F427466

General Info

Members Datasets Scaffolds Average Seq Length
376 322 200 252

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0028829|Ga0495670_0028829_1510_2382
Length 290
Sequence MKLLEGGRAGQIWRDGNTVIRPSGAWTPTVHRFLRHLRSRGFPGAPDPIEITGNQEVVSYVSGRVCEDLSDQFVGSERMLLSVARLLREFHSASQGFLESDRAVQAWMLPPQEPREIICHGDYAPYNVATAGHEAVGIIDFDTAHPAPRIWDLAYSVYRWAPLSDPANPDVTFGLDDQLQRAEIFCTAYGATMQERLQLPEMICRRLQALIDYILPSAAAGDETFAEHVARGDARLYLSDMHYVRSHRNRLLKACADAPSPTRMSSLPHAHPTAISSGGRSRKGQGTRWR

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
13 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2519899620 Rhizobium sp. Pop5 Isolate Nodule
22 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
25 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
26 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
27 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
28 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
29 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
30 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
31 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
32 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
33 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
34 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
35 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
36 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
37 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
38 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
39 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
40 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
41 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
42 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
43 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
44 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
45 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
46 2718217882 Rhizobium sp. N741 Isolate Nodule
47 2718217927 Rhizobium sp. N324 Isolate Nodule
48 2718218009 Rhizobium sp. N561 Isolate Nodule
49 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
50 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
51 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
52 2718218363 Rhizobium sp. N113 Isolate Nodule
53 2718218365 Rhizobium sp. N731 Isolate Nodule
54 2718218366 Rhizobium sp. N621 Isolate Nodule
55 2718218423 Rhizobium sp. N941 Isolate Nodule
56 2721755514 Rhizobium sp. N6212 Isolate Nodule
57 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
58 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
59 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
60 2721755809 Rhizobium sp. N541 Isolate Nodule
61 2721755810 Rhizobium sp. N871 Isolate Nodule
62 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
63 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
64 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
65 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
66 2728369365 Rhizobium sp. N1341 Isolate Nodule
67 2728369397 Rhizobium sp. N1314 Isolate Nodule
68 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
69 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
70 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
71 2791355256 Rhizobium sp. M10 Isolate Nodule
72 2791355260 Rhizobium sp. L9 Isolate Nodule
73 2791355261 Rhizobium sp. J15 Isolate Nodule
74 2791355262 Rhizobium sp. M1 Isolate Nodule
75 2791355263 Rhizobium chutanense C5 Isolate Nodule
76 2791355264 Rhizobium sp. S9 Isolate Nodule
77 2791355265 Rhizobium sp. H4 Isolate Nodule
78 2791355266 Rhizobium sp. L43 Isolate Nodule
79 2791355267 Rhizobium sp. L18 Isolate Nodule
80 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
81 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
82 2802429633 Rhizobium anhuiense J3 Isolate Nodule
83 2802429634 Rhizobium anhuiense S10 Isolate Nodule
84 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
85 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
86 2802429637 Rhizobium anhuiense C15 Isolate Nodule
87 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
88 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
89 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
90 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
91 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
92 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
93 2838048938 Rhizobium pisi 27/80 Isolate Nodule
94 2838061910 Rhizobium phaseoli L15 Isolate Nodule
95 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
96 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
97 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
98 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
99 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
100 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
101 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
102 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
103 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
104 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
105 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
106 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
107 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
108 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
109 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
110 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
111 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
112 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
113 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
114 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
115 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
116 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
117 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
118 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
119 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
120 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
121 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
122 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
123 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
124 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
125 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
126 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
127 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
128 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
129 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
130 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
131 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
132 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
133 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
134 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
135 2933599457 Rhizobium phaseoli M3 Isolate Nodule
136 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
137 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
138 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
139 2936381700 Rhizobium chutanense C16 Isolate Unclassified
140 2996893221 Rhizobium sp. R635 Isolate Nodule
141 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
142 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
143 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
144 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
145 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
146 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
147 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
148 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
149 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
150 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
151 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
152 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
153 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
154 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
155 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
156 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
157 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
158 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
159 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
160 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
161 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
162 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
163 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
164 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
165 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
166 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
167 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
168 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
169 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
179 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
180 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
195 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
198 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
210 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
211 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
212 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
213 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
216 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
217 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
220 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
282 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
283 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
287 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
288 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
289 8005275841 Rhizobium sp. N4311 Isolate Nodule
290 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
291 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
292 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
293 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
294 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
295 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
296 8005382845 Rhizobium sp. R634 Isolate Nodule
297 8005395548 Rhizobium sp. R339 Isolate Nodule
298 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
299 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
300 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
301 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
302 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
303 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
304 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
305 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
306 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
307 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
308 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
309 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
310 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
311 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
312 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
313 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
314 8018176218 Rhizobium sp. N122 Isolate Nodule
315 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
316 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
317 8024501048 Rhizobium sp. H4 Isolate Nodule
318 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
319 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
320 8056382006 Rhizobium croatiense 13T Isolate Nodule
321 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
322 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.19
Metatranscriptomes 0
Isolates 46.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.29
Nodule 36.97
Rhizoplane 1.86
Rhizosphere 24.73
Stem 0
Stem Tuber 0
Unclassified 19.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002802 3300001979 Bacteria 7802
2 JGI25155J39150_1000006 3300002704 Bacteria 244109
3 JGI25156J39149_1000019 3300002705 Bacteria 160845
4 JGI25162J39368_1001776 3300002737 Bacteria 10222
5 JGI25162J39368_1001811 3300002737 Bacteria 10032
6 JGI25154J39366_1000177 3300002738 Bacteria 49732
7 JGI25154J39366_1000365 3300002738 Bacteria 25282
8 JGI25157J39369_1000024 3300002741 Bacteria 160844
9 JGI25159J45721_1000764 3300002987 Bacteria 13969
10 JGI25151J46595_10000475 3300003187 Bacteria 37987
11 JGI25165J46597_1001655 3300003214 Bacteria 10232
12 JGI25165J46597_1001688 3300003214 Bacteria 9984
13 JGI25165J46597_1002350 3300003214 Bacteria 6354
14 JGI25153J46596_10002244 3300003215 Bacteria 11259
15 JGI25153J46596_10014009 3300003215 Bacteria 3358
16 rootH1_10040651 3300003316 Bacteria 7215
17 rootH2_10061138 3300003320 Bacteria 3485
18 rootL2_10071741 3300003322 Bacteria 2985
19 rootH1_10104992 3300003323 Bacteria 1871
20 rootH1_10164523 3300003323 Bacteria 2446
21 JGI25160J50197_1000399 3300003354 Bacteria 28035
22 Ga0055526_1032167 3300003771 Bacteria 1486
23 Ga0055528_1000207 3300003790 Bacteria 49794
24 Ga0055528_1019713 3300003790 Bacteria 2220
25 Ga0055531_10050399 3300003794 Bacteria 1102
26 Ga0055543_1001015 3300004625 Bacteria 12493
27 Ga0065165_1001686 3300005262 Bacteria 22291
28 Ga0070665_100202375 3300005548 Bacteria 1986
29 Ga0068855_100083043 3300005563 Bacteria 3711
30 Ga0068854_100036342 3300005578 Bacteria 3453
31 Ga0068852_100590651 3300005616 Bacteria 1114
32 Ga0075365_10013918 3300006038 Bacteria 4827
33 Ga0075363_100016075 3300006048 Bacteria 3691
34 Ga0075363_100118809 3300006048 Bacteria 1475
35 Ga0075363_100206725 3300006048 Bacteria 1123
36 Ga0075362_10223174 3300006177 Bacteria 921
37 Ga0075369_10005040 3300006186 Bacteria 4919
38 Ga0075370_10004644 3300006353 Bacteria 6697
39 Ga0105240_10000027 3300009093 Bacteria 348486
40 Ga0105237_10000508 3300009545 Bacteria 54970
41 Ga0123342_1010420 3300009766 Bacteria 10659
42 Ga0105239_10002593 3300010375 Bacteria 22866
43 Ga0157370_10000048 3300013104 Bacteria 124683
44 Ga0157369_10727079 3300013105 Bacteria 1022
45 Ga0182007_10001900 3300015262 Bacteria 10892
46 Ga0182005_1009672 3300015265 Bacteria 2797
47 Ga0209435_100011 3300025206 Bacteria 413027
48 Ga0209436_102909 3300025208 Bacteria 4820
49 Ga0209672_110423 3300025228 Bacteria 1256
50 Ga0209437_100036 3300025233 Bacteria 469153
51 Ga0209437_100086 3300025233 Bacteria 254578
52 Ga0207425_1003540 3300025245 Bacteria 4967
53 Ga0209646_1000024 3300025246 Bacteria 413027
54 Ga0209646_1005602 3300025246 Bacteria 2172
55 Ga0209026_1000030 3300025250 Bacteria 329811
56 Ga0209677_100177 3300025253 Bacteria 54158
57 Ga0209759_1000011 3300025256 Bacteria 413027
58 Ga0209129_1002484 3300025258 Bacteria 9002
59 Ga0209233_1000056 3300025261 Bacteria 438104
60 Ga0209233_1000110 3300025261 Bacteria 260825
61 Ga0209233_1000640 3300025261 Bacteria 17399
62 Ga0209673_1000022 3300025273 Bacteria 413125
63 Ga0209673_1000206 3300025273 Bacteria 118136
64 Ga0209130_1000013 3300025284 Bacteria 412810
65 Ga0209025_1000190 3300025294 Bacteria 153726
66 Ga0209564_1000163 3300025295 Bacteria 162077
67 Ga0209564_1000661 3300025295 Bacteria 51008
68 Ga0209564_1022595 3300025295 Bacteria 2216
69 Ga0209758_1000245 3300025297 Bacteria 111769
70 Ga0209050_1008749 3300025298 Bacteria 5329
71 Ga0209256_1001591 3300025299 Bacteria 22212
72 Ga0209256_1001964 3300025299 Bacteria 18566
73 Ga0207426_1000081 3300025302 Bacteria 304502
74 Ga0207426_1000109 3300025302 Bacteria 238665
75 Ga0209051_1000264 3300025303 Bacteria 87736
76 Ga0209051_1006289 3300025303 Bacteria 6729
77 Ga0209257_1002263 3300025304 Bacteria 19660
78 Ga0207695_10000024 3300025913 Bacteria 632311
79 Ga0207671_10000176 3300025914 Bacteria 98289
80 Ga0207667_10118141 3300025949 Bacteria 2733
81 Ga0207640_10020274 3300025981 Bacteria 3946
82 Ga0207702_10144210 3300026078 Bacteria 2159
83 Ga0209371_1001205 3300027312 Bacteria 18688
84 Ga0268266_10204529 3300028379 Bacteria 1808
85 Ga0268256_1003732 3300030500 Bacteria 6696
86 Ga0439465_0026750 3300041413 Bacteria 1825
87 Ga0451795_0135963 3300041456 Bacteria 850
88 Ga0451800_1115706 3300041459 Bacteria 1316
89 Ga0451833_0190596 3300041491 Bacteria 5088
90 Ga0451833_0916259 3300041491 Bacteria 1223
91 Ga0451835_0302054 3300041492 Bacteria 4828
92 Ga0451835_0663323 3300041492 Bacteria 1955
93 Ga0451837_0247443 3300041494 Bacteria 2049
94 Ga0451837_1287790 3300041494 Bacteria 2632
95 Ga0451839_0103695 3300041496 Bacteria 2201
96 Ga0451841_0641391 3300041498 Bacteria 5946
97 Ga0451841_0964193 3300041498 Bacteria 7754
98 Ga0451845_0617037 3300041501 Bacteria 810
99 Ga0451847_0046566 3300041503 Bacteria 3019
100 Ga0451849_0307995 3300041505 Bacteria 3827
101 Ga0451849_1283024 3300041505 Bacteria 1083
102 Ga0451851_0802193 3300041507 Bacteria 2873
103 Ga0451851_0830938 3300041507 Bacteria 3550
104 Ga0451843_0681752 3300041509 Bacteria 2022
105 Ga0451843_0920206 3300041509 Bacteria 2179
106 Ga0451843_0935881 3300041509 Bacteria 1440
107 Ga0451853_1316019 3300041512 Bacteria 8765
108 Ga0451853_1323837 3300041512 Bacteria 4893
109 Ga0451853_2609283 3300041512 Bacteria 4183
110 Ga0451853_4078348 3300041512 Unclassified 1167
111 Ga0439445_0048173 3300042004 Bacteria 1146
112 Ga0439432_029000 3300042006 Bacteria 1801
113 Ga0439449_0113624 3300042007 Bacteria 1004
114 Ga0466966_0188685 3300044684 Bacteria 1249
115 Ga0466963_0030845 3300044694 Bacteria 3462
116 Ga0466970_0017206 3300044765 Bacteria 3733
117 Ga0466957_0262422 3300044842 Bacteria 1151
118 Ga0466958_0036739 3300045836 Bacteria 2933
119 Ga0495605_0017910 3300046474 Bacteria 3804
120 Ga0495605_0032707 3300046474 Bacteria 2646
121 Ga0495662_0034604 3300046476 Bacteria 2438
122 Ga0495585_0013096 3300046492 Bacteria 4862
123 Ga0495585_0070949 3300046492 Bacteria 1899
124 Ga0495583_0008195 3300046506 Bacteria 6423
125 Ga0495606_0009445 3300046507 Bacteria 8254
126 Ga0495610_0092827 3300046512 Bacteria 1365
127 Ga0495610_0095581 3300046512 Bacteria 1339
128 Ga0495610_0100966 3300046512 Bacteria 1292
129 Ga0495620_0003941 3300046515 Bacteria 8437
130 Ga0495620_0016945 3300046515 Bacteria 3643
131 Ga0495631_0102099 3300046518 Bacteria 1234
132 Ga0495631_0145223 3300046518 Bacteria 1018
133 Ga0495637_0071566 3300046520 Bacteria 1398
134 Ga0495643_0090407 3300046522 Bacteria 1580
135 Ga0495643_0245011 3300046522 Bacteria 839
136 Ga0495648_0003196 3300046524 Bacteria 14563
137 Ga0495654_0087616 3300046530 Bacteria 1449
138 Ga0495609_0035988 3300046538 Bacteria 2238
139 Ga0495633_0007491 3300046558 Bacteria 6273
140 Ga0495656_0013689 3300046615 Bacteria 3024
141 Ga0495668_0069256 3300046616 Bacteria 1940
142 Ga0495668_0224689 3300046616 Bacteria 1028
143 Ga0495625_0042117 3300046660 Bacteria 3320
144 Ga0495625_0101344 3300046660 Bacteria 1978
145 Ga0495625_0213273 3300046660 Bacteria 1268
146 Ga0495625_0271216 3300046660 Bacteria 1095
147 Ga0495661_0016624 3300046665 Bacteria 4871
148 Ga0495588_0130899 3300046674 Bacteria 1323
149 Ga0495588_0236335 3300046674 Bacteria 964
150 Ga0495670_0028829 3300046691 Bacteria 2753
151 Ga0495670_0140182 3300046691 Bacteria 1264
152 Ga0495671_0132921 3300046692 Bacteria 1213
153 Ga0495649_0009101 3300046694 Bacteria 5924
154 Ga0495636_0029828 3300047318 Bacteria 2228
155 Ga0495687_016755 3300047443 Bacteria 3676
156 Ga0495673_0142058 3300047469 Bacteria 935
157 Ga0495681_0091495 3300047470 Bacteria 1342
158 Ga0495681_0204859 3300047470 Bacteria 798
159 Ga0495686_0005789 3300047472 Bacteria 9642
160 Ga0495626_0049766 3300048091 Bacteria 1939
161 Ga0496100_0071527 3300048903 Bacteria 2316
162 Ga0496102_0043764 3300048905 Bacteria 4061
163 Ga0496103_0055704 3300048906 Bacteria 2452
164 Ga0496113_0106663 3300048916 Bacteria 2176
165 Ga0496116_0024853 3300048919 Bacteria 4417
166 Ga0496117_0030863 3300048920 Bacteria 4102
167 Ga0496117_0039098 3300048920 Bacteria 3506
168 Ga0496118_0001761 3300048921 Bacteria 31375
169 Ga0496118_0001988 3300048921 Bacteria 29035
170 Ga0496119_0046327 3300048922 Bacteria 2716
171 Ga0496119_0058874 3300048922 Bacteria 2311
172 Ga0496120_0033144 3300048923 Bacteria 3106
173 Ga0496120_0064353 3300048923 Bacteria 2036
174 Ga0496121_0003778 3300048924 Bacteria 21151
175 Ga0496121_0055420 3300048924 Bacteria 3303
176 Ga0496121_0167528 3300048924 Bacteria 1599
177 Ga0496122_0014846 3300048925 Bacteria 7500
178 Ga0496123_0033845 3300048926 Bacteria 3670
179 Ga0496124_0033382 3300048927 Bacteria 4527
180 Ga0496124_0292747 3300048927 Bacteria 1181
181 Ga0496125_0043464 3300048928 Bacteria 3813
182 Ga0496125_0105118 3300048928 Bacteria 2065
183 Ga0496126_0089190 3300048929 Bacteria 2714
184 Ga0495678_040142 3300049459 Bacteria 1883
185 nmdc:mga03683_13358_c1 3300050489 Bacteria 2729
186 nmdc:mga03n38_244384_c1 3300050490 Bacteria 946
187 nmdc:mga03n38_54239_c1 3300050490 Bacteria 1801
188 nmdc:mga0yw44_148255_c1 3300050492 Bacteria 1529
189 nmdc:mga0yw44_380009_c1 3300050492 Bacteria 954
190 nmdc:mga0k408_28166_c1 3300050493 Bacteria 3194
191 nmdc:mga0sz30_74322_c1 3300050516 Bacteria 1466
192 Ga0500651_0192477 3300053093 Bacteria 1207
193 Ga0500594_0002791 3300053118 Bacteria 3803
194 Ga0500628_010478 3300053129 Bacteria 1662
195 Ga0500658_0000398 3300053134 Bacteria 18907
196 Ga0500606_035398 3300053152 Bacteria 1624
197 Ga0500616_0021622 3300053153 Bacteria 3602
198 Ga0500627_0024345 3300053158 Bacteria 2477
199 Ga0500634_0020660 3300053161 Bacteria 3562
200 Ga0500596_017924 3300053735 Bacteria 1062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2838661181 2838663551 221
2 3300041491 Ga0451833_0190596 Ga0451833_0190596_4041_4712 223
3 3300041492 Ga0451835_0302054 Ga0451835_0302054_4053_4724 223
4 3300041498 Ga0451841_0964193 Ga0451841_0964193_141_812 223
5 3300041507 Ga0451851_0830938 Ga0451851_0830938_1754_2425 223
6 3300041509 Ga0451843_0920206 Ga0451843_0920206_854_1525 223
7 3300041512 Ga0451853_1316019 Ga0451853_1316019_7830_8501 223
8 3300048924 Ga0496121_0167528 Ga0496121_0167528_54_725 223
9 3300042004 Ga0439445_0048173 Ga0439445_0048173_318_998 225
10 3300047470 Ga0495681_0204859 Ga0495681_0204859_55_738 226
11 3300006048 Ga0075363_100206725 Ga0075363_1002067252 227
12 3300003215 JGI25153J46596_10014009 JGI25153J46596_100140092 229
13 3300003790 Ga0055528_1019713 Ga0055528_10197132 229
14 3300006048 Ga0075363_100118809 Ga0075363_1001188092 229
15 3300025295 Ga0209564_1022595 Ga0209564_10225952 229
16 3300046474 Ga0495605_0017910 Ga0495605_0017910_2919_3689 229
17 3300046507 Ga0495606_0009445 Ga0495606_0009445_1153_1923 229
18 3300046512 Ga0495610_0100966 Ga0495610_0100966_327_1097 229
19 3300046515 Ga0495620_0003941 Ga0495620_0003941_6529_7299 229
20 3300046518 Ga0495631_0102099 Ga0495631_0102099_30_800 229
21 3300046530 Ga0495654_0087616 Ga0495654_0087616_541_1311 229
22 3300046691 Ga0495670_0140182 Ga0495670_0140182_92_862 229
23 3300046692 Ga0495671_0132921 Ga0495671_0132921_388_1158 229
24 3300046694 Ga0495649_0009101 Ga0495649_0009101_4570_5340 229
25 3300047318 Ga0495636_0029828 Ga0495636_0029828_274_1044 229
26 3300047443 Ga0495687_016755 Ga0495687_016755_455_1225 229
27 3300047472 Ga0495686_0005789 Ga0495686_0005789_5532_6302 229
28 3300049459 Ga0495678_040142 Ga0495678_040142_1061_1831 229
29 3300050490 nmdc:mga03n38_54239_c1 nmdc:mga03n38_54239_c1_1003_1773 229
30 3300053093 Ga0500651_0192477 Ga0500651_0192477_409_1179 229
31 3300053118 Ga0500594_0002791 Ga0500594_0002791_2954_3724 229
32 3300053129 Ga0500628_010478 Ga0500628_010478_584_1354 229
33 3300053134 Ga0500658_0000398 Ga0500658_0000398_10117_10887 229
34 3300053153 Ga0500616_0021622 Ga0500616_0021622_454_1224 229
35 3300053158 Ga0500627_0024345 Ga0500627_0024345_1313_2083 229
36 3300048091 Ga0495626_0049766 Ga0495626_0049766_1050_1820 231
37 3300002987 JGI25159J45721_1000764 JGI25159J45721_100076414 236
38 3300005262 Ga0065165_1001686 Ga0065165_100168620 236
39 3300025208 Ga0209436_102909 Ga0209436_1029093 236
40 3300025284 Ga0209130_1000013 Ga0209130_100001319 236
41 3300025302 Ga0207426_1000081 Ga0207426_100008119 236
42 iso_pu_bacteria 2513237144 2513907964 248
43 iso_pu_bacteria 2582581315 2585325859 248
44 iso_pu_bacteria 2585427530 2585556893 248
45 iso_pu_bacteria 2818991453 2819643450 248
46 iso_pu_bacteria 2524023209 2524457636 249
47 iso_pu_bacteria 2529292951 2530649046 249
48 iso_pu_bacteria 2582581294 2585203995 249
49 iso_pu_bacteria 2582581299 2585229110 249
50 iso_pu_bacteria 2643221634 2644190722 249
51 iso_pu_bacteria 2510917028 2511182107 250
52 iso_pu_bacteria 2582581308 2585281938 250
53 iso_pu_bacteria 2582581316 2585330030 250
54 iso_pu_bacteria 2585427527 2585536436 250
55 iso_pu_bacteria 2615840626 2616306203 250
56 iso_pu_bacteria 2615840698 2616553536 250
57 iso_pu_bacteria 2617270742 2617382592 250
58 iso_pu_bacteria 2667528174 2671112489 250
59 iso_pu_bacteria 2791355265 2793354355 250
60 iso_pu_bacteria 2818991448 2819608284 250
61 iso_pu_bacteria 2838029111 2838029173 250
62 iso_pu_bacteria 2842475841 2842476397 250
63 iso_pu_bacteria 2842482326 2842482471 250
64 iso_pu_bacteria 2842502639 2842502701 250
65 iso_pu_bacteria 2919408235 2919408922 250
66 iso_pu_bacteria 2936375103 2936375963 250
67 iso_pu_bacteria 3005416602 3005422691 250
68 iso_pu_bacteria 8005314921 8005321773 250
69 iso_pu_bacteria 8005376324 8005380638 250
70 iso_pu_bacteria 8005484373 8005486020 250
71 iso_pu_bacteria 8005645114 8005646595 250
72 iso_pu_bacteria 8005682033 8005684994 250
73 3300042006 Ga0439432_029000 Ga0439432_029000_267_1028 251
74 iso_pu_bacteria 2510065019 2510136209 251
75 iso_pu_bacteria 2510461076 2510892775 251
76 iso_pu_bacteria 2510917022 2511136155 251
77 iso_pu_bacteria 2513237084 2513568522 251
78 iso_pu_bacteria 2513237085 2513579380 251
79 iso_pu_bacteria 2513237093 2513630628 251
80 iso_pu_bacteria 2513237103 2513712024 251
81 iso_pu_bacteria 2513237162 2514018357 251
82 iso_pu_bacteria 2515075009 2515108863 251
83 iso_pu_bacteria 2515154113 2515633141 251
84 iso_pu_bacteria 2515154114 2515640346 251
85 iso_pu_bacteria 2515154116 2515656429 251
86 iso_pu_bacteria 2515154134 2515738382 251
87 iso_pu_bacteria 2516653077 2517040797 251
88 iso_pu_bacteria 2516653085 2517080424 251
89 iso_pu_bacteria 2517093000 2517098396 251
90 iso_pu_bacteria 2517287029 2517409889 251
91 iso_pu_bacteria 2582581307 2585275321 251
92 iso_pu_bacteria 2585427526 2585526750 251
93 iso_pu_bacteria 2585427531 2585560236 251
94 iso_pu_bacteria 2585427609 2585905582 251
95 iso_pu_bacteria 2585428125 2587979302 251
96 iso_pu_bacteria 2724679232 2725949482 251
97 iso_pu_bacteria 2765235942 2766068973 251
98 iso_pu_bacteria 2842110456 2842116502 251
99 iso_pu_bacteria 2842217011 2842219751 251
100 iso_pu_bacteria 2842304105 2842307441 251
101 iso_pu_bacteria 2857516855 2857517800 251
102 iso_pu_bacteria 2933016740 2933018411 251
103 iso_pu_bacteria 2933570622 2933573903 251
104 iso_pu_bacteria 2933586486 2933592719 251
105 iso_pu_bacteria 2935901341 2935906206 251
106 iso_pu_bacteria 639633055 639645462 251
107 iso_pu_bacteria 8005307578 8005308203 251
108 iso_pu_bacteria 8005460587 8005467646 251
109 iso_pu_bacteria 8005556819 8005562585 251
110 iso_pu_bacteria 8005563573 8005566360 251
111 iso_pu_bacteria 8018163183 8018163633 251
112 iso_pu_bacteria 8023680758 8023681663 251
113 iso_pu_bacteria 8024479707 8024481524 251
114 iso_pu_bacteria 8057874678 8057881402 251
115 3300041456 Ga0451795_0135963 Ga0451795_0135963_48_830 252
116 3300041491 Ga0451833_0916259 Ga0451833_0916259_356_1126 252
117 3300041492 Ga0451835_0663323 Ga0451835_0663323_130_900 252
118 3300041494 Ga0451837_0247443 Ga0451837_0247443_970_1740 252
119 3300041494 Ga0451837_1287790 Ga0451837_1287790_249_1019 252
120 3300041496 Ga0451839_0103695 Ga0451839_0103695_1199_1969 252
121 3300041498 Ga0451841_0641391 Ga0451841_0641391_3922_4692 252
122 3300041501 Ga0451845_0617037 Ga0451845_0617037_26_796 252
123 3300041503 Ga0451847_0046566 Ga0451847_0046566_1036_1806 252
124 3300041505 Ga0451849_0307995 Ga0451849_0307995_3037_3807 252
125 3300041505 Ga0451849_1283024 Ga0451849_1283024_293_1063 252
126 3300041507 Ga0451851_0802193 Ga0451851_0802193_1068_1838 252
127 3300041509 Ga0451843_0681752 Ga0451843_0681752_1232_2002 252
128 3300041509 Ga0451843_0935881 Ga0451843_0935881_207_977 252
129 3300041512 Ga0451853_1323837 Ga0451853_1323837_3155_3925 252
130 3300041512 Ga0451853_2609283 Ga0451853_2609283_3213_3983 252
131 3300041512 Ga0451853_4078348 Ga0451853_4078348_209_982 252
132 3300046474 Ga0495605_0032707 Ga0495605_0032707_1308_2078 252
133 3300046476 Ga0495662_0034604 Ga0495662_0034604_1581_2369 252
134 3300046492 Ga0495585_0013096 Ga0495585_0013096_2482_3252 252
135 3300046492 Ga0495585_0070949 Ga0495585_0070949_1010_1774 252
136 3300046506 Ga0495583_0008195 Ga0495583_0008195_481_1245 252
137 3300046512 Ga0495610_0092827 Ga0495610_0092827_359_1129 252
138 3300046518 Ga0495631_0145223 Ga0495631_0145223_16_780 252
139 3300046524 Ga0495648_0003196 Ga0495648_0003196_8971_9741 252
140 3300046558 Ga0495633_0007491 Ga0495633_0007491_896_1666 252
141 3300046615 Ga0495656_0013689 Ga0495656_0013689_920_1690 252
142 3300046616 Ga0495668_0069256 Ga0495668_0069256_125_895 252
143 3300046616 Ga0495668_0224689 Ga0495668_0224689_10_774 252
144 3300046660 Ga0495625_0042117 Ga0495625_0042117_2086_2856 252
145 3300046660 Ga0495625_0101344 Ga0495625_0101344_473_1237 252
146 3300046665 Ga0495661_0016624 Ga0495661_0016624_1737_2507 252
147 3300046674 Ga0495588_0236335 Ga0495588_0236335_150_920 252
148 3300053152 Ga0500606_035398 Ga0500606_035398_272_1042 252
149 iso_pu_bacteria 2519899620 2520377623 252
150 iso_pu_bacteria 2565956521 2566036218 252
151 iso_pu_bacteria 2585427528 2585543147 252
152 iso_pu_bacteria 2585427593 2585841513 252
153 iso_pu_bacteria 2585427608 2585901497 252
154 iso_pu_bacteria 2615840624 2616297181 252
155 iso_pu_bacteria 2718217882 2719184774 252
156 iso_pu_bacteria 2718217927 2719389460 252
157 iso_pu_bacteria 2718218009 2719728794 252
158 iso_pu_bacteria 2718218363 2721144485 252
159 iso_pu_bacteria 2718218365 2721156432 252
160 iso_pu_bacteria 2718218366 2721161855 252
161 iso_pu_bacteria 2718218423 2721402228 252
162 iso_pu_bacteria 2721755514 2722843000 252
163 iso_pu_bacteria 2721755809 2724036061 252
164 iso_pu_bacteria 2721755810 2724041819 252
165 iso_pu_bacteria 2728369365 2730160889 252
166 iso_pu_bacteria 2728369397 2730295965 252
167 iso_pu_bacteria 2738541333 2739035215 252
168 iso_pu_bacteria 2791355256 2793297915 252
169 iso_pu_bacteria 2791355260 2793323681 252
170 iso_pu_bacteria 2791355261 2793330668 252
171 iso_pu_bacteria 2791355262 2793333949 252
172 iso_pu_bacteria 2791355263 2793342206 252
173 iso_pu_bacteria 2791355264 2793345666 252
174 iso_pu_bacteria 2791355266 2793360211 252
175 iso_pu_bacteria 2802429606 2805935242 252
176 iso_pu_bacteria 2802429633 2806048117 252
177 iso_pu_bacteria 2802429634 2806054653 252
178 iso_pu_bacteria 2802429635 2806060661 252
179 iso_pu_bacteria 2802429636 2806069419 252
180 iso_pu_bacteria 2802429637 2806076946 252
181 iso_pu_bacteria 2838016132 2838020419 252
182 iso_pu_bacteria 2838022645 2838025195 252
183 iso_pu_bacteria 2838042994 2838044166 252
184 iso_pu_bacteria 2838048938 2838049860 252
185 iso_pu_bacteria 2838061910 2838062127 252
186 iso_pu_bacteria 2838068647 2838069517 252
187 iso_pu_bacteria 2838668709 2838669363 252
188 iso_pu_bacteria 2838694306 2838698816 252
189 iso_pu_bacteria 2838701080 2838701735 252
190 iso_pu_bacteria 2842118031 2842122703 252
191 iso_pu_bacteria 2842192696 2842196004 252
192 iso_pu_bacteria 2842198810 2842200761 252
193 iso_pu_bacteria 2842205361 2842209831 252
194 iso_pu_bacteria 2842250916 2842251841 252
195 iso_pu_bacteria 2842264693 2842264892 252
196 iso_pu_bacteria 2842278818 2842283285 252
197 iso_pu_bacteria 2842291075 2842295774 252
198 iso_pu_bacteria 2842311132 2842313033 252
199 iso_pu_bacteria 2842317721 2842320241 252
200 iso_pu_bacteria 2842370503 2842374345 252
201 iso_pu_bacteria 2842377471 2842382178 252
202 iso_pu_bacteria 2842384541 2842389251 252
203 iso_pu_bacteria 2842395702 2842397037 252
204 iso_pu_bacteria 2842422224 2842422708 252
205 iso_pu_bacteria 2842428310 2842429055 252
206 iso_pu_bacteria 2842434925 2842435668 252
207 iso_pu_bacteria 2842441272 2842441471 252
208 iso_pu_bacteria 2842462802 2842463479 252
209 iso_pu_bacteria 2842469257 2842469998 252
210 iso_pu_bacteria 2842489311 2842489817 252
211 iso_pu_bacteria 2842495871 2842498137 252
212 iso_pu_bacteria 2933599457 2933600180 252
213 iso_pu_bacteria 2935894831 2935898733 252
214 iso_pu_bacteria 2936381700 2936385339 252
215 iso_pu_bacteria 2996893221 2996897440 252
216 iso_pu_bacteria 8005275841 8005277803 252
217 iso_pu_bacteria 8005289223 8005290389 252
218 iso_pu_bacteria 8005301065 8005301200 252
219 iso_pu_bacteria 8005382845 8005383175 252
220 iso_pu_bacteria 8005395548 8005398774 252
221 iso_pu_bacteria 8005430974 8005436660 252
222 iso_pu_bacteria 8005570704 8005571372 252
223 iso_pu_bacteria 8005619151 8005624163 252
224 iso_pu_bacteria 8005626139 8005629426 252
225 iso_pu_bacteria 8005688590 8005688986 252
226 iso_pu_bacteria 8005695170 8005697865 252
227 iso_pu_bacteria 8018127388 8018132209 252
228 iso_pu_bacteria 8018176218 8018176364 252
229 iso_pu_bacteria 8024501048 8024507345 252
230 iso_pu_bacteria 8056382006 8056382100 252
231 3300003187 JGI25151J46595_10000475 JGI25151J46595_1000047516 253
232 3300003215 JGI25153J46596_10002244 JGI25153J46596_100022446 253
233 3300003354 JGI25160J50197_1000399 JGI25160J50197_100039919 253
234 3300003771 Ga0055526_1032167 Ga0055526_10321672 253
235 3300003790 Ga0055528_1000207 Ga0055528_100020733 253
236 3300003794 Ga0055531_10050399 Ga0055531_100503991 253
237 3300004625 Ga0055543_1001015 Ga0055543_10010158 253
238 3300006038 Ga0075365_10013918 Ga0075365_100139184 253
239 3300006048 Ga0075363_100016075 Ga0075363_1000160752 253
240 3300006177 Ga0075362_10223174 Ga0075362_102231741 253
241 3300006186 Ga0075369_10005040 Ga0075369_100050407 253
242 3300006353 Ga0075370_10004644 Ga0075370_100046444 253
243 3300009766 Ga0123342_1010420 Ga0123342_10104209 253
244 3300025245 Ga0207425_1003540 Ga0207425_10035403 253
245 3300025258 Ga0209129_1002484 Ga0209129_10024844 253
246 3300025273 Ga0209673_1000022 Ga0209673_1000022294 253
247 3300025273 Ga0209673_1000206 Ga0209673_100020626 253
248 3300025294 Ga0209025_1000190 Ga0209025_100019055 253
249 3300025295 Ga0209564_1000163 Ga0209564_100016343 253
250 3300025295 Ga0209564_1000661 Ga0209564_100066125 253
251 3300025297 Ga0209758_1000245 Ga0209758_100024519 253
252 3300025298 Ga0209050_1008749 Ga0209050_10087494 253
253 3300025299 Ga0209256_1001591 Ga0209256_10015919 253
254 3300025299 Ga0209256_1001964 Ga0209256_10019642 253
255 3300025302 Ga0207426_1000109 Ga0207426_100010973 253
256 3300025303 Ga0209051_1000264 Ga0209051_100026469 253
257 3300025303 Ga0209051_1006289 Ga0209051_10062894 253
258 3300025304 Ga0209257_1002263 Ga0209257_100226315 253
259 3300041413 Ga0439465_0026750 Ga0439465_0026750_677_1441 253
260 3300041459 Ga0451800_1115706 Ga0451800_1115706_203_976 253
261 3300042007 Ga0439449_0113624 Ga0439449_0113624_27_821 253
262 3300046515 Ga0495620_0016945 Ga0495620_0016945_2504_3274 253
263 3300046691 Ga0495670_0028829 Ga0495670_0028829_1510_2382 253
264 3300048920 Ga0496117_0039098 Ga0496117_0039098_1857_2648 253
265 3300048921 Ga0496118_0001761 Ga0496118_0001761_11179_11970 253
266 3300050489 nmdc:mga03683_13358_c1 nmdc:mga03683_13358_c1_1632_2402 253
267 3300050490 nmdc:mga03n38_244384_c1 nmdc:mga03n38_244384_c1_89_889 253
268 3300050492 nmdc:mga0yw44_148255_c1 nmdc:mga0yw44_148255_c1_164_934 253
269 3300050492 nmdc:mga0yw44_380009_c1 nmdc:mga0yw44_380009_c1_93_866 253
270 3300050493 nmdc:mga0k408_28166_c1 nmdc:mga0k408_28166_c1_1792_2556 253
271 3300050516 nmdc:mga0sz30_74322_c1 nmdc:mga0sz30_74322_c1_488_1258 253
272 3300053161 Ga0500634_0020660 Ga0500634_0020660_27_800 253
273 iso_pu_bacteria 2509276021 2509390597 253
274 iso_pu_bacteria 2718218199 2720489465 253
275 iso_pu_bacteria 2718218235 2720628709 253
276 iso_pu_bacteria 2718218269 2720772657 253
277 iso_pu_bacteria 2721755556 2723030097 253
278 iso_pu_bacteria 2721755684 2723564502 253
279 iso_pu_bacteria 2721755685 2723569857 253
280 iso_pu_bacteria 2721755819 2724092686 253
281 iso_pu_bacteria 2721755822 2724101404 253
282 iso_pu_bacteria 2728369352 2730110630 253
283 iso_pu_bacteria 2791355267 2793368682 253
284 iso_pu_bacteria 2802429605 2805928430 253
285 iso_pu_bacteria 2841864319 2841866087 253
286 iso_pu_bacteria 2842363717 2842364337 253
287 iso_pu_bacteria 8005282627 8005285756 253
288 iso_pu_bacteria 8005497431 8005501920 253
289 iso_pu_bacteria 8005668836 8005673342 253
290 iso_pu_bacteria 8046767195 8046771047 253
291 iso_pu_bacteria 8056375014 8056378024 253
292 iso_pu_bacteria 8057575449 8057579811 253
293 3300001979 JGI24740J21852_10002802 JGI24740J21852_100028023 254
294 3300002704 JGI25155J39150_1000006 JGI25155J39150_1000006204 254
295 3300002705 JGI25156J39149_1000019 JGI25156J39149_100001943 254
296 3300002737 JGI25162J39368_1001776 JGI25162J39368_10017769 254
297 3300002737 JGI25162J39368_1001811 JGI25162J39368_10018119 254
298 3300002738 JGI25154J39366_1000177 JGI25154J39366_100017743 254
299 3300002738 JGI25154J39366_1000365 JGI25154J39366_10003654 254
300 3300002741 JGI25157J39369_1000024 JGI25157J39369_1000024121 254
301 3300003214 JGI25165J46597_1001655 JGI25165J46597_10016554 254
302 3300003214 JGI25165J46597_1001688 JGI25165J46597_10016884 254
303 3300003214 JGI25165J46597_1002350 JGI25165J46597_10023507 254
304 3300003316 rootH1_10040651 rootH1_100406518 254
305 3300003320 rootH2_10061138 rootH2_100611383 254
306 3300003322 rootL2_10071741 rootL2_100717412 254
307 3300003323 rootH1_10104992 rootH1_101049922 254
308 3300003323 rootH1_10164523 rootH1_101645232 254
309 3300005548 Ga0070665_100202375 Ga0070665_1002023752 254
310 3300005563 Ga0068855_100083043 Ga0068855_1000830434 254
311 3300005578 Ga0068854_100036342 Ga0068854_1000363425 254
312 3300005616 Ga0068852_100590651 Ga0068852_1005906512 254
313 3300009093 Ga0105240_10000027 Ga0105240_1000002723 254
314 3300009545 Ga0105237_10000508 Ga0105237_1000050831 254
315 3300010375 Ga0105239_10002593 Ga0105239_1000259315 254
316 3300013104 Ga0157370_10000048 Ga0157370_100000484 254
317 3300013105 Ga0157369_10727079 Ga0157369_107270792 254
318 3300015262 Ga0182007_10001900 Ga0182007_1000190013 254
319 3300015265 Ga0182005_1009672 Ga0182005_10096723 254
320 3300025206 Ga0209435_100011 Ga0209435_100011201 254
321 3300025228 Ga0209672_110423 Ga0209672_1104232 254
322 3300025233 Ga0209437_100036 Ga0209437_100036149 254
323 3300025233 Ga0209437_100086 Ga0209437_10008699 254
324 3300025246 Ga0209646_1000024 Ga0209646_1000024210 254
325 3300025246 Ga0209646_1005602 Ga0209646_10056023 254
326 3300025250 Ga0209026_1000030 Ga0209026_1000030210 254
327 3300025253 Ga0209677_100177 Ga0209677_10017736 254
328 3300025256 Ga0209759_1000011 Ga0209759_1000011201 254
329 3300025261 Ga0209233_1000056 Ga0209233_1000056443 254
330 3300025261 Ga0209233_1000110 Ga0209233_1000110149 254
331 3300025261 Ga0209233_1000640 Ga0209233_10006404 254
332 3300025913 Ga0207695_10000024 Ga0207695_10000024607 254
333 3300025914 Ga0207671_10000176 Ga0207671_1000017663 254
334 3300025949 Ga0207667_10118141 Ga0207667_101181413 254
335 3300025981 Ga0207640_10020274 Ga0207640_100202745 254
336 3300026078 Ga0207702_10144210 Ga0207702_101442102 254
337 3300027312 Ga0209371_1001205 Ga0209371_10012059 254
338 3300028379 Ga0268266_10204529 Ga0268266_102045291 254
339 3300030500 Ga0268256_1003732 Ga0268256_10037323 254
340 3300044684 Ga0466966_0188685 Ga0466966_0188685_239_1003 254
341 3300044694 Ga0466963_0030845 Ga0466963_0030845_1742_2506 254
342 3300044765 Ga0466970_0017206 Ga0466970_0017206_1980_2744 254
343 3300044842 Ga0466957_0262422 Ga0466957_0262422_195_959 254
344 3300045836 Ga0466958_0036739 Ga0466958_0036739_1100_1864 254
345 3300046512 Ga0495610_0095581 Ga0495610_0095581_203_973 254
346 3300046520 Ga0495637_0071566 Ga0495637_0071566_396_1166 254
347 3300046522 Ga0495643_0090407 Ga0495643_0090407_556_1329 254
348 3300046522 Ga0495643_0245011 Ga0495643_0245011_52_828 254
349 3300046538 Ga0495609_0035988 Ga0495609_0035988_340_1110 254
350 3300046660 Ga0495625_0213273 Ga0495625_0213273_251_1021 254
351 3300046660 Ga0495625_0271216 Ga0495625_0271216_105_881 254
352 3300046674 Ga0495588_0130899 Ga0495588_0130899_337_1107 254
353 3300047469 Ga0495673_0142058 Ga0495673_0142058_112_882 254
354 3300047470 Ga0495681_0091495 Ga0495681_0091495_435_1220 254
355 3300048903 Ga0496100_0071527 Ga0496100_0071527_412_1176 254
356 3300048905 Ga0496102_0043764 Ga0496102_0043764_2148_2912 254
357 3300048906 Ga0496103_0055704 Ga0496103_0055704_1150_1914 254
358 3300048916 Ga0496113_0106663 Ga0496113_0106663_321_1085 254
359 3300048919 Ga0496116_0024853 Ga0496116_0024853_2535_3299 254
360 3300048920 Ga0496117_0030863 Ga0496117_0030863_2388_3152 254
361 3300048921 Ga0496118_0001988 Ga0496118_0001988_4955_5719 254
362 3300048922 Ga0496119_0046327 Ga0496119_0046327_927_1706 254
363 3300048922 Ga0496119_0058874 Ga0496119_0058874_442_1206 254
364 3300048923 Ga0496120_0033144 Ga0496120_0033144_1002_1766 254
365 3300048923 Ga0496120_0064353 Ga0496120_0064353_191_967 254
366 3300048924 Ga0496121_0003778 Ga0496121_0003778_4912_5676 254
367 3300048924 Ga0496121_0055420 Ga0496121_0055420_1213_1989 254
368 3300048925 Ga0496122_0014846 Ga0496122_0014846_1418_2182 254
369 3300048926 Ga0496123_0033845 Ga0496123_0033845_1432_2196 254
370 3300048927 Ga0496124_0033382 Ga0496124_0033382_3250_4014 254
371 3300048927 Ga0496124_0292747 Ga0496124_0292747_244_1023 254
372 3300048928 Ga0496125_0043464 Ga0496125_0043464_1151_1915 254
373 3300048928 Ga0496125_0105118 Ga0496125_0105118_431_1195 254
374 3300048929 Ga0496126_0089190 Ga0496126_0089190_388_1152 254
375 3300053735 Ga0500596_017924 Ga0500596_017924_270_1034 254
376 iso_pu_bacteria 2775507266 2778174290 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

96

185

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qg7-assembly2.cif.gz_B plasmodium vivax ethanolamine kinase pv091845 0.7083 15 211
2qg7-assembly1.cif.gz_A plasmodium vivax ethanolamine kinase pv091845 0.6883 15 211
2qg7-assembly2.cif.gz_D plasmodium vivax ethanolamine kinase pv091845 0.6741 15 211
7w1a-assembly2.cif.gz_A crystal structure of mph-e in complex with gmp and azithromycin 0.6724 15 222
6sv5-assembly1.cif.gz_A amicoumacin kinase amin in complex with atp 0.6692 9 238
ID Description Score Start End Superfamily
af_C7G071_31_244_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.7412 15 155 3.90.1200.10
3i1aB02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6685 73 187 1.10.510.10
2qg7A02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.6586 58 211 3.90.1200.10
af_Q9VSS3_185_391_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.6351 110 205 3.90.1200.10
1nd4B02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.6205 59 189 3.90.1200.10
ID Description Score Start End GO Terms
AF-A0A4R3RQQ4-F1-model_v4 Uncharacterized protein 0.9883 173 254
AF-A0A7X8Y4Q5-F1-model_v4 Aminoglycoside phosphotransferase family protein 0.9856 9 254 GO:0016740
AF-A0A2T3EKR4-F1-model_v4 Aminoglycoside phosphotransferase 0.9793 1 254 GO:0016740
AF-A0A7W8XLN0-F1-model_v4 Aminoglycoside phosphotransferase (APT) family kinase protein 0.9769 75 254 GO:0016301
AF-A0A4R1YQH3-F1-model_v4 Phosphotransferase family enzyme 0.9724 28 254 GO:0016740

Feature Viewer

pLDDT pTM Quality
93.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map