 Ga0495651_0004229 3300046462 Bacteria 10999
220 Ga0495651_0167771 3300046462 Bacteria 1566
221 Ga0495653_0019985 3300046463 Bacteria 5428
222 Ga0495653_0030180 3300046463 Bacteria 4321
223 Ga0495653_0083702 3300046463 Bacteria 2351
224 Ga0495580_0048766 3300046472 Bacteria 2996
225 Ga0495580_0151169 3300046472 Bacteria 1608
226 Ga0495580_0320133 3300046472 Unclassified 1054
227 Ga0495582_0006139 3300046473 Bacteria 6691
228 Ga0495639_0015224 3300046475 Bacteria 3332
229 Ga0495639_0124485 3300046475 Bacteria 1231
230 Ga0495662_0004273 3300046476 Bacteria 7184
231 Ga0495662_0043026 3300046476 Bacteria 2180
232 Ga0495662_0103664 3300046476 Bacteria 1392
233 Ga0495662_0122425 3300046476 Bacteria 1277
234 Ga0495664_0025255 3300046477 Bacteria 3458
235 Ga0495664_0079392 3300046477 Bacteria 1967
236 Ga0495664_0084289 3300046477 Bacteria 1907
237 Ga0495664_0129499 3300046477 Bacteria 1527
238 Ga0495594_0011257 3300046499 Bacteria 4646
239 Ga0495594_0120145 3300046499 Bacteria 1485
240 Ga0495608_0001415 3300046511 Bacteria 17058
241 Ga0495608_0056207 3300046511 Bacteria 2599
242 Ga0495608_0068670 3300046511 Bacteria 2317
243 Ga0495618_0016199 3300046514 Bacteria 4556
244 Ga0495628_0008546 3300046516 Bacteria 8772
245 Ga0495628_0018487 3300046516 Bacteria 5771
246 Ga0495628_0091909 3300046516 Bacteria 2348
247 Ga0495628_0181591 3300046516 Bacteria 1591
248 Ga0495628_0204331 3300046516 Bacteria 1487
249 Ga0495630_0000680 3300046517 Bacteria 24316
250 Ga0495630_0045060 3300046517 Bacteria 3295
251 Ga0495630_0140670 3300046517 Bacteria 1835
252 Ga0495630_0262029 3300046517 Bacteria 1320
253 Ga0495630_0475897 3300046517 Unclassified 957
254 Ga0495630_0489202 3300046517 Bacteria 943
255 Ga0495666_0044577 3300046526 Bacteria 2141
256 Ga0495652_0010689 3300046529 Bacteria 8316
257 Ga0495652_0047960 3300046529 Bacteria 3662
258 Ga0495652_0110617 3300046529 Bacteria 2209
259 Ga0495652_0113000 3300046529 Unclassified 2181
260 Ga0495665_0031158 3300046531 Bacteria 2854
261 Ga0495665_0138948 3300046531 Bacteria 1270
262 Ga0495665_0293059 3300046531 Bacteria 834
263 Ga0495640_0014359 3300046533 Bacteria 5997
264 Ga0495640_0058462 3300046533 Bacteria 2629
265 Ga0495640_0125970 3300046533 Bacteria 1661
266 Ga0495586_0314053 3300046535 Bacteria 898
267 Ga0495587_0011760 3300046536 Bacteria 5534
268 Ga0495587_0020999 3300046536 Bacteria 4028
269 Ga0495645_0012921 3300046543 Bacteria 5895
270 Ga0495645_0022687 3300046543 Bacteria 4542
271 Ga0495667_0005365 3300046559 Bacteria 8666
272 Ga0495667_0013304 3300046559 Bacteria 5570
273 Ga0495667_0237135 3300046559 Bacteria 1162
274 Ga0495667_0420686 3300046559 Bacteria 841
275 Ga0495634_0021502 3300046642 Bacteria 4558
276 Ga0495634_0166196 3300046642 Bacteria 1389
277 Ga0495635_0017182 3300046663 Bacteria 5052
278 Ga0495635_0068029 3300046663 Bacteria 2443
279 Ga0495635_0071939 3300046663 Bacteria 2370
280 Ga0495657_0015484 3300046675 Bacteria 5580
281 Ga0495657_0179043 3300046675 Unclassified 1302
282 Ga0495599_0007694 3300046678 Bacteria 6545
283 Ga0495599_0037729 3300046678 Bacteria 3035
284 Ga0495623_0000554 3300046679 Bacteria 24925
285 Ga0495623_0016053 3300046679 Bacteria 4839
286 Ga0495646_0028947 3300046680 Bacteria 3466
287 Ga0495646_0070982 3300046680 Bacteria 2050
288 Ga0495647_0005743 3300046681 Bacteria 4078
289 Ga0495658_0004223 3300046683 Bacteria 7067
290 Ga0495658_0406361 3300046683 Bacteria 868
291 Ga0495658_0480529 3300046683 Bacteria 794
292 Ga0495613_0159632 3300046689 Bacteria 1604
293 Ga0495624_0295877 3300046690 Bacteria 976
294 Ga0495600_0006811 3300046809 Bacteria 6968
295 Ga0495600_0048926 3300046809 Bacteria 2758
296 Ga0495600_0157995 3300046809 Bacteria 1466
297 Ga0495600_0167523 3300046809 Bacteria 1419
298 Ga0495600_0295101 3300046809 Bacteria 1023
299 Ga0495581_0062901 3300047315 Bacteria 2144
300 Ga0495581_0091585 3300047315 Bacteria 1764
301 Ga0495604_0013745 3300047317 Bacteria 6454
302 Ga0495604_0017551 3300047317 Bacteria 5730
303 Ga0495674_0030554 3300047319 Bacteria 4897
304 Ga0495674_0034223 3300047319 Bacteria 4595
305 Ga0495674_0071946 3300047319 Bacteria 2983
306 Ga0495674_0303135 3300047319 Bacteria 1304
307 Ga0495672_0087961 3300047320 Bacteria 1714
308 Ga0495676_0069813 3300047321 Bacteria 2709
309 Ga0495680_0007521 3300047322 Bacteria 9971
310 Ga0495680_0026617 3300047322 Bacteria 4764
311 Ga0495680_0035055 3300047322 Bacteria 4045
312 Ga0495680_0057999 3300047322 Bacteria 2993
313 Ga0495680_0089233 3300047322 Bacteria 2314
314 Ga0495675_0000625 3300047444 Bacteria 22516
315 Ga0495684_0005789 3300047471 Bacteria 9608
316 Ga0495684_0041019 3300047471 Bacteria 3547
317 Ga0495602_0003684 3300048088 Bacteria 15893
318 Ga0496100_0044149 3300048903 Bacteria 2853
319 Ga0496100_0059088 3300048903 Bacteria 2518
320 Ga0496101_0525457 3300048904 Bacteria 935
321 Ga0496102_0173895 3300048905 Bacteria 2027
322 Ga0496102_0184756 3300048905 Bacteria 1964
323 Ga0496103_0072843 3300048906 Bacteria 2152
324 Ga0496104_0000055 3300048907 Bacteria 124267
325 Ga0496105_0000918 3300048908 Bacteria 20094
326 Ga0496105_0134605 3300048908 Bacteria 2036
327 Ga0496106_0042929 3300048909 Bacteria 3391
328 Ga0496106_0409735 3300048909 Unclassified 1089
329 Ga0496107_0150454 3300048910 Bacteria 1721
330 Ga0496109_0081684 3300048912 Bacteria 2978
331 Ga0496110_0078590 3300048913 Bacteria 2937
332 Ga0496110_0101745 3300048913 Bacteria 2576
333 Ga0496110_0271946 3300048913 Bacteria 1542
334 Ga0496111_0300796 3300048914 Bacteria 1189
335 Ga0496111_0348550 3300048914 Bacteria 1096
336 Ga0496112_0420120 3300048915 Bacteria 1276
337 Ga0496114_0034420 3300048917 Bacteria 4179
338 Ga0496115_0006473 3300048918 Bacteria 8586
339 Ga0496115_0108819 3300048918 Bacteria 2275
340 nmdc:mga03683_20988_c1 3300050489 Unclassified 2512
341 nmdc:mga03n38_46559_c1 3300050490 Bacteria 1915
342 nmdc:mga00v17_227213_c1 3300050491 Bacteria 1209
343 nmdc:mga0yw44_2973_c1 3300050492 Bacteria 7389
344 nmdc:mga0k408_91889_c1 3300050493 Bacteria 1783
345 nmdc:mga06z11_82654_c1 3300050494 Bacteria 1727
346 nmdc:mga07m45_42008_c1 3300050496 Bacteria 2562
347 nmdc:mga05p37_584210_c1 3300050507 Bacteria 1264
348 nmdc:mga09592_99031_c1 3300050508 Unclassified 2496
349 nmdc:mga06r32_43434_c1 3300050510 Bacteria 4277
350 nmdc:mga06r32_727948_c1 3300050510 Bacteria 956
351 nmdc:mga08y16_324222_c1 3300050511 Bacteria 1585
352 nmdc:mga08y16_354786_c1 3300050511 Bacteria 1506
353 nmdc:mga0n895_637072_c1 3300050512 Bacteria 1066
354 nmdc:mga0n895_93681_c1 3300050512 Bacteria 3007
355 Ga0495601_0000357 3300053077 Bacteria 23996
356 Ga0495601_0012544 3300053077 Bacteria 5082
357 Ga0495601_0014579 3300053077 Bacteria 4737
358 Ga0495601_0018871 3300053077 Bacteria 4202
359 Ga0495601_0069295 3300053077 Bacteria 2250
360 Ga0495601_0093584 3300053077 Bacteria 1936
361 Ga0495601_0136422 3300053077 Unclassified 1599
362 Ga0495601_0326305 3300053077 Bacteria 999
363 Ga0495612_0007466 3300053078 Bacteria 4467
364 Ga0495612_0028526 3300053078 Bacteria 2247
365 Ga0495612_0029508 3300053078 Bacteria 2209
366 Ga0495612_0107188 3300053078 Bacteria 1194
367 Ga0495595_0006003 3300053084 Bacteria 4932
368 Ga0495595_0009681 3300053084 Bacteria 3991
369 Ga0495595_0011695 3300053084 Bacteria 3673
370 Ga0495595_0103990 3300053084 Bacteria 1372
371 Ga0495619_0002650 3300053085 Bacteria 11698
372 Ga0495619_0011976 3300053085 Bacteria 5464
373 Ga0495619_0100490 3300053085 Bacteria 1968
374 Ga0500647_0076904 3300053091 Unclassified 1601
375 Ga0500641_0001943 3300053096 Bacteria 7333
376 Ga0590071_008145 3300059421 Bacteria 2473
377 2513629411 2513237092 Bacteria 8341956
378 JGI24751J29686_10020315
379 rootH2_10312241
380 rootL2_10105744
381 JGI25404J52841_10000752
382 Ga0070676_10340536
383 Ga0070670_100013544
384 Ga0068869_100238993
385 Ga0070666_10111664
386 Ga0070680_100139770
387 Ga0070680_100617986
388 Ga0070691_10061940
389 Ga0070668_100203683
390 Ga0070669_100778958
391 Ga0070671_100132158
392 Ga0070674_100114739
393 Ga0070673_100419668
394 Ga0070709_10216567
395 Ga0070714_100254806
396 Ga0070713_100317301
397 Ga0070713_100709383
398 Ga0070710_10437754
399 Ga0070711_100214014
400 Ga0070711_100260717
401 Ga0070708_100159829
402 Ga0070708_100542052
403 Ga0070663_100038589
404 Ga0070662_100199026
405 Ga0070707_100002826
406 Ga0070707_100281212
407 Ga0070698_100459979
408 Ga0070698_100594025
409 Ga0070679_100492850
410 Ga0070684_100410032
411 Ga0070686_100075002
412 Ga0070686_100111226
413 Ga0070695_100309338
414 Ga0070665_100073605
415 Ga0070704_100065771
416 Ga0068855_100927184
417 Ga0068852_100419873
418 Ga0068859_100022826
419 Ga0068859_100439632
420 Ga0068861_100115020
421 Ga0068863_100114190
422 Ga0068858_100513597
423 Ga0068860_100398511
424 Ga0068860_100570528
425 Ga0081455_10000031
426 Ga0081455_10056126
427 Ga0081540_1000078
428 Ga0075368_10015168
429 Ga0075363_100006929
430 Ga0075363_100072606
431 Ga0075363_100081640
432 Ga0075364_10078680
433 Ga0075364_10156204
434 Ga0075367_10003679
435 Ga0075367_10058091
436 Ga0097621_100189759
437 Ga0075370_10032684
438 Ga0068871_100303472
439 Ga0068871_100312101
440 Ga0075428_100083109
441 Ga0075431_100340392
442 Ga0075433_10244978
443 Ga0075434_100683561
444 Ga0075434_101125932
445 Ga0075429_100490030
446 Ga0075436_100207312
447 Ga0097620_100022825
448 Ga0097620_100439630
449 Ga0099794_10031535
450 Ga0111539_10014069
451 Ga0111539_10119627
452 Ga0111539_10343888
453 Ga0111539_10376921
454 Ga0111539_10686773
455 Ga0105245_10132729
456 Ga0105247_10013836
457 Ga0105247_10034321
458 Ga0114129_10017522
459 Ga0114129_10040644
460 Ga0105243_10147051
461 Ga0105243_10238654
462 Ga0105243_10464943
463 Ga0105241_10169998
464 Ga0105242_10257455
465 Ga0105242_10773265
466 Ga0105248_10241999
467 Ga0105237_10318868
468 Ga0105238_10077997
469 Ga0105249_10229081
470 Ga0099796_10015330
471 Ga0105239_10904074
472 Ga0105246_10152559
473 Ga0157370_10011664
474 Ga0157374_10115795
475 Ga0157374_10151943
476 Ga0157378_10420431
477 Ga0157378_11117082
478 Ga0163162_10835418
479 Ga0157375_10295695
480 Ga0163163_10384455
481 Ga0157380_10386235
482 Ga0157380_10843168
483 Ga0157379_10060216
484 Ga0157376_10323293
485 Ga0207642_10050168
486 Ga0207710_10022295
487 Ga0207688_10049686
488 Ga0207680_10034442
489 Ga0207699_10323171
490 Ga0207645_10209780
491 Ga0207654_10047311
492 Ga0207707_10361015
493 Ga0207707_10652846
494 Ga0207671_10165364
495 Ga0207663_10211744
496 Ga0207657_10027255
497 Ga0207646_10027344
498 Ga0207650_10011509
499 Ga0207687_10112287
500 Ga0207700_10626468
501 Ga0207690_10198641
502 Ga0207706_10041220
503 Ga0207686_10188875
504 Ga0207709_10329413
505 Ga0207669_10140210
506 Ga0207711_10160516
507 Ga0207679_10230041
508 Ga0207712_10131917
509 Ga0207658_10394278
510 Ga0207678_10036272
511 Ga0207641_10363163
512 Ga0207676_10013492
513 Ga0207675_100206815
514 Ga0207683_10169952
515 Ga0207683_10747660
516 Ga0268266_10034595
517 Ga0268266_10050742
518 Ga0268264_10337720
519 Ga0268264_10364847
520 Ga0265325_10000036
521 Ga0307412_10382377
522 Ga0307416_100277986
523 Ga0373926_0026751
524 Ga0373929_0098085
525 Ga0373934_0001802
526 Ga0373934_0003581
527 Ga0373944_0051253
528 Ga0373923_0030342
529 Ga0373932_0113821
530 Ga0373936_0041086
531 Ga0373945_0007743
532 Ga0373945_0099090
533 Ga0373953_0026232
534 Ga0373954_0000040
535 Ga0373954_0000957
536 Ga0373954_0004892
537 Ga0373954_0140003
538 Ga0373956_0005196
539 Ga0373957_0000662
540 Ga0373957_0288483
541 Ga0373943_0014185
542 Ga0373943_0031211
543 Ga0373943_0138437
544 Ga0373943_0207186
545 Ga0373946_0035576
546 Ga0373946_0090020
547 Ga0373946_0169276
548 Ga0373955_0004777
549 Ga0373955_0008029
550 Ga0373955_0018153
551 Ga0373955_0055214
552 Ga0373955_0071407
553 Ga0373955_0119420
554 Ga0373955_0243996
555 Ga0373955_0263161
556 Ga0373924_0005662
557 Ga0373924_0113825
558 Ga0373924_0220886
559 Ga0373931_0069790
560 Ga0373935_0038636
561 Ga0373935_0086950
562 Ga0373935_0219022
563 Ga0373927_0110456
564 Ga0373927_0283239
565 Ga0373933_0004047
566 Ga0373933_0005174
567 Ga0373933_0041019
568 Ga0373933_0089428
569 Ga0373933_0193190
570 Ga0373947_0186220
571 Ga0373937_0014098
572 Ga0373937_0014481
573 Ga0373937_0015787
574 Ga0373937_0024894
575 Ga0373937_0398063
576 Ga0373937_0445507
577 Ga0373937_0473890
578 Ga0373925_0012731
579 Ga0373925_0014286
580 Ga0373925_0014436
581 Ga0373925_0125489
582 Ga0395900_0534471
583 Ga0436364_0691115
584 Ga0436365_0249247
585 Ga0466963_0005907
586 Ga0466967_0035123
587 Ga0466967_1082888
588 Ga0495592_0001425
589 Ga0495592_0004298
590 Ga0495603_0081210
591 Ga0495629_0001317
592 Ga0495629_0416888
593 Ga0495641_0013719
594 Ga0495641_0022234
595 Ga0495641_0100754
596 Ga0495651_0004229
597 Ga0495651_0167771
598 Ga0495653_0019985
599 Ga0495653_0030180
600 Ga0495653_0083702
601 Ga0495580_0048766
602 Ga0495580_0151169
603 Ga0495580_0320133
604 Ga0495582_0006139
605 Ga0495639_0015224
606 Ga0495639_0124485
607 Ga0495662_0004273
608 Ga0495662_0043026
609 Ga0495662_0103664
610 Ga0495662_0122425
611 Ga0495664_0025255
612 Ga0495664_0079392
613 Ga0495664_0084289
614 Ga0495664_0129499
615 Ga0495594_0011257
616 Ga0495594_0120145
617 Ga0495608_0001415
618 Ga0495608_0056207
619 Ga0495608_0068670
620 Ga0495618_0016199
621 Ga0495628_0008546
622 Ga0495628_0018487
623 Ga0495628_0091909
624 Ga0495628_0181591
625 Ga0495628_0204331
626 Ga0495630_0000680
627 Ga0495630_0045060
628 Ga0495630_0140670
629 Ga0495630_0262029
630 Ga0495630_0475897
631 Ga0495630_0489202
632 Ga0495666_0044577
633 Ga0495652_0010689
634 Ga0495652_0047960
635 Ga0495652_0110617
636 Ga0495652_0113000
637 Ga0495665_0031158
638 Ga0495665_0138948
639 Ga0495665_0293059
640 Ga0495640_0014359
641 Ga0495640_0058462
642 Ga0495640_0125970
643 Ga0495586_0314053
644 Ga0495587_0011760
645 Ga0495587_0020999
646 Ga0495645_0012921
647 Ga0495645_0022687
648 Ga0495667_0005365
649 Ga0495667_0013304
650 Ga0495667_0237135
651 Ga0495667_0420686
652 Ga0495634_0021502
653 Ga0495634_0166196
654 Ga0495635_0017182
655 Ga0495635_0068029
656 Ga0495635_0071939
657 Ga0495657_0015484
658 Ga0495657_0179043
659 Ga0495599_0007694
660 Ga0495599_0037729
661 Ga0495623_0000554
662 Ga0495623_0016053
663 Ga0495646_0028947
664 Ga0495646_0070982
665 Ga0495647_0005743
666 Ga0495658_0004223
667 Ga0495658_0406361
668 Ga0495658_0480529
669 Ga0495613_0159632
670 Ga0495624_0295877
671 Ga0495600_0006811
672 Ga0495600_0048926
673 Ga0495600_0157995
674 Ga0495600_0167523
675 Ga0495600_0295101
676 Ga0495581_0062901
677 Ga0495581_0091585
678 Ga0495604_0013745
679 Ga0495604_0017551
680 Ga0495674_0030554
681 Ga0495674_0034223
682 Ga0495674_0071946
683 Ga0495674_0303135
684 Ga0495672_0087961
685 Ga0495676_0069813
686 Ga0495680_0007521
687 Ga0495680_0026617
688 Ga0495680_0035055
689 Ga0495680_0057999
690 Ga0495680_0089233
691 Ga0495675_0000625
692 Ga0495684_0005789
693 Ga0495684_0041019
694 Ga0495602_0003684
695 Ga0496100_0044149
696 Ga0496100_0059088
697 Ga0496101_0525457
698 Ga0496102_0173895
699 Ga0496102_0184756
700 Ga0496103_0072843
701 Ga0496104_0000055
702 Ga0496105_0000918
703 Ga0496105_0134605
704 Ga0496106_0042929
705 Ga0496106_0409735
706 Ga0496107_0150454
707 Ga0496109_0081684
708 Ga0496110_0078590
709 Ga0496110_0101745
710 Ga0496110_0271946
711 Ga0496111_0300796
712 Ga0496111_0348550
713 Ga0496112_0420120
714 Ga0496114_0034420
715 Ga0496115_0006473
716 Ga0496115_0108819
717 nmdc:mga03683_20988_c1
718 nmdc:mga03n38_46559_c1
719 nmdc:mga00v17_227213_c1
720 nmdc:mga0yw44_2973_c1
721 nmdc:mga0k408_91889_c1
722 nmdc:mga06z11_82654_c1
723 nmdc:mga07m45_42008_c1
724 nmdc:mga05p37_584210_c1
725 nmdc:mga09592_99031_c1
726 nmdc:mga06r32_43434_c1
727 nmdc:mga06r32_727948_c1
728 nmdc:mga08y16_324222_c1
729 nmdc:mga08y16_354786_c1
730 nmdc:mga0n895_637072_c1
731 nmdc:mga0n895_93681_c1
732 Ga0495601_0000357
733 Ga0495601_0012544
734 Ga0495601_0014579
735 Ga0495601_0018871
736 Ga0495601_0069295
737 Ga0495601_0093584
738 Ga0495601_0136422
739 Ga0495601_0326305
740 Ga0495612_0007466
741 Ga0495612_0028526
742 Ga0495612_0029508
743 Ga0495612_0107188
744 Ga0495595_0006003
745 Ga0495595_0009681
746 Ga0495595_0011695
747 Ga0495595_0103990
748 Ga0495619_0002650
749 Ga0495619_0011976
750 Ga0495619_0100490
751 Ga0500647_0076904
752 Ga0500641_0001943
753 Ga0590071_008145
754 2513629411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

40

267

0.96

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

44

259

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tav-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8787 37 267
7tav-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8739 36 268
7tav-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8724 36 268
7tav-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8712 36 268
7tav-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8669 36 268
ID Description Score Start End Superfamily
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9204 39 268 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9025 36 115 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9021 39 115 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8989 39 268 3.40.190.10
6nioA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.881 38 115 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4V1R146-F1-model_v4 deleted 0.9596 88 268
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9581 69 268 GO:0015689
GO:0030973
AF-A0A7W0LCN7-F1-model_v4 Substrate-binding domain-containing protein 0.9581 51 268 GO:0015689
GO:0030973
AF-A0A3N5N326-F1-model_v4 ABC transporter substrate-binding protein 0.958 97 266 GO:0015689
GO:0030973
AF-A0A537PL92-F1-model_v4 ABC transporter substrate-binding protein 0.955 39 268 GO:0015689
GO:0030973

Map