F427410

General Info

Members Datasets Scaffolds Average Seq Length
376 230 736 279

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0001842|Ga0373937_0001842_10375_11382
Length 335
Sequence MLERLLLPADVKPLWRGAIAGCAAAKDRLDGRKPATVNRNNAGRPIMSHRSSTCALALVAVLTAAMGGAHAADDAKYPSWKGQWNSIVAPGLEGRQYKFDPTKSRGLGQQAPLTPEYQKVLADSMAEQAKGGIGNYPTARCLPGGMPRMAASQAQEYIITPETTYILLGGSEDPLRRIYTDGRDWPANLEPTYQGYSIGRWSGLDGDGRYSVLEVETRGFKGPRAYDSSGLPLAFDNQSVFKERFHLDKDNPNILHNEITVIDHALTRPWTVDKTFRHNPNPRPYWRETSCTEGNNQVVLGKENYFLSAEGFLMPTKKDQTPPDLRYFKQMQAPK

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 10.11
Rhizosphere 84.84
Stem 0
Stem Tuber 0
Unclassified 22.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0001842 3300036401 Bacteria 17815
2 JGI24737J22298_10029243 3300001990 Bacteria 1729
3 JGI24743J22301_10000268 3300001991 Bacteria 5562
4 JGI24748J21848_1005639 3300002074 Bacteria 1454
5 JGI24738J21930_10027703 3300002075 Unclassified 1160
6 JGI24744J21845_10011076 3300002077 Bacteria 1845
7 JGI24033J26618_1002038 3300002155 Unclassified 2034
8 JGI24034J26672_10000329 3300002239 Bacteria 6077
9 Ga0068869_100009235 3300005334 Bacteria 6391
10 Ga0070666_10044433 3300005335 Bacteria 2976
11 Ga0070682_100051445 3300005337 Bacteria 2575
12 Ga0068868_100020094 3300005338 Bacteria 5012
13 Ga0070691_10050344 3300005341 Bacteria 1987
14 Ga0070687_100001804 3300005343 Bacteria 7729
15 Ga0070692_10013932 3300005345 Bacteria 3760
16 Ga0070668_100043102 3300005347 Bacteria 3460
17 Ga0070669_100219052 3300005353 Bacteria 1504
18 Ga0070675_100007435 3300005354 Bacteria 8461
19 Ga0070671_100019958 3300005355 Bacteria 5460
20 Ga0070674_100007217 3300005356 Bacteria 6542
21 Ga0070673_100002780 3300005364 Bacteria 10762
22 Ga0070688_100012870 3300005365 Bacteria 4701
23 Ga0070659_100019715 3300005366 Bacteria 5116
24 Ga0070667_100009789 3300005367 Bacteria 7947
25 Ga0070713_100034529 3300005436 Bacteria 4064
26 Ga0070713_100068876 3300005436 Bacteria 2983
27 Ga0070713_100069289 3300005436 Unclassified 2974
28 Ga0070710_10114428 3300005437 Bacteria 1625
29 Ga0070711_100097920 3300005439 Bacteria 2128
30 Ga0070711_100130969 3300005439 Bacteria 1868
31 Ga0070705_100049245 3300005440 Bacteria 2445
32 Ga0070700_100051971 3300005441 Bacteria 2553
33 Ga0070700_100114398 3300005441 Bacteria 1799
34 Ga0070663_100013157 3300005455 Bacteria 5262
35 Ga0070663_100134418 3300005455 Bacteria 1882
36 Ga0070663_100271961 3300005455 Bacteria 1347
37 Ga0070678_100009522 3300005456 Bacteria 5891
38 Ga0070662_100004423 3300005457 Bacteria 8885
39 Ga0068867_100015161 3300005459 Bacteria 5465
40 Ga0070685_10018966 3300005466 Bacteria 3706
41 Ga0070706_100101241 3300005467 Bacteria 2677
42 Ga0070707_100183419 3300005468 Bacteria 2040
43 Ga0070698_100110147 3300005471 Bacteria 2719
44 Ga0070684_100014022 3300005535 Bacteria 6480
45 Ga0070697_100110592 3300005536 Bacteria 2289
46 Ga0070697_100375623 3300005536 Bacteria 1230
47 Ga0068853_100144783 3300005539 Unclassified 2135
48 Ga0070672_100009769 3300005543 Bacteria 6626
49 Ga0070686_100005138 3300005544 Bacteria 7225
50 Ga0070693_100077028 3300005547 Bacteria 1978
51 Ga0070665_100014763 3300005548 Bacteria 7840
52 Ga0068855_100640702 3300005563 Bacteria 1142
53 Ga0070664_100059425 3300005564 Bacteria 3252
54 Ga0068857_100191868 3300005577 Unclassified 1861
55 Ga0068854_100014775 3300005578 Bacteria 5155
56 Ga0068856_100121295 3300005614 Bacteria 2616
57 Ga0070702_100006271 3300005615 Bacteria 5615
58 Ga0068852_100007338 3300005616 Bacteria 8043
59 Ga0068859_100049952 3300005617 Bacteria 4201
60 Ga0068864_100010063 3300005618 Bacteria 7808
61 Ga0068861_100041539 3300005719 Bacteria 3445
62 Ga0068861_100310096 3300005719 Bacteria 1370
63 Ga0068870_10002160 3300005840 Bacteria 8140
64 Ga0068863_100008334 3300005841 Bacteria 10125
65 Ga0068863_100330355 3300005841 Bacteria 1482
66 Ga0068863_100364994 3300005841 Bacteria 1408
67 Ga0068858_100028850 3300005842 Bacteria 5153
68 Ga0068858_100569282 3300005842 Unclassified 1097
69 Ga0068860_100088715 3300005843 Bacteria 2944
70 Ga0068862_100024587 3300005844 Bacteria 5055
71 Ga0081455_10007777 3300005937 Bacteria 11238
72 Ga0081455_10010194 3300005937 Bacteria 9564
73 Ga0081455_10011266 3300005937 Bacteria 8999
74 Ga0081455_10102495 3300005937 Bacteria 2294
75 Ga0081455_10198834 3300005937 Bacteria 1502
76 Ga0081455_10256512 3300005937 Unclassified 1276
77 Ga0081540_1006858 3300005983 Bacteria 8218
78 Ga0081540_1062145 3300005983 Bacteria 1776
79 Ga0081540_1066883 3300005983 Unclassified 1681
80 Ga0070717_10164309 3300006028 Bacteria 1928
81 Ga0070717_10261944 3300006028 Bacteria 1530
82 Ga0075365_10035186 3300006038 Bacteria 3239
83 Ga0075365_10218491 3300006038 Bacteria 1337
84 Ga0070715_10130744 3300006163 Unclassified 1208
85 Ga0070712_100171220 3300006175 Unclassified 1685
86 Ga0075367_10112133 3300006178 Bacteria 1675
87 Ga0068871_100180753 3300006358 Bacteria 1813
88 Ga0075431_100196486 3300006847 Unclassified 2065
89 Ga0075433_10024573 3300006852 Bacteria 5088
90 Ga0075433_10254811 3300006852 Bacteria 1557
91 Ga0075434_100014762 3300006871 Bacteria 7472
92 Ga0075434_100084752 3300006871 Bacteria 3168
93 Ga0068865_100005064 3300006881 Bacteria 7975
94 Ga0097620_100049952 3300006931 Bacteria 4201
95 Ga0099795_10000918 3300007788 Bacteria 5953
96 Ga0099795_10002862 3300007788 Bacteria 4172
97 Ga0099795_10003794 3300007788 Bacteria 3799
98 Ga0099795_10006577 3300007788 Bacteria 3182
99 Ga0099795_10013338 3300007788 Unclassified 2520
100 Ga0099795_10043394 3300007788 Bacteria 1609
101 Ga0099795_10052066 3300007788 Bacteria 1494
102 Ga0105251_10061424 3300009011 Bacteria 1766
103 Ga0105250_10054803 3300009092 Bacteria 1600
104 Ga0111539_10024303 3300009094 Bacteria 7440
105 Ga0111539_10087207 3300009094 Bacteria 3667
106 Ga0105245_10004937 3300009098 Bacteria 11729
107 Ga0105245_10174283 3300009098 Bacteria 2050
108 Ga0105247_10002663 3300009101 Bacteria 12022
109 Ga0105247_10143449 3300009101 Bacteria 1567
110 Ga0105243_10013511 3300009148 Bacteria 6176
111 Ga0105242_10016690 3300009176 Bacteria 5711
112 Ga0105248_10013675 3300009177 Bacteria 8934
113 Ga0105249_10035717 3300009553 Bacteria 4507
114 Ga0105249_10130187 3300009553 Bacteria 2401
115 Ga0099796_10001396 3300010159 Bacteria 4833
116 Ga0099796_10012481 3300010159 Bacteria 2401
117 Ga0105239_10021623 3300010375 Bacteria 7092
118 Ga0105239_10227007 3300010375 Unclassified 2095
119 Ga0105246_10020726 3300011119 Bacteria 4220
120 Ga0105246_10063659 3300011119 Unclassified 2573
121 Ga0157374_10003066 3300013296 Bacteria 14010
122 Ga0157374_10409835 3300013296 Bacteria 1353
123 Ga0157378_10040769 3300013297 Bacteria 4118
124 Ga0157378_10164875 3300013297 Bacteria 2075
125 Ga0163162_10049387 3300013306 Bacteria 4216
126 Ga0163162_10161045 3300013306 Unclassified 2366
127 Ga0157375_10037777 3300013308 Bacteria 4629
128 Ga0157375_10200638 3300013308 Unclassified 2151
129 Ga0163163_10007647 3300014325 Bacteria 9547
130 Ga0157380_10007444 3300014326 Bacteria 7773
131 Ga0157377_10003781 3300014745 Bacteria 6871
132 Ga0157379_10010133 3300014968 Bacteria 8216
133 Ga0157379_10114822 3300014968 Bacteria 2420
134 Ga0157379_10193104 3300014968 Bacteria 1840
135 Ga0157376_10006579 3300014969 Bacteria 8225
136 Ga0163161_10005212 3300017792 Bacteria 9043
137 Ga0163161_10156026 3300017792 Unclassified 1738
138 Ga0213874_10012437 3300021377 Bacteria 2183
139 Ga0207713_1061176 3300025735 Unclassified 1434
140 Ga0207688_10000549 3300025901 Bacteria 18295
141 Ga0207647_10008330 3300025904 Bacteria 7434
142 Ga0207693_10034711 3300025915 Bacteria 3978
143 Ga0207693_10150410 3300025915 Unclassified 1831
144 Ga0207693_10428291 3300025915 Unclassified 1034
145 Ga0207663_10138912 3300025916 Bacteria 1690
146 Ga0207662_10003432 3300025918 Bacteria 8153
147 Ga0207657_10026650 3300025919 Bacteria 5306
148 Ga0207681_10041437 3300025923 Bacteria 3070
149 Ga0207650_10029474 3300025925 Bacteria 3946
150 Ga0207659_10042412 3300025926 Bacteria 3190
151 Ga0207687_10062320 3300025927 Bacteria 2637
152 Ga0207687_10392124 3300025927 Bacteria 1140
153 Ga0207700_10025881 3300025928 Bacteria 4083
154 Ga0207700_10087359 3300025928 Bacteria 2452
155 Ga0207700_10159924 3300025928 Bacteria 1870
156 Ga0207700_10178511 3300025928 Unclassified 1776
157 Ga0207700_10604220 3300025928 Bacteria 976
158 Ga0207664_10147372 3300025929 Unclassified 1997
159 Ga0207690_10026454 3300025932 Bacteria 3653
160 Ga0207706_10006206 3300025933 Bacteria 11103
161 Ga0207686_10080090 3300025934 Unclassified 2128
162 Ga0207709_10005760 3300025935 Bacteria 7001
163 Ga0207669_10383801 3300025937 Unclassified 1095
164 Ga0207704_10011619 3300025938 Bacteria 4342
165 Ga0207711_10007730 3300025941 Bacteria 8982
166 Ga0207689_10007304 3300025942 Bacteria 9699
167 Ga0207679_10064016 3300025945 Unclassified 2747
168 Ga0207651_10082040 3300025960 Unclassified 2326
169 Ga0207712_10031958 3300025961 Bacteria 3549
170 Ga0207712_10170634 3300025961 Bacteria 1700
171 Ga0207668_10111278 3300025972 Unclassified 2055
172 Ga0207658_10347033 3300025986 Unclassified 1291
173 Ga0207677_10010467 3300026023 Bacteria 5248
174 Ga0207703_10008784 3300026035 Bacteria 7967
175 Ga0207703_10225456 3300026035 Bacteria 1678
176 Ga0207639_10028830 3300026041 Plasmid 4057
177 Ga0207639_10571832 3300026041 Bacteria 1040
178 Ga0207678_10003706 3300026067 Bacteria 13735
179 Ga0207678_10185992 3300026067 Bacteria 1774
180 Ga0207708_10001468 3300026075 Bacteria 17638
181 Ga0207708_10409709 3300026075 Unclassified 1122
182 Ga0207702_10420706 3300026078 Bacteria 1292
183 Ga0207641_10079813 3300026088 Bacteria 2837
184 Ga0207648_10004345 3300026089 Bacteria 14578
185 Ga0207676_10051714 3300026095 Bacteria 3208
186 Ga0207674_10171826 3300026116 Unclassified 2120
187 Ga0207675_100025507 3300026118 Bacteria 5502
188 Ga0207675_100844088 3300026118 Unclassified 931
189 Ga0209179_1000770 3300027512 Bacteria 3481
190 Ga0209179_1002366 3300027512 Unclassified 2535
191 Ga0209179_1016898 3300027512 Bacteria 1374
192 Ga0207428_10214811 3300027907 Bacteria 1444
193 Ga0268264_10113277 3300028381 Unclassified 2379
194 Ga0373938_0009001 3300034957 Unclassified 1797
195 Ga0373926_0013557 3300035083 Bacteria 2767
196 Ga0373926_0094651 3300035083 Unclassified 1113
197 Ga0373940_0050337 3300035088 Bacteria 1169
198 Ga0373945_0009460 3300035116 Bacteria 3193
199 Ga0373945_0129989 3300035116 Unclassified 1008
200 Ga0373953_0015429 3300035117 Bacteria 2769
201 Ga0373953_0136118 3300035117 Bacteria 1049
202 Ga0373954_0068098 3300035118 Unclassified 1688
203 Ga0373957_0035967 3300035120 Bacteria 1843
204 Ga0373957_0123098 3300035120 Bacteria 1051
205 Ga0373943_0050428 3300035170 Bacteria 2045
206 Ga0373943_0051882 3300035170 Unclassified 2021
207 Ga0373943_0119763 3300035170 Unclassified 1398
208 Ga0373943_0139373 3300035170 Bacteria 1305
209 Ga0373924_0043829 3300035410 Bacteria 1838
210 Ga0373931_0034914 3300035691 Bacteria 2612
211 Ga0373935_0019850 3300035692 Bacteria 4102
212 Ga0373935_0308844 3300035692 Unclassified 1119
213 Ga0373935_0476033 3300035692 Unclassified 904
214 Ga0373927_0016058 3300035695 Bacteria 4941
215 Ga0373927_0016327 3300035695 Bacteria 4899
216 Ga0373927_0024969 3300035695 Bacteria 3907
217 Ga0373927_0041155 3300035695 Bacteria 2997
218 Ga0373927_0076068 3300035695 Bacteria 2174
219 Ga0373927_0141038 3300035695 Bacteria 1576
220 Ga0373927_0143127 3300035695 Bacteria 1565
221 Ga0373933_0005012 3300035724 Bacteria 7225
222 Ga0373947_0010343 3300035725 Bacteria 5354
223 Ga0373947_0021770 3300035725 Bacteria 3713
224 Ga0373947_0029623 3300035725 Bacteria 3212
225 Ga0373947_0059965 3300035725 Bacteria 2309
226 Ga0373947_0090720 3300035725 Unclassified 1905
227 Ga0373937_0002933 3300036401 Bacteria 14270
228 Ga0373937_0003759 3300036401 Bacteria 12825
229 Ga0373937_0033773 3300036401 Bacteria 4649
230 Ga0373925_0014587 3300037068 Bacteria 5679
231 Ga0373925_0029331 3300037068 Bacteria 4036
232 Ga0373925_0032011 3300037068 Unclassified 3869
233 Ga0373925_0151245 3300037068 Bacteria 1823
234 Ga0436364_0761007 3300037853 Bacteria 1253
235 Ga0436364_1224040 3300037853 Bacteria 1458
236 Ga0436365_1216821 3300039437 Bacteria 4700
237 Ga0436365_1404441 3300039437 Bacteria 2450
238 Ga0436360_0207735 3300039438 Unclassified 896
239 Ga0436360_1046199 3300039438 Unclassified 1110
240 Ga0436363_0252339 3300039450 Bacteria 2727
241 Ga0436363_0583111 3300039450 Unclassified 4620
242 Ga0436363_0718297 3300039450 Unclassified 4784
243 Ga0436363_1052127 3300039450 Unclassified 943
244 Ga0436363_1452818 3300039450 Bacteria 5537
245 Ga0436363_1496932 3300039450 Bacteria 4303
246 Ga0451853_2048748 3300041512 Bacteria 1510
247 Ga0495603_0014469 3300046455 Bacteria 4772
248 Ga0495590_0121848 3300046457 Unclassified 935
249 Ga0495590_0146077 3300046457 Unclassified 856
250 Ga0495591_061479 3300046458 Unclassified 997
251 Ga0495641_0018023 3300046461 Bacteria 3657
252 Ga0495641_0024149 3300046461 Bacteria 3005
253 Ga0495641_0154492 3300046461 Bacteria 1026
254 Ga0495580_0081267 3300046472 Bacteria 2259
255 Ga0495580_0159421 3300046472 Bacteria 1562
256 Ga0495580_0209110 3300046472 Unclassified 1343
257 Ga0495582_0018079 3300046473 Bacteria 3856
258 Ga0495582_0054237 3300046473 Bacteria 2211
259 Ga0495605_0044880 3300046474 Bacteria 2182
260 Ga0495605_0200123 3300046474 Bacteria 871
261 Ga0495639_0091850 3300046475 Bacteria 1425
262 Ga0495639_0102604 3300046475 Bacteria 1352
263 Ga0495662_0154698 3300046476 Unclassified 1129
264 Ga0495584_0045925 3300046491 Bacteria 2203
265 Ga0495585_0005446 3300046492 Bacteria 8022
266 Ga0495596_0047823 3300046500 Bacteria 1678
267 Ga0495607_0041207 3300046501 Unclassified 2744
268 Ga0495607_0167760 3300046501 Bacteria 1111
269 Ga0495616_0034686 3300046513 Bacteria 2617
270 Ga0495630_0104205 3300046517 Bacteria 2147
271 Ga0495630_0182179 3300046517 Bacteria 1602
272 Ga0495631_0056868 3300046518 Bacteria 1703
273 Ga0495631_0139738 3300046518 Unclassified 1040
274 Ga0495637_0051719 3300046520 Bacteria 1717
275 Ga0495644_0005933 3300046523 Bacteria 4764
276 Ga0495644_0010106 3300046523 Bacteria 3636
277 Ga0495663_0038982 3300046525 Bacteria 1438
278 Ga0495666_0017072 3300046526 Bacteria 3614
279 Ga0495666_0072253 3300046526 Bacteria 1639
280 Ga0495642_0095533 3300046528 Bacteria 1261
281 Ga0495654_0058962 3300046530 Unclassified 1850
282 Ga0495665_0040890 3300046531 Bacteria 2468
283 Ga0495640_0023885 3300046533 Bacteria 4447
284 Ga0495640_0244109 3300046533 Unclassified 1126
285 Ga0495598_0012409 3300046537 Bacteria 2091
286 Ga0495621_0027079 3300046539 Bacteria 1938
287 Ga0495656_0005421 3300046615 Bacteria 4403
288 Ga0495668_0074259 3300046616 Bacteria 1867
289 Ga0495634_0212069 3300046642 Unclassified 1198
290 Ga0495611_0025123 3300046648 Bacteria 2594
291 Ga0495611_0163038 3300046648 Unclassified 1042
292 Ga0495659_0011740 3300046664 Bacteria 2825
293 Ga0495661_0034736 3300046665 Bacteria 3170
294 Ga0495588_0017425 3300046674 Bacteria 3489
295 Ga0495588_0026593 3300046674 Bacteria 2890
296 Ga0495599_0236476 3300046678 Bacteria 1115
297 Ga0495647_0004238 3300046681 Bacteria 4644
298 Ga0495647_0047593 3300046681 Unclassified 1655
299 Ga0495658_0011036 3300046683 Bacteria 4532
300 Ga0495658_0011467 3300046683 Unclassified 4460
301 Ga0495658_0040130 3300046683 Bacteria 2601
302 Ga0495658_0063837 3300046683 Bacteria 2120
303 Ga0495669_0016037 3300046684 Bacteria 3208
304 Ga0495613_0070739 3300046689 Bacteria 2544
305 Ga0495624_0077521 3300046690 Bacteria 2061
306 Ga0495670_0043159 3300046691 Bacteria 2250
307 Ga0495671_0108415 3300046692 Unclassified 1356
308 Ga0495649_0105014 3300046694 Bacteria 1500
309 Ga0495589_0231498 3300046794 Unclassified 866
310 Ga0495660_0068972 3300046810 Unclassified 1880
311 Ga0495581_0053709 3300047315 Bacteria 2327
312 Ga0495674_0117806 3300047319 Bacteria 2246
313 Ga0495676_0020320 3300047321 Bacteria 5829
314 Ga0495676_0051021 3300047321 Bacteria 3313
315 Ga0495676_0143019 3300047321 Unclassified 1712
316 Ga0495677_0029047 3300047445 Bacteria 2010
317 Ga0495677_0122411 3300047445 Bacteria 993
318 Ga0495679_028434 3300047446 Bacteria 1835
319 Ga0495681_0174033 3300047470 Bacteria 889
320 Ga0495615_0017830 3300048090 Unclassified 1553
321 Ga0496100_0013738 3300048903 Bacteria 4682
322 Ga0496101_0071148 3300048904 Bacteria 2549
323 Ga0496101_0115929 3300048904 Bacteria 2021
324 Ga0496102_0084500 3300048905 Unclassified 2929
325 Ga0496102_0168575 3300048905 Bacteria 2061
326 Ga0496102_0234812 3300048905 Bacteria 1729
327 Ga0496103_0001572 3300048906 Bacteria 15074
328 Ga0496104_0020839 3300048907 Bacteria 6012
329 Ga0496104_0025019 3300048907 Bacteria 5500
330 Ga0496104_0065633 3300048907 Bacteria 3444
331 Ga0496104_0068276 3300048907 Bacteria 3378
332 Ga0496104_0101380 3300048907 Unclassified 2756
333 Ga0496104_0151380 3300048907 Unclassified 2227
334 Ga0496105_0014731 3300048908 Bacteria 6224
335 Ga0496105_0199071 3300048908 Bacteria 1635
336 Ga0496106_0067652 3300048909 Unclassified 2723
337 Ga0496106_0180744 3300048909 Unclassified 1674
338 Ga0496106_0222755 3300048909 Bacteria 1505
339 Ga0496107_0145591 3300048910 Unclassified 1752
340 Ga0496107_0295734 3300048910 Bacteria 1205
341 Ga0496107_0321561 3300048910 Bacteria 1151
342 Ga0496107_0335445 3300048910 Bacteria 1125
343 Ga0496108_0027310 3300048911 Bacteria 4712
344 Ga0496108_0150707 3300048911 Unclassified 2006
345 Ga0496109_0014200 3300048912 Bacteria 6926
346 Ga0496109_0086291 3300048912 Bacteria 2898
347 Ga0496110_0047455 3300048913 Bacteria 3761
348 Ga0496110_0107562 3300048913 Bacteria 2504
349 Ga0496111_0004206 3300048914 Bacteria 9064
350 Ga0496112_0077034 3300048915 Bacteria 3297
351 Ga0496112_0865934 3300048915 Unclassified 826
352 Ga0496114_0067757 3300048917 Unclassified 2994
353 Ga0496114_0131393 3300048917 Bacteria 2162
354 Ga0496115_0004404 3300048918 Bacteria 10197
355 Ga0496115_0077624 3300048918 Bacteria 2701
356 Ga0496115_0123571 3300048918 Unclassified 2131
357 Ga0496115_0212831 3300048918 Bacteria 1596
358 Ga0496115_0636966 3300048918 Bacteria 844
359 nmdc:mga0yw44_97448_c1 3300050492 Unclassified 1868
360 nmdc:mga06z11_207887_c1 3300050494 Unclassified 1139
361 nmdc:mga06r32_189043_c1 3300050510 Unclassified 2046
362 nmdc:mga08y16_69129_c1 3300050511 Bacteria 3682
363 nmdc:mga0n895_66267_c1 3300050512 Unclassified 3576
364 nmdc:mga0a205_11708_c1 3300050515 Bacteria 8090
365 nmdc:mga0a205_21780_c1 3300050515 Bacteria 6060
366 nmdc:mga0a205_258373_c1 3300050515 Bacteria 1620
367 Ga0495601_0049574 3300053077 Unclassified 2648
368 Ga0495655_0001923 3300053083 Unclassified 3240
369 Ga0373937_0001842
370 JGI24737J22298_10029243
371 JGI24743J22301_10000268
372 JGI24748J21848_1005639
373 JGI24738J21930_10027703
374 JGI24744J21845_10011076
375 JGI24033J26618_1002038
376 JGI24034J26672_10000329
377 Ga0068869_100009235
378 Ga0070666_10044433
379 Ga0070682_100051445
380 Ga0068868_100020094
381 Ga0070691_10050344
382 Ga0070687_100001804
383 Ga0070692_10013932
384 Ga0070668_100043102
385 Ga0070669_100219052
386 Ga0070675_100007435
387 Ga0070671_100019958
388 Ga0070674_100007217
389 Ga0070673_100002780
390 Ga0070688_100012870
391 Ga0070659_100019715
392 Ga0070667_100009789
393 Ga0070713_100034529
394 Ga0070713_100068876
395 Ga0070713_100069289
396 Ga0070710_10114428
397 Ga0070711_100097920
398 Ga0070711_100130969
399 Ga0070705_100049245
400 Ga0070700_100051971
401 Ga0070700_100114398
402 Ga0070663_100013157
403 Ga0070663_100134418
404 Ga0070663_100271961
405 Ga0070678_100009522
406 Ga0070662_100004423
407 Ga0068867_100015161
408 Ga0070685_10018966
409 Ga0070706_100101241
410 Ga0070707_100183419
411 Ga0070698_100110147
412 Ga0070684_100014022
413 Ga0070697_100110592
414 Ga0070697_100375623
415 Ga0068853_100144783
416 Ga0070672_100009769
417 Ga0070686_100005138
418 Ga0070693_100077028
419 Ga0070665_100014763
420 Ga0068855_100640702
421 Ga0070664_100059425
422 Ga0068857_100191868
423 Ga0068854_100014775
424 Ga0068856_100121295
425 Ga0070702_100006271
426 Ga0068852_100007338
427 Ga0068859_100049952
428 Ga0068864_100010063
429 Ga0068861_100041539
430 Ga0068861_100310096
431 Ga0068870_10002160
432 Ga0068863_100008334
433 Ga0068863_100330355
434 Ga0068863_100364994
435 Ga0068858_100028850
436 Ga0068858_100569282
437 Ga0068860_100088715
438 Ga0068862_100024587
439 Ga0081455_10007777
440 Ga0081455_10010194
441 Ga0081455_10011266
442 Ga0081455_10102495
443 Ga0081455_10198834
444 Ga0081455_10256512
445 Ga0081540_1006858
446 Ga0081540_1062145
447 Ga0081540_1066883
448 Ga0070717_10164309
449 Ga0070717_10261944
450 Ga0075365_10035186
451 Ga0075365_10218491
452 Ga0070715_10130744
453 Ga0070712_100171220
454 Ga0075367_10112133
455 Ga0068871_100180753
456 Ga0075431_100196486
457 Ga0075433_10024573
458 Ga0075433_10254811
459 Ga0075434_100014762
460 Ga0075434_100084752
461 Ga0068865_100005064
462 Ga0097620_100049952
463 Ga0099795_10000918
464 Ga0099795_10002862
465 Ga0099795_10003794
466 Ga0099795_10006577
467 Ga0099795_10013338
468 Ga0099795_10043394
469 Ga0099795_10052066
470 Ga0105251_10061424
471 Ga0105250_10054803
472 Ga0111539_10024303
473 Ga0111539_10087207
474 Ga0105245_10004937
475 Ga0105245_10174283
476 Ga0105247_10002663
477 Ga0105247_10143449
478 Ga0105243_10013511
479 Ga0105242_10016690
480 Ga0105248_10013675
481 Ga0105249_10035717
482 Ga0105249_10130187
483 Ga0099796_10001396
484 Ga0099796_10012481
485 Ga0105239_10021623
486 Ga0105239_10227007
487 Ga0105246_10020726
488 Ga0105246_10063659
489 Ga0157374_10003066
490 Ga0157374_10409835
491 Ga0157378_10040769
492 Ga0157378_10164875
493 Ga0163162_10049387
494 Ga0163162_10161045
495 Ga0157375_10037777
496 Ga0157375_10200638
497 Ga0163163_10007647
498 Ga0157380_10007444
499 Ga0157377_10003781
500 Ga0157379_10010133
501 Ga0157379_10114822
502 Ga0157379_10193104
503 Ga0157376_10006579
504 Ga0163161_10005212
505 Ga0163161_10156026
506 Ga0213874_10012437
507 Ga0207713_1061176
508 Ga0207688_10000549
509 Ga0207647_10008330
510 Ga0207693_10034711
511 Ga0207693_10150410
512 Ga0207693_10428291
513 Ga0207663_10138912
514 Ga0207662_10003432
515 Ga0207657_10026650
516 Ga0207681_10041437
517 Ga0207650_10029474
518 Ga0207659_10042412
519 Ga0207687_10062320
520 Ga0207687_10392124
521 Ga0207700_10025881
522 Ga0207700_10087359
523 Ga0207700_10159924
524 Ga0207700_10178511
525 Ga0207700_10604220
526 Ga0207664_10147372
527 Ga0207690_10026454
528 Ga0207706_10006206
529 Ga0207686_10080090
530 Ga0207709_10005760
531 Ga0207669_10383801
532 Ga0207704_10011619
533 Ga0207711_10007730
534 Ga0207689_10007304
535 Ga0207679_10064016
536 Ga0207651_10082040
537 Ga0207712_10031958
538 Ga0207712_10170634
539 Ga0207668_10111278
540 Ga0207658_10347033
541 Ga0207677_10010467
542 Ga0207703_10008784
543 Ga0207703_10225456
544 Ga0207639_10028830
545 Ga0207639_10571832
546 Ga0207678_10003706
547 Ga0207678_10185992
548 Ga0207708_10001468
549 Ga0207708_10409709
550 Ga0207702_10420706
551 Ga0207641_10079813
552 Ga0207648_10004345
553 Ga0207676_10051714
554 Ga0207674_10171826
555 Ga0207675_100025507
556 Ga0207675_100844088
557 Ga0209179_1000770
558 Ga0209179_1002366
559 Ga0209179_1016898
560 Ga0207428_10214811
561 Ga0268264_10113277
562 Ga0373938_0009001
563 Ga0373926_0013557
564 Ga0373926_0094651
565 Ga0373940_0050337
566 Ga0373945_0009460
567 Ga0373945_0129989
568 Ga0373953_0015429
569 Ga0373953_0136118
570 Ga0373954_0068098
571 Ga0373957_0035967
572 Ga0373957_0123098
573 Ga0373943_0050428
574 Ga0373943_0051882
575 Ga0373943_0119763
576 Ga0373943_0139373
577 Ga0373924_0043829
578 Ga0373931_0034914
579 Ga0373935_0019850
580 Ga0373935_0308844
581 Ga0373935_0476033
582 Ga0373927_0016058
583 Ga0373927_0016327
584 Ga0373927_0024969
585 Ga0373927_0041155
586 Ga0373927_0076068
587 Ga0373927_0141038
588 Ga0373927_0143127
589 Ga0373933_0005012
590 Ga0373947_0010343
591 Ga0373947_0021770
592 Ga0373947_0029623
593 Ga0373947_0059965
594 Ga0373947_0090720
595 Ga0373937_0002933
596 Ga0373937_0003759
597 Ga0373937_0033773
598 Ga0373925_0014587
599 Ga0373925_0029331
600 Ga0373925_0032011
601 Ga0373925_0151245
602 Ga0436364_0761007
603 Ga0436364_1224040
604 Ga0436365_1216821
605 Ga0436365_1404441
606 Ga0436360_0207735
607 Ga0436360_1046199
608 Ga0436363_0252339
609 Ga0436363_0583111
610 Ga0436363_0718297
611 Ga0436363_1052127
612 Ga0436363_1452818
613 Ga0436363_1496932
614 Ga0451853_2048748
615 Ga0495603_0014469
616 Ga0495590_0121848
617 Ga0495590_0146077
618 Ga0495591_061479
619 Ga0495641_0018023
620 Ga0495641_0024149
621 Ga0495641_0154492
622 Ga0495580_0081267
623 Ga0495580_0159421
624 Ga0495580_0209110
625 Ga0495582_0018079
626 Ga0495582_0054237
627 Ga0495605_0044880
628 Ga0495605_0200123
629 Ga0495639_0091850
630 Ga0495639_0102604
631 Ga0495662_0154698
632 Ga0495584_0045925
633 Ga0495585_0005446
634 Ga0495596_0047823
635 Ga0495607_0041207
636 Ga0495607_0167760
637 Ga0495616_0034686
638 Ga0495630_0104205
639 Ga0495630_0182179
640 Ga0495631_0056868
641 Ga0495631_0139738
642 Ga0495637_0051719
643 Ga0495644_0005933
644 Ga0495644_0010106
645 Ga0495663_0038982
646 Ga0495666_0017072
647 Ga0495666_0072253
648 Ga0495642_0095533
649 Ga0495654_0058962
650 Ga0495665_0040890
651 Ga0495640_0023885
652 Ga0495640_0244109
653 Ga0495598_0012409
654 Ga0495621_0027079
655 Ga0495656_0005421
656 Ga0495668_0074259
657 Ga0495634_0212069
658 Ga0495611_0025123
659 Ga0495611_0163038
660 Ga0495659_0011740
661 Ga0495661_0034736
662 Ga0495588_0017425
663 Ga0495588_0026593
664 Ga0495599_0236476
665 Ga0495647_0004238
666 Ga0495647_0047593
667 Ga0495658_0011036
668 Ga0495658_0011467
669 Ga0495658_0040130
670 Ga0495658_0063837
671 Ga0495669_0016037
672 Ga0495613_0070739
673 Ga0495624_0077521
674 Ga0495670_0043159
675 Ga0495671_0108415
676 Ga0495649_0105014
677 Ga0495589_0231498
678 Ga0495660_0068972
679 Ga0495581_0053709
680 Ga0495674_0117806
681 Ga0495676_0020320
682 Ga0495676_0051021
683 Ga0495676_0143019
684 Ga0495677_0029047
685 Ga0495677_0122411
686 Ga0495679_028434
687 Ga0495681_0174033
688 Ga0495615_0017830
689 Ga0496100_0013738
690 Ga0496101_0071148
691 Ga0496101_0115929
692 Ga0496102_0084500
693 Ga0496102_0168575
694 Ga0496102_0234812
695 Ga0496103_0001572
696 Ga0496104_0020839
697 Ga0496104_0025019
698 Ga0496104_0065633
699 Ga0496104_0068276
700 Ga0496104_0101380
701 Ga0496104_0151380
702 Ga0496105_0014731
703 Ga0496105_0199071
704 Ga0496106_0067652
705 Ga0496106_0180744
706 Ga0496106_0222755
707 Ga0496107_0145591
708 Ga0496107_0295734
709 Ga0496107_0321561
710 Ga0496107_0335445
711 Ga0496108_0027310
712 Ga0496108_0150707
713 Ga0496109_0014200
714 Ga0496109_0086291
715 Ga0496110_0047455
716 Ga0496110_0107562
717 Ga0496111_0004206
718 Ga0496112_0077034
719 Ga0496112_0865934
720 Ga0496114_0067757
721 Ga0496114_0131393
722 Ga0496115_0004404
723 Ga0496115_0077624
724 Ga0496115_0123571
725 Ga0496115_0212831
726 Ga0496115_0636966
727 nmdc:mga0yw44_97448_c1
728 nmdc:mga06z11_207887_c1
729 nmdc:mga06r32_189043_c1
730 nmdc:mga08y16_69129_c1
731 nmdc:mga0n895_66267_c1
732 nmdc:mga0a205_11708_c1
733 nmdc:mga0a205_21780_c1
734 nmdc:mga0a205_258373_c1
735 Ga0495601_0049574
736 Ga0495655_0001923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qvi-assembly2.cif.gz_B crystal structure of competence-associated pilin comz from thermus thermophilus 0.7184 173 226
1gyv-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant 0.7067 179 209
1gyu-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1 0.7062 179 209
1wch-assembly1.cif.gz_A crystal structure of ptpl1 human tyrosine phosphatase mutated in colorectal cancer - evidence for a second phosphotyrosine substrate recognition pocket 0.6907 183 221
4ge6-assembly1.cif.gz_A crystal structure of human protein tyrosine phosphatase ptpn9 (meg2) complex with compound 7 0.6845 185 221
ID Description Score Start End Superfamily
af_F1R6A1_237_360_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.7368 187 225 3.30.160.40
3zhfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7207 185 209 2.60.40.1230
3hxlA05 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2; 0.7096 191 223 3.30.360.90
af_I6Y4U0_54_180_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7049 145 207 3.30.420.40
af_A0A0P0X651_63_187_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6963 185 225 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A537UUM3-F1-model_v4 Uncharacterized protein 0.9456 34 238
AF-A0A2V9D6W8-F1-model_v4 Uncharacterized protein 0.9432 92 239
AF-A0A317I6A0-F1-model_v4 deleted 0.9378 19 276
AF-A0A537UUM3-F1-model_v4 Uncharacterized protein 0.9317 34 238
AF-A0A2V8K557-F1-model_v4 Uncharacterized protein 0.9311 60 239

Map