F427317

General Info

Members Datasets Scaffolds Average Seq Length
376 179 752 294

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10020573|Ga0075433_100205732
Length 337
Sequence LRAPGLTRTTSERKILPDTEACRQGGRVVVESNKKEEPFEVNSMLANKPKTKILVDGGDPSETLRIKSLIGFVDGQTTNPSLIAKNPEIQRLIASGHKLTSQEEQNEYKKIVQSISPLVGDAGVSIEVFADLGARAEEMLAQGEEMFSWIPNAYVKYPCTHEGLRAAQMSVHKSIRVNMTLCFSQEQAAAVYAATKGSKEPVYVSPFVGRLDDRSEDGMDVVRNIKKMYEHGDGHVHVLAASIRSVNHLLCSFALGAELATVPTKVLDEWAATGFSMPDQDFRYRGVDASGKPLKSIPYKELDLNLPWESFDIAHELTSKGIQKFVADYESTLRRSA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.99
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 25.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10020573 3300006852 Bacteria 5522
2 JGI24737J22298_10012582 3300001990 Bacteria 2758
3 Ga0058862_10004188 3300004803 Bacteria 1242
4 Ga0065712_10126857 3300005290 Bacteria 1597
5 Ga0070683_100042133 3300005329 Unclassified 4204
6 Ga0070683_100067380 3300005329 Unclassified 3334
7 Ga0070683_100514000 3300005329 Unclassified 1144
8 Ga0070680_100025788 3300005336 Bacteria 4700
9 Ga0070680_100127796 3300005336 Unclassified 2124
10 Ga0070680_100228403 3300005336 Unclassified 1572
11 Ga0070682_100059117 3300005337 Unclassified 2420
12 Ga0068868_100267721 3300005338 Unclassified 1443
13 Ga0070660_100045978 3300005339 Archaea 3344
14 Ga0070660_100254666 3300005339 Bacteria 1432
15 Ga0070675_100185157 3300005354 Bacteria 1802
16 Ga0070671_100169742 3300005355 Bacteria 1845
17 Ga0070673_100019658 3300005364 Unclassified 4853
18 Ga0070709_10075654 3300005434 Bacteria 2185
19 Ga0070709_10200434 3300005434 Unclassified 1413
20 Ga0070709_10262338 3300005434 Bacteria 1248
21 Ga0070714_100001429 3300005435 Bacteria 17358
22 Ga0070714_100018228 3300005435 Bacteria 5698
23 Ga0070714_100042537 3300005435 Bacteria 3839
24 Ga0070714_100048945 3300005435 Unclassified 3597
25 Ga0070714_100226190 3300005435 Bacteria 1722
26 Ga0070714_100265455 3300005435 Bacteria 1591
27 Ga0070714_100351563 3300005435 Unclassified 1384
28 Ga0070713_100003340 3300005436 Bacteria 10588
29 Ga0070713_100005888 3300005436 Bacteria 8428
30 Ga0070713_100302347 3300005436 Bacteria 1473
31 Ga0070710_10096203 3300005437 Unclassified 1755
32 Ga0070711_100061154 3300005439 Unclassified 2621
33 Ga0070708_100018848 3300005445 Bacteria 5781
34 Ga0070708_100051296 3300005445 Unclassified 3655
35 Ga0070681_10010809 3300005458 Bacteria 9022
36 Ga0070681_10107151 3300005458 Unclassified 2736
37 Ga0070681_10364446 3300005458 Bacteria 1355
38 Ga0068867_100119046 3300005459 Bacteria 2038
39 Ga0070706_100004343 3300005467 Bacteria 13711
40 Ga0070706_100011127 3300005467 Bacteria 8353
41 Ga0070707_100032168 3300005468 Unclassified 4997
42 Ga0070707_100423782 3300005468 Bacteria 1291
43 Ga0070698_100015576 3300005471 Bacteria 8029
44 Ga0070698_100032793 3300005471 Bacteria 5379
45 Ga0070698_100076412 3300005471 Unclassified 3351
46 Ga0070699_100002656 3300005518 Bacteria 15972
47 Ga0070699_100032461 3300005518 Unclassified 4509
48 Ga0070699_100113892 3300005518 Unclassified 2376
49 Ga0070699_100146647 3300005518 Bacteria 2085
50 Ga0070679_100007555 3300005530 Bacteria 10168
51 Ga0070679_100026457 3300005530 Bacteria 5700
52 Ga0070679_100039471 3300005530 Unclassified 4691
53 Ga0070679_100258787 3300005530 Unclassified 1695
54 Ga0070684_100491473 3300005535 Unclassified 1136
55 Ga0070697_100003334 3300005536 Bacteria 12333
56 Ga0068853_100474318 3300005539 Unclassified 1179
57 Ga0070693_100198905 3300005547 Unclassified 1300
58 Ga0070665_100082338 3300005548 Unclassified 3223
59 Ga0068855_100190091 3300005563 Unclassified 2316
60 Ga0070664_100535147 3300005564 Unclassified 1082
61 Ga0068857_100015978 3300005577 Bacteria 6575
62 Ga0068854_100010607 3300005578 Bacteria 5980
63 Ga0068856_100074166 3300005614 Bacteria 3368
64 Ga0068856_100175076 3300005614 Bacteria 2158
65 Ga0068856_100187574 3300005614 Bacteria 2082
66 Ga0068856_100189063 3300005614 Unclassified 2073
67 Ga0068856_100406674 3300005614 Bacteria 1381
68 Ga0068856_100680708 3300005614 Unclassified 1049
69 Ga0068852_100015439 3300005616 Bacteria 5924
70 Ga0068859_100005340 3300005617 Bacteria 13074
71 Ga0068864_100003000 3300005618 Bacteria 13946
72 Ga0068864_100277987 3300005618 Bacteria 1562
73 Ga0068866_10052109 3300005718 Unclassified 2087
74 Ga0068863_100040557 3300005841 Unclassified 4426
75 Ga0068863_100137904 3300005841 Bacteria 2330
76 Ga0068860_100093435 3300005843 Unclassified 2867
77 Ga0070717_10000295 3300006028 Bacteria 33556
78 Ga0070717_10001065 3300006028 Bacteria 18424
79 Ga0070717_10002346 3300006028 Bacteria 13336
80 Ga0070717_10050898 3300006028 Bacteria 3407
81 Ga0070717_10062218 3300006028 Bacteria 3095
82 Ga0070717_10359242 3300006028 Bacteria 1303
83 Ga0070716_100005950 3300006173 Bacteria 5933
84 Ga0070716_100067749 3300006173 Unclassified 2086
85 Ga0070716_100084660 3300006173 Bacteria 1902
86 Ga0070712_100022628 3300006175 Bacteria 4142
87 Ga0070712_100042219 3300006175 Unclassified 3135
88 Ga0070712_100058277 3300006175 Bacteria 2717
89 Ga0097621_100022418 3300006237 Bacteria 4902
90 Ga0097621_100113218 3300006237 Bacteria 2295
91 Ga0068871_100028246 3300006358 Bacteria 4396
92 Ga0075433_10025730 3300006852 Bacteria 4976
93 Ga0075433_10038163 3300006852 Bacteria 4147
94 Ga0075433_10364286 3300006852 Bacteria 1277
95 Ga0075434_100001428 3300006871 Bacteria 20068
96 Ga0075434_100009778 3300006871 Bacteria 8965
97 Ga0075434_100019507 3300006871 Bacteria 6564
98 Ga0075434_100032296 3300006871 Bacteria 5163
99 Ga0075434_100241340 3300006871 Bacteria 1827
100 Ga0075434_100298097 3300006871 Bacteria 1632
101 Ga0075434_100647771 3300006871 Unclassified 1075
102 Ga0075436_100001124 3300006914 Bacteria 18082
103 Ga0075436_100024682 3300006914 Bacteria 4133
104 Ga0097620_100005340 3300006931 Bacteria 13074
105 Ga0075435_100000718 3300007076 Bacteria 20569
106 Ga0075435_100006340 3300007076 Bacteria 8357
107 Ga0075435_100107829 3300007076 Bacteria 2314
108 Ga0105250_10014572 3300009092 Bacteria 3227
109 Ga0105240_10002063 3300009093 Bacteria 32935
110 Ga0105240_10006218 3300009093 Bacteria 17560
111 Ga0105240_10010604 3300009093 Bacteria 12949
112 Ga0105240_10024242 3300009093 Bacteria 8005
113 Ga0105240_10052844 3300009093 Bacteria 5104
114 Ga0105240_10336785 3300009093 Bacteria 1715
115 Ga0105240_10603472 3300009093 Bacteria 1208
116 Ga0105240_10784901 3300009093 Bacteria 1033
117 Ga0105245_10014594 3300009098 Bacteria 6841
118 Ga0105245_10072644 3300009098 Unclassified 3126
119 Ga0114129_10023038 3300009147 Bacteria 8835
120 Ga0105241_10003956 3300009174 Bacteria 10957
121 Ga0105241_10013938 3300009174 Bacteria 5892
122 Ga0105241_10048147 3300009174 Bacteria 3243
123 Ga0105241_10075158 3300009174 Bacteria 2632
124 Ga0105241_10160892 3300009174 Bacteria 1845
125 Ga0105241_10238431 3300009174 Bacteria 1536
126 Ga0105241_10400061 3300009174 Unclassified 1204
127 Ga0105248_10237156 3300009177 Bacteria 2053
128 Ga0105248_10635953 3300009177 Bacteria 1204
129 Ga0105237_10009746 3300009545 Bacteria 10277
130 Ga0105237_10056792 3300009545 Unclassified 3917
131 Ga0105237_10145830 3300009545 Bacteria 2362
132 Ga0105237_10385583 3300009545 Bacteria 1406
133 Ga0105237_10640523 3300009545 Bacteria 1070
134 Ga0105238_10076000 3300009551 Bacteria 3350
135 Ga0105238_10109738 3300009551 Bacteria 2740
136 Ga0105238_10114631 3300009551 Unclassified 2674
137 Ga0105239_10016145 3300010375 Bacteria 8262
138 Ga0105239_10057603 3300010375 Unclassified 4262
139 Ga0105239_10730855 3300010375 Bacteria 1133
140 Ga0105246_10082244 3300011119 Bacteria 2298
141 Ga0157373_10158037 3300013100 Bacteria 1595
142 Ga0157373_10324951 3300013100 Unclassified 1095
143 Ga0157370_10032942 3300013104 Bacteria 5055
144 Ga0157370_10058082 3300013104 Bacteria 3677
145 Ga0157370_10135618 3300013104 Unclassified 2294
146 Ga0157370_10428720 3300013104 Bacteria 1216
147 Ga0157369_10002790 3300013105 Bacteria 20848
148 Ga0157369_10040854 3300013105 Bacteria 5063
149 Ga0157369_10084743 3300013105 Bacteria 3387
150 Ga0157369_10103972 3300013105 Bacteria 3025
151 Ga0157374_10001072 3300013296 Bacteria 23720
152 Ga0157374_10048782 3300013296 Unclassified 3930
153 Ga0157374_10087988 3300013296 Bacteria 2958
154 Ga0157374_10096095 3300013296 Bacteria 2834
155 Ga0157374_10248302 3300013296 Bacteria 1751
156 Ga0157378_10000257 3300013297 Bacteria 52147
157 Ga0157378_10023314 3300013297 Bacteria 5448
158 Ga0157378_10466012 3300013297 Bacteria 1256
159 Ga0157378_10547520 3300013297 Bacteria 1162
160 Ga0163162_10051244 3300013306 Bacteria 4141
161 Ga0163162_10228337 3300013306 Unclassified 1992
162 Ga0157372_10012411 3300013307 Bacteria 9080
163 Ga0157372_10037148 3300013307 Bacteria 5370
164 Ga0157372_10051357 3300013307 Unclassified 4588
165 Ga0157372_10102544 3300013307 Bacteria 3269
166 Ga0157372_10364934 3300013307 Bacteria 1683
167 Ga0157372_10393673 3300013307 Unclassified 1614
168 Ga0157372_10427243 3300013307 Unclassified 1544
169 Ga0157372_10749246 3300013307 Bacteria 1136
170 Ga0157375_10403116 3300013308 Unclassified 1534
171 Ga0163163_10042442 3300014325 Bacteria 4455
172 Ga0163163_10053134 3300014325 Bacteria 3999
173 Ga0163163_10113854 3300014325 Unclassified 2735
174 Ga0163163_10359393 3300014325 Bacteria 1513
175 Ga0182008_10028341 3300014497 Bacteria 2832
176 Ga0157379_10014614 3300014968 Bacteria 6886
177 Ga0157376_10008147 3300014969 Bacteria 7536
178 Ga0157376_10016063 3300014969 Bacteria 5673
179 Ga0157376_10282918 3300014969 Unclassified 1563
180 Ga0182007_10008346 3300015262 Bacteria 4261
181 Ga0182007_10079470 3300015262 Unclassified 1076
182 Ga0206355_1067274 3300020076 Bacteria 1064
183 Ga0206355_1189896 3300020076 Bacteria 1622
184 Ga0206351_10278172 3300020077 Unclassified 1924
185 Ga0206351_10315287 3300020077 Bacteria 1513
186 Ga0206350_10040799 3300020080 Unclassified 1084
187 Ga0206350_10308259 3300020080 Unclassified 1267
188 Ga0154015_1109976 3300020610 Unclassified 1077
189 Ga0154015_1485160 3300020610 Bacteria 2147
190 Ga0224712_10073061 3300022467 Unclassified 1398
191 Ga0224712_10085700 3300022467 Bacteria 1309
192 Ga0207642_10131341 3300025899 Unclassified 1307
193 Ga0207647_10003388 3300025904 Bacteria 11949
194 Ga0207685_10065500 3300025905 Unclassified 1455
195 Ga0207699_10307578 3300025906 Bacteria 1108
196 Ga0207684_10000843 3300025910 Bacteria 35325
197 Ga0207684_10004683 3300025910 Bacteria 12848
198 Ga0207654_10030666 3300025911 Bacteria 2954
199 Ga0207654_10103787 3300025911 Bacteria 1756
200 Ga0207707_10032680 3300025912 Archaea 4554
201 Ga0207707_10451108 3300025912 Bacteria 1100
202 Ga0207695_10002656 3300025913 Bacteria 26136
203 Ga0207695_10026033 3300025913 Bacteria 6535
204 Ga0207695_10026765 3300025913 Bacteria 6432
205 Ga0207695_10034656 3300025913 Bacteria 5486
206 Ga0207695_10069596 3300025913 Bacteria 3600
207 Ga0207695_10083816 3300025913 Bacteria 3220
208 Ga0207695_10160389 3300025913 Unclassified 2181
209 Ga0207671_10049859 3300025914 Bacteria 3100
210 Ga0207671_10069218 3300025914 Bacteria 2631
211 Ga0207671_10268197 3300025914 Unclassified 1345
212 Ga0207693_10013482 3300025915 Bacteria 6588
213 Ga0207693_10021720 3300025915 Bacteria 5102
214 Ga0207693_10025789 3300025915 Bacteria 4658
215 Ga0207693_10030713 3300025915 Bacteria 4244
216 Ga0207663_10050573 3300025916 Unclassified 2583
217 Ga0207663_10224986 3300025916 Unclassified 1367
218 Ga0207660_10054062 3300025917 Bacteria 2864
219 Ga0207660_10093311 3300025917 Bacteria 2236
220 Ga0207660_10206330 3300025917 Unclassified 1537
221 Ga0207657_10031987 3300025919 Unclassified 4759
222 Ga0207652_10015354 3300025921 Bacteria 6219
223 Ga0207652_10028373 3300025921 Bacteria 4670
224 Ga0207652_10215349 3300025921 Unclassified 1730
225 Ga0207652_10292649 3300025921 Bacteria 1469
226 Ga0207652_10577113 3300025921 Unclassified 1009
227 Ga0207646_10004408 3300025922 Bacteria 15306
228 Ga0207646_10024313 3300025922 Bacteria 5550
229 Ga0207646_10068693 3300025922 Unclassified 3165
230 Ga0207646_10198117 3300025922 Bacteria 1814
231 Ga0207694_10044969 3300025924 Bacteria 3410
232 Ga0207650_10076374 3300025925 Unclassified 2531
233 Ga0207700_10015115 3300025928 Bacteria 5078
234 Ga0207700_10075018 3300025928 Unclassified 2619
235 Ga0207700_10124461 3300025928 Bacteria 2095
236 Ga0207664_10000033 3300025929 Bacteria 176549
237 Ga0207664_10050373 3300025929 Unclassified 3284
238 Ga0207664_10067276 3300025929 Bacteria 2874
239 Ga0207664_10161084 3300025929 Bacteria 1914
240 Ga0207706_10163642 3300025933 Bacteria 1955
241 Ga0207669_10117896 3300025937 Bacteria 1795
242 Ga0207665_10001413 3300025939 Bacteria 16144
243 Ga0207665_10018819 3300025939 Bacteria 4539
244 Ga0207665_10098155 3300025939 Bacteria 2040
245 Ga0207665_10102467 3300025939 Bacteria 2000
246 Ga0207665_10212090 3300025939 Unclassified 1415
247 Ga0207665_10268494 3300025939 Bacteria 1266
248 Ga0207679_10395941 3300025945 Unclassified 1214
249 Ga0207667_10119665 3300025949 Bacteria 2714
250 Ga0207651_10068916 3300025960 Bacteria 2496
251 Ga0207640_10157421 3300025981 Bacteria 1676
252 Ga0207658_10406857 3300025986 Bacteria 1197
253 Ga0207677_10007013 3300026023 Bacteria 6200
254 Ga0207702_10052143 3300026078 Bacteria 3460
255 Ga0207702_10113778 3300026078 Bacteria 2411
256 Ga0207702_10555719 3300026078 Unclassified 1123
257 Ga0207641_10065439 3300026088 Bacteria 3110
258 Ga0207648_10294744 3300026089 Unclassified 1453
259 Ga0207676_10091953 3300026095 Bacteria 2494
260 Ga0207676_10230776 3300026095 Bacteria 1654
261 Ga0207674_10001943 3300026116 Bacteria 26232
262 Ga0207674_10021214 3300026116 Bacteria 7003
263 Ga0268264_10096923 3300028381 Unclassified 2556
264 Ga0265338_10041471 3300028800 Bacteria 4304
265 Ga0265338_10086090 3300028800 Bacteria 2617
266 Ga0265331_10174177 3300031250 Bacteria 973
267 Ga0265316_10000097 3300031344 Bacteria 95218
268 Ga0265314_10242674 3300031711 Bacteria 1038
269 Ga0373934_0013388 3300035086 Bacteria 3103
270 Ga0373945_0001135 3300035116 Bacteria 8053
271 Ga0373953_0018885 3300035117 Bacteria 2557
272 Ga0373953_0034451 3300035117 Bacteria 1985
273 Ga0373956_0003804 3300035119 Bacteria 6065
274 Ga0373956_0048788 3300035119 Bacteria 1897
275 Ga0373957_0021817 3300035120 Bacteria 2277
276 Ga0373943_0000108 3300035170 Bacteria 30482
277 Ga0373946_0007955 3300035171 Bacteria 3893
278 Ga0373946_0038695 3300035171 Viruses 1944
279 Ga0373955_0003156 3300035172 Bacteria 7210
280 Ga0373955_0018665 3300035172 Unclassified 3454
281 Ga0373924_0020763 3300035410 Bacteria 2556
282 Ga0373931_0267447 3300035691 Bacteria 1045
283 Ga0373935_0001684 3300035692 Bacteria 12353
284 Ga0373935_0041871 3300035692 Bacteria 2879
285 Ga0373927_0000122 3300035695 Bacteria 59292
286 Ga0373927_0037628 3300035695 Bacteria 3144
287 Ga0373933_0003671 3300035724 Bacteria 8498
288 Ga0373933_0007248 3300035724 Bacteria 6046
289 Ga0373947_0001126 3300035725 Bacteria 16399
290 Ga0373947_0064139 3300035725 Bacteria 2239
291 Ga0373937_0000412 3300036401 Bacteria 39962
292 Ga0373937_0052731 3300036401 Unclassified 3730
293 Ga0373925_0000661 3300037068 Bacteria 32361
294 Ga0373925_0012739 3300037068 Bacteria 6093
295 Ga0395900_0122719 3300037418 Bacteria 2665
296 Ga0395900_0588852 3300037418 Bacteria 1054
297 Ga0395898_0059927 3300037466 Unclassified 3701
298 Ga0395898_0209428 3300037466 Bacteria 1860
299 Ga0395905_0048114 3300037471 Unclassified 3997
300 Ga0395905_0250510 3300037471 Bacteria 1654
301 Ga0395905_0304595 3300037471 Unclassified 1481
302 Ga0436360_1127360 3300039438 Bacteria 4257
303 Ga0451577_0005619 3300042876 Bacteria 12747
304 Ga0466966_0180196 3300044684 Bacteria 1282
305 Ga0453684_0006516 3300044712 Bacteria 22126
306 Ga0453684_0090833 3300044712 Bacteria 3772
307 Ga0453684_0412715 3300044712 Bacteria 1510
308 Ga0453684_0469367 3300044712 Bacteria 1398
309 Ga0451576_0000027 3300045051 Bacteria 422925
310 Ga0451576_0002213 3300045051 Bacteria 29932
311 Ga0451576_0166605 3300045051 Bacteria 2300
312 Ga0451576_0390522 3300045051 Bacteria 1459
313 Ga0495592_0052982 3300046454 Bacteria 3010
314 Ga0495651_0030851 3300046462 Bacteria 4180
315 Ga0495651_0128912 3300046462 Unclassified 1849
316 Ga0495580_0003012 3300046472 Bacteria 14440
317 Ga0495580_0007449 3300046472 Bacteria 8797
318 Ga0495580_0011134 3300046472 Bacteria 6968
319 Ga0495639_0024693 3300046475 Bacteria 2647
320 Ga0495608_0294082 3300046511 Bacteria 1006
321 Ga0495630_0397859 3300046517 Unclassified 1055
322 Ga0495652_0009908 3300046529 Bacteria 8641
323 Ga0495652_0101986 3300046529 Unclassified 2326
324 Ga0495665_0071611 3300046531 Bacteria 1825
325 Ga0495586_0007523 3300046535 Bacteria 5812
326 Ga0495587_0000200 3300046536 Bacteria 43851
327 Ga0495587_0002346 3300046536 Bacteria 12653
328 Ga0495609_0030625 3300046538 Unclassified 2449
329 Ga0495635_0094854 3300046663 Bacteria 2040
330 Ga0495669_0063816 3300046684 Bacteria 1671
331 Ga0495581_0075435 3300047315 Bacteria 1951
332 Ga0495604_0025413 3300047317 Unclassified 4720
333 Ga0495674_0104446 3300047319 Unclassified 2408
334 Ga0495674_0491030 3300047319 Unclassified 983
335 Ga0495684_0028146 3300047471 Unclassified 4316
336 Ga0495593_0193785 3300047673 Unclassified 1022
337 Ga0495602_0008995 3300048088 Bacteria 10407
338 Ga0495602_0049176 3300048088 Bacteria 3780
339 Ga0496104_0061525 3300048907 Unclassified 3560
340 Ga0496104_0264140 3300048907 Bacteria 1634
341 Ga0496104_0327453 3300048907 Bacteria 1445
342 Ga0496107_0173395 3300048910 Bacteria 1601
343 Ga0496108_0238335 3300048911 Bacteria 1582
344 Ga0496109_0295064 3300048912 Bacteria 1528
345 Ga0496109_0462064 3300048912 Bacteria 1199
346 Ga0496109_0644536 3300048912 Unclassified 996
347 Ga0496110_0084741 3300048913 Unclassified 2829
348 Ga0496112_0013961 3300048915 Bacteria 7433
349 Ga0496112_0039835 3300048915 Bacteria 4592
350 Ga0496112_0123247 3300048915 Bacteria 2563
351 Ga0496112_0190088 3300048915 Bacteria 2015
352 Ga0496113_0078994 3300048916 Bacteria 2518
353 Ga0496115_0042862 3300048918 Bacteria 3607
354 Ga0501033_0227081 3300049570 Bacteria 1327
355 Ga0501034_0026603 3300049571 Bacteria 5890
356 Ga0501047_0002015 3300049581 Bacteria 19485
357 Ga0501083_0184686 3300049744 Bacteria 1361
358 Ga0501035_0001229 3300049822 Bacteria 26660
359 Ga0501044_0053738 3300049823 Bacteria 4143
360 nmdc:mga0n895_210730_c1 3300050512 Bacteria 1973
361 nmdc:mga0n895_243130_c1 3300050512 Bacteria 1827
362 nmdc:mga0n895_435961_c1 3300050512 Bacteria 1324
363 nmdc:mga0n895_549323_c1 3300050512 Unclassified 1161
364 nmdc:mga0n895_5499_c1 3300050512 Bacteria 10602
365 nmdc:mga0n895_68728_c1 3300050512 Unclassified 3509
366 nmdc:mga0rr50_14513_c1 3300050513 Bacteria 5172
367 nmdc:mga0rr50_172070_c1 3300050513 Bacteria 1765
368 nmdc:mga0rr50_4407_c1 3300050513 Bacteria 8273
369 nmdc:mga08x19_36539_c1 3300050514 Bacteria 3112
370 nmdc:mga08x19_475945_c1 3300050514 Unclassified 880
371 nmdc:mga08x19_6658_c1 3300050514 Bacteria 6854
372 nmdc:mga0a205_161555_c1 3300050515 Bacteria 2137
373 nmdc:mga0a205_41079_c1 3300050515 Bacteria 4454
374 nmdc:mga0a205_70055_c1 3300050515 Unclassified 3386
375 Ga0495619_0055979 3300053085 Unclassified 2614
376 Ga0501084_0227720 3300054114 Bacteria 1573
377 Ga0075433_10020573
378 JGI24737J22298_10012582
379 Ga0058862_10004188
380 Ga0065712_10126857
381 Ga0070683_100042133
382 Ga0070683_100067380
383 Ga0070683_100514000
384 Ga0070680_100025788
385 Ga0070680_100127796
386 Ga0070680_100228403
387 Ga0070682_100059117
388 Ga0068868_100267721
389 Ga0070660_100045978
390 Ga0070660_100254666
391 Ga0070675_100185157
392 Ga0070671_100169742
393 Ga0070673_100019658
394 Ga0070709_10075654
395 Ga0070709_10200434
396 Ga0070709_10262338
397 Ga0070714_100001429
398 Ga0070714_100018228
399 Ga0070714_100042537
400 Ga0070714_100048945
401 Ga0070714_100226190
402 Ga0070714_100265455
403 Ga0070714_100351563
404 Ga0070713_100003340
405 Ga0070713_100005888
406 Ga0070713_100302347
407 Ga0070710_10096203
408 Ga0070711_100061154
409 Ga0070708_100018848
410 Ga0070708_100051296
411 Ga0070681_10010809
412 Ga0070681_10107151
413 Ga0070681_10364446
414 Ga0068867_100119046
415 Ga0070706_100004343
416 Ga0070706_100011127
417 Ga0070707_100032168
418 Ga0070707_100423782
419 Ga0070698_100015576
420 Ga0070698_100032793
421 Ga0070698_100076412
422 Ga0070699_100002656
423 Ga0070699_100032461
424 Ga0070699_100113892
425 Ga0070699_100146647
426 Ga0070679_100007555
427 Ga0070679_100026457
428 Ga0070679_100039471
429 Ga0070679_100258787
430 Ga0070684_100491473
431 Ga0070697_100003334
432 Ga0068853_100474318
433 Ga0070693_100198905
434 Ga0070665_100082338
435 Ga0068855_100190091
436 Ga0070664_100535147
437 Ga0068857_100015978
438 Ga0068854_100010607
439 Ga0068856_100074166
440 Ga0068856_100175076
441 Ga0068856_100187574
442 Ga0068856_100189063
443 Ga0068856_100406674
444 Ga0068856_100680708
445 Ga0068852_100015439
446 Ga0068859_100005340
447 Ga0068864_100003000
448 Ga0068864_100277987
449 Ga0068866_10052109
450 Ga0068863_100040557
451 Ga0068863_100137904
452 Ga0068860_100093435
453 Ga0070717_10000295
454 Ga0070717_10001065
455 Ga0070717_10002346
456 Ga0070717_10050898
457 Ga0070717_10062218
458 Ga0070717_10359242
459 Ga0070716_100005950
460 Ga0070716_100067749
461 Ga0070716_100084660
462 Ga0070712_100022628
463 Ga0070712_100042219
464 Ga0070712_100058277
465 Ga0097621_100022418
466 Ga0097621_100113218
467 Ga0068871_100028246
468 Ga0075433_10025730
469 Ga0075433_10038163
470 Ga0075433_10364286
471 Ga0075434_100001428
472 Ga0075434_100009778
473 Ga0075434_100019507
474 Ga0075434_100032296
475 Ga0075434_100241340
476 Ga0075434_100298097
477 Ga0075434_100647771
478 Ga0075436_100001124
479 Ga0075436_100024682
480 Ga0097620_100005340
481 Ga0075435_100000718
482 Ga0075435_100006340
483 Ga0075435_100107829
484 Ga0105250_10014572
485 Ga0105240_10002063
486 Ga0105240_10006218
487 Ga0105240_10010604
488 Ga0105240_10024242
489 Ga0105240_10052844
490 Ga0105240_10336785
491 Ga0105240_10603472
492 Ga0105240_10784901
493 Ga0105245_10014594
494 Ga0105245_10072644
495 Ga0114129_10023038
496 Ga0105241_10003956
497 Ga0105241_10013938
498 Ga0105241_10048147
499 Ga0105241_10075158
500 Ga0105241_10160892
501 Ga0105241_10238431
502 Ga0105241_10400061
503 Ga0105248_10237156
504 Ga0105248_10635953
505 Ga0105237_10009746
506 Ga0105237_10056792
507 Ga0105237_10145830
508 Ga0105237_10385583
509 Ga0105237_10640523
510 Ga0105238_10076000
511 Ga0105238_10109738
512 Ga0105238_10114631
513 Ga0105239_10016145
514 Ga0105239_10057603
515 Ga0105239_10730855
516 Ga0105246_10082244
517 Ga0157373_10158037
518 Ga0157373_10324951
519 Ga0157370_10032942
520 Ga0157370_10058082
521 Ga0157370_10135618
522 Ga0157370_10428720
523 Ga0157369_10002790
524 Ga0157369_10040854
525 Ga0157369_10084743
526 Ga0157369_10103972
527 Ga0157374_10001072
528 Ga0157374_10048782
529 Ga0157374_10087988
530 Ga0157374_10096095
531 Ga0157374_10248302
532 Ga0157378_10000257
533 Ga0157378_10023314
534 Ga0157378_10466012
535 Ga0157378_10547520
536 Ga0163162_10051244
537 Ga0163162_10228337
538 Ga0157372_10012411
539 Ga0157372_10037148
540 Ga0157372_10051357
541 Ga0157372_10102544
542 Ga0157372_10364934
543 Ga0157372_10393673
544 Ga0157372_10427243
545 Ga0157372_10749246
546 Ga0157375_10403116
547 Ga0163163_10042442
548 Ga0163163_10053134
549 Ga0163163_10113854
550 Ga0163163_10359393
551 Ga0182008_10028341
552 Ga0157379_10014614
553 Ga0157376_10008147
554 Ga0157376_10016063
555 Ga0157376_10282918
556 Ga0182007_10008346
557 Ga0182007_10079470
558 Ga0206355_1067274
559 Ga0206355_1189896
560 Ga0206351_10278172
561 Ga0206351_10315287
562 Ga0206350_10040799
563 Ga0206350_10308259
564 Ga0154015_1109976
565 Ga0154015_1485160
566 Ga0224712_10073061
567 Ga0224712_10085700
568 Ga0207642_10131341
569 Ga0207647_10003388
570 Ga0207685_10065500
571 Ga0207699_10307578
572 Ga0207684_10000843
573 Ga0207684_10004683
574 Ga0207654_10030666
575 Ga0207654_10103787
576 Ga0207707_10032680
577 Ga0207707_10451108
578 Ga0207695_10002656
579 Ga0207695_10026033
580 Ga0207695_10026765
581 Ga0207695_10034656
582 Ga0207695_10069596
583 Ga0207695_10083816
584 Ga0207695_10160389
585 Ga0207671_10049859
586 Ga0207671_10069218
587 Ga0207671_10268197
588 Ga0207693_10013482
589 Ga0207693_10021720
590 Ga0207693_10025789
591 Ga0207693_10030713
592 Ga0207663_10050573
593 Ga0207663_10224986
594 Ga0207660_10054062
595 Ga0207660_10093311
596 Ga0207660_10206330
597 Ga0207657_10031987
598 Ga0207652_10015354
599 Ga0207652_10028373
600 Ga0207652_10215349
601 Ga0207652_10292649
602 Ga0207652_10577113
603 Ga0207646_10004408
604 Ga0207646_10024313
605 Ga0207646_10068693
606 Ga0207646_10198117
607 Ga0207694_10044969
608 Ga0207650_10076374
609 Ga0207700_10015115
610 Ga0207700_10075018
611 Ga0207700_10124461
612 Ga0207664_10000033
613 Ga0207664_10050373
614 Ga0207664_10067276
615 Ga0207664_10161084
616 Ga0207706_10163642
617 Ga0207669_10117896
618 Ga0207665_10001413
619 Ga0207665_10018819
620 Ga0207665_10098155
621 Ga0207665_10102467
622 Ga0207665_10212090
623 Ga0207665_10268494
624 Ga0207679_10395941
625 Ga0207667_10119665
626 Ga0207651_10068916
627 Ga0207640_10157421
628 Ga0207658_10406857
629 Ga0207677_10007013
630 Ga0207702_10052143
631 Ga0207702_10113778
632 Ga0207702_10555719
633 Ga0207641_10065439
634 Ga0207648_10294744
635 Ga0207676_10091953
636 Ga0207676_10230776
637 Ga0207674_10001943
638 Ga0207674_10021214
639 Ga0268264_10096923
640 Ga0265338_10041471
641 Ga0265338_10086090
642 Ga0265331_10174177
643 Ga0265316_10000097
644 Ga0265314_10242674
645 Ga0373934_0013388
646 Ga0373945_0001135
647 Ga0373953_0018885
648 Ga0373953_0034451
649 Ga0373956_0003804
650 Ga0373956_0048788
651 Ga0373957_0021817
652 Ga0373943_0000108
653 Ga0373946_0007955
654 Ga0373946_0038695
655 Ga0373955_0003156
656 Ga0373955_0018665
657 Ga0373924_0020763
658 Ga0373931_0267447
659 Ga0373935_0001684
660 Ga0373935_0041871
661 Ga0373927_0000122
662 Ga0373927_0037628
663 Ga0373933_0003671
664 Ga0373933_0007248
665 Ga0373947_0001126
666 Ga0373947_0064139
667 Ga0373937_0000412
668 Ga0373937_0052731
669 Ga0373925_0000661
670 Ga0373925_0012739
671 Ga0395900_0122719
672 Ga0395900_0588852
673 Ga0395898_0059927
674 Ga0395898_0209428
675 Ga0395905_0048114
676 Ga0395905_0250510
677 Ga0395905_0304595
678 Ga0436360_1127360
679 Ga0451577_0005619
680 Ga0466966_0180196
681 Ga0453684_0006516
682 Ga0453684_0090833
683 Ga0453684_0412715
684 Ga0453684_0469367
685 Ga0451576_0000027
686 Ga0451576_0002213
687 Ga0451576_0166605
688 Ga0451576_0390522
689 Ga0495592_0052982
690 Ga0495651_0030851
691 Ga0495651_0128912
692 Ga0495580_0003012
693 Ga0495580_0007449
694 Ga0495580_0011134
695 Ga0495639_0024693
696 Ga0495608_0294082
697 Ga0495630_0397859
698 Ga0495652_0009908
699 Ga0495652_0101986
700 Ga0495665_0071611
701 Ga0495586_0007523
702 Ga0495587_0000200
703 Ga0495587_0002346
704 Ga0495609_0030625
705 Ga0495635_0094854
706 Ga0495669_0063816
707 Ga0495581_0075435
708 Ga0495604_0025413
709 Ga0495674_0104446
710 Ga0495674_0491030
711 Ga0495684_0028146
712 Ga0495593_0193785
713 Ga0495602_0008995
714 Ga0495602_0049176
715 Ga0496104_0061525
716 Ga0496104_0264140
717 Ga0496104_0327453
718 Ga0496107_0173395
719 Ga0496108_0238335
720 Ga0496109_0295064
721 Ga0496109_0462064
722 Ga0496109_0644536
723 Ga0496110_0084741
724 Ga0496112_0013961
725 Ga0496112_0039835
726 Ga0496112_0123247
727 Ga0496112_0190088
728 Ga0496113_0078994
729 Ga0496115_0042862
730 Ga0501033_0227081
731 Ga0501034_0026603
732 Ga0501047_0002015
733 Ga0501083_0184686
734 Ga0501035_0001229
735 Ga0501044_0053738
736 nmdc:mga0n895_210730_c1
737 nmdc:mga0n895_243130_c1
738 nmdc:mga0n895_435961_c1
739 nmdc:mga0n895_549323_c1
740 nmdc:mga0n895_5499_c1
741 nmdc:mga0n895_68728_c1
742 nmdc:mga0rr50_14513_c1
743 nmdc:mga0rr50_172070_c1
744 nmdc:mga0rr50_4407_c1
745 nmdc:mga08x19_36539_c1
746 nmdc:mga08x19_475945_c1
747 nmdc:mga08x19_6658_c1
748 nmdc:mga0a205_161555_c1
749 nmdc:mga0a205_41079_c1
750 nmdc:mga0a205_70055_c1
751 Ga0495619_0055979
752 Ga0501084_0227720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

53

336

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpx-assembly1.cif.gz_H crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9441 8 227
1vpx-assembly2.cif.gz_M crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9247 8 227
1vpx-assembly2.cif.gz_L crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9188 8 227
1vpx-assembly2.cif.gz_N crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9041 8 227
6yre-assembly1.cif.gz_C transaldolase variant t30c/d211c from t. acidophilum 0.8841 8 230
ID Description Score Start End Superfamily
af_Q2FXE8_2_234_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.86 5 227 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8555 8 234 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8303 8 286 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8228 8 286 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7711 8 234 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A538NIB0-F1-model_v4 Transaldolase 0.9991 5 291 GO:0005975
AF-A0A2V9ZEZ5-F1-model_v4 Transaldolase 0.9944 3 205 GO:0005975
AF-A0A2V9V1I9-F1-model_v4 Transaldolase 0.9921 2 167 GO:0005975
AF-A0A2V9SAL4-F1-model_v4 Uncharacterized protein 0.9914 104 213 GO:0005975
AF-A0A2V9SFP6-F1-model_v4 Transaldolase 0.9893 3 290 GO:0005975

Map