F427311

General Info

Members Datasets Scaffolds Average Seq Length
376 199 376 301

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100004004|Ga0075428_10000400413
Length 342
Sequence MLAALAGVRVHVATYKDYYQIMGVARGASQDEIKRAYRRLARKFHPDVSKEANAEDKFKELQEAYEVLKDPQRRAAYDQLGSNWRAGQEFRPPPDWGQDFEFSTSSFGGGAGSRDGDFSDFFASLFGQRSPFGQRGGTSFGSGRGRGGFAAAGEDHVAKIQIDLEDAFRGGTQTIELKAPQLGEDGHVTVQPRTLKVTIPAGVVEGQRIRLAGQGSPGIGGGPAGDLYLEIGFRPHRLFTVEGRDITLSLPIAPWEAALGATVQTPTLAGPVDLRIPPNARAGQKMRLKGRGLPGPTVGDQYVVLKLVQPLADTPRAKEIYEQMHRDLPFDPRKEWEAGTSE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
135 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
149 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
150 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
151 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 0
Rhizoplane 2.39
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001253 3300003203 Bacteria 11914
2 rootH1_10268214 3300003323 Bacteria 1482
3 Ga0065715_10162927 3300005293 Unclassified 1612
4 Ga0070683_100012793 3300005329 Bacteria 7301
5 Ga0070683_100059164 3300005329 Bacteria 3560
6 Ga0070683_100280055 3300005329 Bacteria 1586
7 Ga0070690_100008889 3300005330 Bacteria 5801
8 Ga0070670_100005911 3300005331 Bacteria 10344
9 Ga0070670_100022417 3300005331 Bacteria 5435
10 Ga0070670_100076133 3300005331 Bacteria 2883
11 Ga0068869_100001748 3300005334 Bacteria 12995
12 Ga0068869_100003974 3300005334 Bacteria 9137
13 Ga0070666_10002222 3300005335 Bacteria 11740
14 Ga0070680_100011524 3300005336 Bacteria 6841
15 Ga0070680_100011528 3300005336 Bacteria 6840
16 Ga0070680_100090097 3300005336 Bacteria 2538
17 Ga0068868_100026324 3300005338 Bacteria 4431
18 Ga0070687_100108165 3300005343 Bacteria 1569
19 Ga0070661_100001598 3300005344 Bacteria 15688
20 Ga0070661_100025127 3300005344 Bacteria 4278
21 Ga0070661_100138761 3300005344 Bacteria 1831
22 Ga0070661_100179430 3300005344 Bacteria 1610
23 Ga0070669_100001338 3300005353 Bacteria 17772
24 Ga0070669_100011734 3300005353 Bacteria 6215
25 Ga0070669_100181245 3300005353 Bacteria 1648
26 Ga0070675_100001686 3300005354 Bacteria 16304
27 Ga0070675_100032057 3300005354 Bacteria 4250
28 Ga0070671_100003625 3300005355 Bacteria 12087
29 Ga0070674_100011127 3300005356 Bacteria 5463
30 Ga0070673_100005658 3300005364 Bacteria 8030
31 Ga0070673_100009675 3300005364 Bacteria 6483
32 Ga0070673_100118833 3300005364 Bacteria 2201
33 Ga0070673_100220171 3300005364 Bacteria 1642
34 Ga0070688_100012064 3300005365 Bacteria 4828
35 Ga0070667_100001252 3300005367 Bacteria 23072
36 Ga0070667_100046791 3300005367 Bacteria 3639
37 Ga0070709_10047863 3300005434 Bacteria 2665
38 Ga0070714_100002674 3300005435 Bacteria 13127
39 Ga0070713_100044226 3300005436 Bacteria 3644
40 Ga0070701_10021355 3300005438 Bacteria 3088
41 Ga0070705_100055323 3300005440 Bacteria 2332
42 Ga0070700_100004199 3300005441 Bacteria 7513
43 Ga0070700_100124899 3300005441 Bacteria 1729
44 Ga0070694_100123187 3300005444 Bacteria 1863
45 Ga0070663_100024312 3300005455 Bacteria 4075
46 Ga0070678_100061140 3300005456 Bacteria 2775
47 Ga0070678_100070283 3300005456 Bacteria 2616
48 Ga0070678_100102214 3300005456 Bacteria 2224
49 Ga0070662_100012511 3300005457 Bacteria 5628
50 Ga0070662_100056606 3300005457 Bacteria 2847
51 Ga0070681_10001696 3300005458 Bacteria 19704
52 Ga0070681_10154401 3300005458 Bacteria 2221
53 Ga0070681_10472228 3300005458 Bacteria 1167
54 Ga0070679_100013748 3300005530 Bacteria 7754
55 Ga0070679_100294897 3300005530 Bacteria 1573
56 Ga0070684_100001057 3300005535 Bacteria 19684
57 Ga0070684_100125429 3300005535 Bacteria 2312
58 Ga0070672_100004560 3300005543 Bacteria 9071
59 Ga0070672_100005290 3300005543 Bacteria 8541
60 Ga0070686_100004252 3300005544 Bacteria 7890
61 Ga0070686_100053487 3300005544 Bacteria 2578
62 Ga0070693_100039327 3300005547 Bacteria 2649
63 Ga0070693_100081677 3300005547 Bacteria 1928
64 Ga0070665_100095959 3300005548 Bacteria 2970
65 Ga0070665_100304555 3300005548 Bacteria 1597
66 Ga0068855_100000777 3300005563 Bacteria 39367
67 Ga0068855_100006843 3300005563 Bacteria 13832
68 Ga0068855_100234103 3300005563 Bacteria 2055
69 Ga0070664_100001071 3300005564 Bacteria 21535
70 Ga0068857_100004520 3300005577 Bacteria 11764
71 Ga0068857_100229553 3300005577 Unclassified 1697
72 Ga0068856_100026018 3300005614 Bacteria 5707
73 Ga0070702_100017988 3300005615 Bacteria 3657
74 Ga0068859_100011081 3300005617 Bacteria 9072
75 Ga0068859_100143017 3300005617 Bacteria 2465
76 Ga0068864_100021928 3300005618 Bacteria 5354
77 Ga0068864_100098119 3300005618 Bacteria 2594
78 Ga0068864_100118261 3300005618 Bacteria 2366
79 Ga0068864_100443925 3300005618 Bacteria 1240
80 Ga0068866_10018788 3300005718 Bacteria 3133
81 Ga0068861_100001653 3300005719 Bacteria 14251
82 Ga0068861_100034834 3300005719 Bacteria 3725
83 Ga0068861_100130376 3300005719 Bacteria 2040
84 Ga0068851_10029029 3300005834 Bacteria 2736
85 Ga0068851_10085805 3300005834 Bacteria 1650
86 Ga0068870_10001332 3300005840 Bacteria 9951
87 Ga0068863_100001027 3300005841 Bacteria 27904
88 Ga0068863_100001758 3300005841 Bacteria 21501
89 Ga0068863_100165850 3300005841 Bacteria 2118
90 Ga0068858_100001384 3300005842 Bacteria 24985
91 Ga0068858_100013050 3300005842 Bacteria 7836
92 Ga0068860_100001335 3300005843 Bacteria 26824
93 Ga0068860_100004234 3300005843 Bacteria 14695
94 Ga0068860_100412421 3300005843 Bacteria 1338
95 Ga0068862_100006150 3300005844 Bacteria 9991
96 Ga0068862_100008872 3300005844 Bacteria 8325
97 Ga0068862_100019417 3300005844 Bacteria 5672
98 Ga0081455_10000032 3300005937 Bacteria 146266
99 Ga0081539_10000007 3300005985 Bacteria 532790
100 Ga0075365_10179954 3300006038 Unclassified 1478
101 Ga0097621_100198214 3300006237 Bacteria 1742
102 Ga0097621_100243247 3300006237 Bacteria 1573
103 Ga0068871_100016332 3300006358 Bacteria 5588
104 Ga0068871_100025729 3300006358 Bacteria 4583
105 Ga0075428_100001213 3300006844 Bacteria 27569
106 Ga0075428_100004004 3300006844 Bacteria 16171
107 Ga0075430_100000626 3300006846 Bacteria 26928
108 Ga0075430_100002011 3300006846 Bacteria 16749
109 Ga0075431_100001454 3300006847 Bacteria 21836
110 Ga0075431_100003248 3300006847 Bacteria 15749
111 Ga0075431_100035529 3300006847 Bacteria 5131
112 Ga0075429_100001409 3300006880 Bacteria 19695
113 Ga0075429_100002507 3300006880 Bacteria 15449
114 Ga0075429_100079238 3300006880 Bacteria 2863
115 Ga0068865_100101109 3300006881 Bacteria 2111
116 Ga0097620_100011081 3300006931 Bacteria 9072
117 Ga0097620_100143021 3300006931 Bacteria 2465
118 Ga0099794_10009309 3300007265 Bacteria 4124
119 Ga0105240_10000096 3300009093 Bacteria 179543
120 Ga0105240_10011252 3300009093 Bacteria 12476
121 Ga0105240_10021966 3300009093 Bacteria 8476
122 Ga0105240_10030463 3300009093 Bacteria 7013
123 Ga0105240_10058904 3300009093 Bacteria 4794
124 Ga0105240_10073573 3300009093 Bacteria 4219
125 Ga0105240_10176441 3300009093 Unclassified 2526
126 Ga0105240_10218465 3300009093 Bacteria 2222
127 Ga0105240_10387223 3300009093 Bacteria 1578
128 Ga0111539_10001135 3300009094 Bacteria 35190
129 Ga0111539_10019168 3300009094 Bacteria 8451
130 Ga0111539_10039348 3300009094 Bacteria 5700
131 Ga0111539_10111782 3300009094 Bacteria 3205
132 Ga0111539_10651596 3300009094 Bacteria 1226
133 Ga0114129_10000072 3300009147 Bacteria 92950
134 Ga0114129_10076909 3300009147 Bacteria 4645
135 Ga0105243_10012980 3300009148 Bacteria 6294
136 Ga0105241_10022727 3300009174 Bacteria 4647
137 Ga0105241_10078528 3300009174 Bacteria 2579
138 Ga0105248_10004566 3300009177 Bacteria 15334
139 Ga0105248_10010676 3300009177 Bacteria 10132
140 Ga0105248_10092366 3300009177 Bacteria 3409
141 Ga0105238_10021412 3300009551 Bacteria 6586
142 Ga0105238_10262139 3300009551 Bacteria 1708
143 Ga0105249_10012594 3300009553 Bacteria 7456
144 Ga0105249_10013374 3300009553 Bacteria 7248
145 Ga0157369_10028550 3300013105 Bacteria 6174
146 Ga0157369_10405864 3300013105 Bacteria 1413
147 Ga0157374_10335413 3300013296 Bacteria 1500
148 Ga0163162_10005389 3300013306 Bacteria 12354
149 Ga0163162_10065045 3300013306 Bacteria 3693
150 Ga0157372_10032168 3300013307 Bacteria 5749
151 Ga0157375_10007311 3300013308 Bacteria 9664
152 Ga0157375_10011126 3300013308 Bacteria 7934
153 Ga0157375_10140485 3300013308 Bacteria 2542
154 Ga0163163_10002246 3300014325 Bacteria 16270
155 Ga0163163_10204168 3300014325 Bacteria 2025
156 Ga0163163_10239692 3300014325 Bacteria 1863
157 Ga0157377_10024514 3300014745 Bacteria 3207
158 Ga0157379_10032160 3300014968 Bacteria 4676
159 Ga0157379_10162115 3300014968 Bacteria 2018
160 Ga0207656_10022891 3300025321 Bacteria 2510
161 Ga0207656_10024425 3300025321 Bacteria 2444
162 Ga0207682_10129942 3300025893 Bacteria 1124
163 Ga0207642_10002231 3300025899 Bacteria 6017
164 Ga0207680_10007990 3300025903 Bacteria 5178
165 Ga0207699_10179846 3300025906 Bacteria 1421
166 Ga0207645_10078095 3300025907 Bacteria 2121
167 Ga0207643_10024979 3300025908 Bacteria 3300
168 Ga0207654_10208269 3300025911 Bacteria 1291
169 Ga0207707_10018683 3300025912 Bacteria 6045
170 Ga0207707_10092542 3300025912 Bacteria 2642
171 Ga0207707_10148705 3300025912 Bacteria 2048
172 Ga0207695_10000836 3300025913 Bacteria 56759
173 Ga0207695_10014667 3300025913 Bacteria 9267
174 Ga0207695_10036069 3300025913 Bacteria 5350
175 Ga0207695_10082521 3300025913 Bacteria 3249
176 Ga0207695_10230446 3300025913 Bacteria 1757
177 Ga0207660_10023759 3300025917 Bacteria 4142
178 Ga0207660_10119322 3300025917 Bacteria 1996
179 Ga0207662_10015817 3300025918 Bacteria 4249
180 Ga0207649_10092824 3300025920 Bacteria 1980
181 Ga0207652_10016775 3300025921 Bacteria 5984
182 Ga0207652_10092903 3300025921 Bacteria 2654
183 Ga0207652_10294425 3300025921 Bacteria 1465
184 Ga0207681_10000103 3300025923 Bacteria 72540
185 Ga0207681_10008992 3300025923 Bacteria 6101
186 Ga0207681_10177785 3300025923 Bacteria 1618
187 Ga0207650_10014455 3300025925 Bacteria 5488
188 Ga0207650_10019257 3300025925 Bacteria 4793
189 Ga0207650_10049078 3300025925 Bacteria 3115
190 Ga0207650_10122748 3300025925 Bacteria 2024
191 Ga0207659_10002887 3300025926 Bacteria 10226
192 Ga0207659_10016157 3300025926 Bacteria 4853
193 Ga0207659_10044845 3300025926 Bacteria 3113
194 Ga0207700_10013479 3300025928 Bacteria 5322
195 Ga0207700_10069688 3300025928 Bacteria 2700
196 Ga0207644_10004850 3300025931 Bacteria 8754
197 Ga0207706_10023086 3300025933 Bacteria 5587
198 Ga0207706_10027553 3300025933 Bacteria 5080
199 Ga0207706_10028083 3300025933 Bacteria 5027
200 Ga0207706_10183703 3300025933 Bacteria 1837
201 Ga0207686_10253254 3300025934 Unclassified 1287
202 Ga0207691_10032418 3300025940 Bacteria 4870
203 Ga0207691_10069347 3300025940 Bacteria 3185
204 Ga0207691_10182183 3300025940 Bacteria 1835
205 Ga0207711_10030153 3300025941 Bacteria 4574
206 Ga0207711_10113326 3300025941 Bacteria 2414
207 Ga0207711_10138086 3300025941 Bacteria 2191
208 Ga0207689_10009879 3300025942 Bacteria 8225
209 Ga0207689_10011432 3300025942 Bacteria 7608
210 Ga0207661_10157176 3300025944 Bacteria 1970
211 Ga0207661_10361542 3300025944 Bacteria 1311
212 Ga0207679_10001894 3300025945 Bacteria 12990
213 Ga0207679_10002428 3300025945 Bacteria 11486
214 Ga0207679_10232688 3300025945 Bacteria 1557
215 Ga0207667_10003206 3300025949 Bacteria 20214
216 Ga0207667_10003939 3300025949 Bacteria 18267
217 Ga0207651_10011781 3300025960 Bacteria 4909
218 Ga0207651_10094319 3300025960 Bacteria 2200
219 Ga0207712_10006651 3300025961 Bacteria 7296
220 Ga0207712_10077508 3300025961 Bacteria 2409
221 Ga0207668_10022330 3300025972 Bacteria 4049
222 Ga0207668_10022473 3300025972 Bacteria 4039
223 Ga0207658_10000115 3300025986 Bacteria 88556
224 Ga0207677_10015385 3300026023 Bacteria 4499
225 Ga0207677_10019724 3300026023 Bacteria 4078
226 Ga0207703_10000944 3300026035 Bacteria 28184
227 Ga0207703_10016967 3300026035 Bacteria 5679
228 Ga0207639_10159709 3300026041 Bacteria 1898
229 Ga0207639_10192419 3300026041 Bacteria 1743
230 Ga0207708_10012626 3300026075 Bacteria 6300
231 Ga0207708_10026469 3300026075 Bacteria 4390
232 Ga0207702_10013192 3300026078 Bacteria 6871
233 Ga0207702_10015302 3300026078 Bacteria 6360
234 Ga0207641_10000656 3300026088 Bacteria 37739
235 Ga0207641_10008113 3300026088 Bacteria 8696
236 Ga0207641_10109701 3300026088 Bacteria 2444
237 Ga0207641_10436488 3300026088 Bacteria 1263
238 Ga0207648_10022459 3300026089 Bacteria 5663
239 Ga0207676_10002322 3300026095 Bacteria 13651
240 Ga0207676_10019621 3300026095 Bacteria 4934
241 Ga0207676_10040892 3300026095 Bacteria 3555
242 Ga0207674_10013849 3300026116 Bacteria 8922
243 Ga0207674_10084045 3300026116 Bacteria 3182
244 Ga0207675_100004048 3300026118 Bacteria 14195
245 Ga0207675_100024438 3300026118 Bacteria 5618
246 Ga0207675_100050743 3300026118 Bacteria 3871
247 Ga0207675_100105467 3300026118 Bacteria 2657
248 Ga0207683_10004944 3300026121 Bacteria 11467
249 Ga0207683_10057780 3300026121 Bacteria 3405
250 Ga0207683_10139711 3300026121 Bacteria 2182
251 Ga0207698_10041982 3300026142 Bacteria 3413
252 Ga0207698_10114562 3300026142 Bacteria 2268
253 Ga0207698_10304390 3300026142 Bacteria 1485
254 Ga0209588_1005342 3300027671 Bacteria 3676
255 Ga0207428_10066288 3300027907 Bacteria 2845
256 Ga0207428_10175561 3300027907 Bacteria 1621
257 Ga0268266_10012863 3300028379 Bacteria 7226
258 Ga0268266_10362491 3300028379 Bacteria 1364
259 Ga0268265_10004746 3300028380 Bacteria 9373
260 Ga0268265_10005102 3300028380 Bacteria 9004
261 Ga0268265_10006018 3300028380 Bacteria 8253
262 Ga0268264_10001008 3300028381 Bacteria 28576
263 Ga0268264_10035773 3300028381 Bacteria 4088
264 Ga0307515_10117445 3300028794 Bacteria 3045
265 Ga0265332_10001510 3300031238 Bacteria 12918
266 Ga0265320_10019336 3300031240 Bacteria 3726
267 Ga0307509_10000044 3300031507 Bacteria 176718
268 Ga0307408_100179438 3300031548 Bacteria 1697
269 Ga0307408_100248068 3300031548 Bacteria 1467
270 Ga0265313_10012748 3300031595 Bacteria 5104
271 Ga0316575_10002587 3300031665 Bacteria 6093
272 Ga0316575_10015296 3300031665 Bacteria 2891
273 Ga0316575_10098284 3300031665 Bacteria 1188
274 Ga0316579_10006265 3300031691 Bacteria 4847
275 Ga0265314_10027457 3300031711 Bacteria 4261
276 Ga0316576_10019377 3300031727 Bacteria 4661
277 Ga0316576_10024120 3300031727 Bacteria 4245
278 Ga0316576_10066094 3300031727 Bacteria 2659
279 Ga0316576_10070978 3300031727 Bacteria 2569
280 Ga0316578_10058463 3300031728 Bacteria 2267
281 Ga0316578_10090963 3300031728 Bacteria 1822
282 Ga0316578_10253003 3300031728 Bacteria 1057
283 Ga0307405_10011104 3300031731 Bacteria 4702
284 Ga0316577_10039258 3300031733 Bacteria 2648
285 Ga0316577_10248935 3300031733 Bacteria 1005
286 Ga0307410_10154037 3300031852 Bacteria 1714
287 Ga0307407_10214352 3300031903 Bacteria 1298
288 Ga0307412_10092689 3300031911 Bacteria 2117
289 Ga0307409_100001798 3300031995 Bacteria 10845
290 Ga0307416_100077656 3300032002 Bacteria 2790
291 Ga0307411_10331977 3300032005 Bacteria 1232
292 Ga0307415_100034430 3300032126 Bacteria 3298
293 Ga0316583_10011116 3300032133 Bacteria 3242
294 Ga0316585_10022979 3300032137 Bacteria 1920
295 Ga0316580_10008612 3300032139 Bacteria 3059
296 Ga0316596_1025763 3300033541 Bacteria 1514
297 Ga0373957_0044049 3300035120 Bacteria 1688
298 Ga0373943_0072691 3300035170 Bacteria 1745
299 Ga0316574_0005449 3300035398 Bacteria 6786
300 Ga0316574_0008015 3300035398 Bacteria 5835
301 Ga0316574_0010958 3300035398 Bacteria 5139
302 Ga0316574_0033178 3300035398 Bacteria 3142
303 Ga0316574_0091495 3300035398 Bacteria 1940
304 Ga0316574_0102284 3300035398 Bacteria 1834
305 Ga0373924_0024450 3300035410 Bacteria 2380
306 Ga0316582_0014214 3300036647 Bacteria 4510
307 Ga0316582_0102044 3300036647 Bacteria 1901
308 Ga0316582_0142951 3300036647 Bacteria 1614
309 Ga0316582_0176066 3300036647 Bacteria 1454
310 Ga0316584_0097996 3300036712 Bacteria 2195
311 Ga0436364_0072161 3300037853 Bacteria 1392
312 Ga0436363_1481939 3300039450 Bacteria 14203
313 Ga0466969_0026041 3300044656 Bacteria 3002
314 Ga0466959_0001922 3300045049 Bacteria 13066
315 Ga0466959_0014292 3300045049 Bacteria 5762
316 Ga0466959_0032766 3300045049 Bacteria 3846
317 Ga0451576_0027133 3300045051 Bacteria 6154
318 Ga0451576_0075815 3300045051 Bacteria 3500
319 Ga0466958_0106370 3300045836 Bacteria 1749
320 Ga0495629_0029374 3300046459 Bacteria 3899
321 Ga0495650_0007004 3300046471 Bacteria 6884
322 Ga0495640_0111279 3300046533 Bacteria 1790
323 Ga0495645_0017626 3300046543 Bacteria 5117
324 Ga0495647_0010086 3300046681 Bacteria 3214
325 Ga0495658_0032741 3300046683 Bacteria 2841
326 Ga0495658_0036053 3300046683 Bacteria 2726
327 Ga0495658_0083383 3300046683 Bacteria 1880
328 Ga0495674_0016960 3300047319 Bacteria 6789
329 Ga0495672_0104727 3300047320 Bacteria 1528
330 Ga0495686_0247882 3300047472 Bacteria 1002
331 Ga0496108_0154282 3300048911 Bacteria 1982
332 Ga0496109_0005785 3300048912 Bacteria 10349
333 Ga0496109_0088561 3300048912 Bacteria 2861
334 Ga0496110_0552692 3300048913 Bacteria 1046
335 Ga0496112_0104649 3300048915 Bacteria 2800
336 Ga0496112_0138279 3300048915 Bacteria 2406
337 Ga0496113_0274887 3300048916 Bacteria 1347
338 Ga0496114_0022175 3300048917 Bacteria 5173
339 Ga0496114_0134177 3300048917 Bacteria 2140
340 Ga0496124_0219988 3300048927 Bacteria 1429
341 Ga0496126_0036009 3300048929 Bacteria 4632
342 Ga0501040_0004056 3300049576 Bacteria 9518
343 Ga0501040_0032472 3300049576 Bacteria 3532
344 Ga0501042_0000281 3300049578 Bacteria 24998
345 Ga0501042_0035437 3300049578 Bacteria 3540
346 Ga0501047_0077938 3300049581 Bacteria 3187
347 Ga0501074_0054670 3300049590 Bacteria 2879
348 Ga0501080_0031403 3300049742 Bacteria 4949
349 Ga0501044_0007844 3300049823 Bacteria 11737
350 nmdc:mga0yw44_159238_c1 3300050492 Unclassified 1477
351 nmdc:mga05p37_135_c1 3300050507 Bacteria 68116
352 nmdc:mga05p37_18037_c1 3300050507 Bacteria 8525
353 nmdc:mga09592_13735_c1 3300050508 Bacteria 6616
354 nmdc:mga09592_204_c1 3300050508 Bacteria 42574
355 nmdc:mga09592_29393_c1 3300050508 Bacteria 4571
356 nmdc:mga0qj67_300675_c1 3300050509 Bacteria 1300
357 nmdc:mga0qj67_507_c1 3300050509 Bacteria 26621
358 nmdc:mga0qj67_7592_c1 3300050509 Bacteria 8011
359 nmdc:mga06r32_1617_c1 3300050510 Bacteria 20320
360 nmdc:mga06r32_3_c1 3300050510 Bacteria 164616
361 nmdc:mga06r32_96_c1 3300050510 Bacteria 61629
362 nmdc:mga08y16_13179_c1 3300050511 Bacteria 8696
363 nmdc:mga08y16_25133_c1 3300050511 Bacteria 6282
364 nmdc:mga08y16_288901_c1 3300050511 Bacteria 1691
365 nmdc:mga08y16_55087_c1 3300050511 Bacteria 4156
366 nmdc:mga0n895_592015_c1 3300050512 Unclassified 1112
367 Ga0500583_0106299 3300053092 Bacteria 1379
368 Ga0500583_0168342 3300053092 Bacteria 1091
369 Ga0500617_075075 3300053124 Bacteria 1474
370 Ga0500568_0012050 3300053139 Bacteria 3986
371 Ga0500568_0016777 3300053139 Bacteria 3245
372 Ga0500588_0004235 3300053146 Bacteria 3093
373 Ga0500622_0001274 3300053156 Bacteria 20542
374 Ga0500622_0003006 3300053156 Bacteria 11661
375 Ga0500637_0122955 3300053178 Bacteria 1506
376 Ga0500637_0126377 3300053178 Bacteria 1483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0029374 Ga0495629_0029374_1419_2366 245
2 3300047319 Ga0495674_0016960 Ga0495674_0016960_5520_6467 245
3 3300048929 Ga0496126_0036009 Ga0496126_0036009_2229_3239 252
4 3300045049 Ga0466959_0014292 Ga0466959_0014292_2014_3006 254
5 3300005329 Ga0070683_100059164 Ga0070683_1000591643 257
6 3300005336 Ga0070680_100011524 Ga0070680_1000115243 257
7 3300005458 Ga0070681_10154401 Ga0070681_101544012 257
8 3300005535 Ga0070684_100125429 Ga0070684_1001254292 257
9 3300005841 Ga0068863_100165850 Ga0068863_1001658502 257
10 3300009551 Ga0105238_10262139 Ga0105238_102621391 257
11 3300025912 Ga0207707_10092542 Ga0207707_100925424 257
12 3300025944 Ga0207661_10157176 Ga0207661_101571762 257
13 3300005563 Ga0068855_100234103 Ga0068855_1002341033 258
14 3300009093 Ga0105240_10387223 Ga0105240_103872231 258
15 3300013105 Ga0157369_10405864 Ga0157369_104058641 258
16 3300025906 Ga0207699_10179846 Ga0207699_101798461 258
17 3300048927 Ga0496124_0219988 Ga0496124_0219988_28_960 258
18 3300009093 Ga0105240_10030463 Ga0105240_100304635 259
19 3300049581 Ga0501047_0077938 Ga0501047_0077938_1928_2869 260
20 3300049590 Ga0501074_0054670 Ga0501074_0054670_490_1431 260
21 3300049742 Ga0501080_0031403 Ga0501080_0031403_2119_3060 260
22 3300049823 Ga0501044_0007844 Ga0501044_0007844_1226_2167 260
23 3300025928 Ga0207700_10013479 Ga0207700_100134792 261
24 3300003323 rootH1_10268214 rootH1_102682142 262
25 3300005434 Ga0070709_10047863 Ga0070709_100478632 263
26 3300005563 Ga0068855_100000777 Ga0068855_10000077718 263
27 3300009093 Ga0105240_10021966 Ga0105240_100219666 263
28 3300025913 Ga0207695_10014667 Ga0207695_100146674 263
29 3300025949 Ga0207667_10003939 Ga0207667_100039399 263
30 3300028379 Ga0268266_10012863 Ga0268266_100128637 263
31 3300005353 Ga0070669_100181245 Ga0070669_1001812452 265
32 3300025923 Ga0207681_10177785 Ga0207681_101777852 265
33 3300053139 Ga0500568_0012050 Ga0500568_0012050_418_1353 265
34 3300050509 nmdc:mga0qj67_300675_c1 nmdc:mga0qj67_300675_c1_387_1286 267
35 3300005336 Ga0070680_100011528 Ga0070680_1000115287 268
36 3300005458 Ga0070681_10001696 Ga0070681_100016962 268
37 3300005458 Ga0070681_10472228 Ga0070681_104722281 268
38 3300005530 Ga0070679_100013748 Ga0070679_1000137487 268
39 3300009551 Ga0105238_10021412 Ga0105238_100214122 268
40 3300013105 Ga0157369_10028550 Ga0157369_100285503 268
41 3300025912 Ga0207707_10018683 Ga0207707_100186834 268
42 3300025912 Ga0207707_10148705 Ga0207707_101487052 268
43 3300025917 Ga0207660_10023759 Ga0207660_100237592 268
44 3300025921 Ga0207652_10016775 Ga0207652_100167754 268
45 3300025921 Ga0207652_10294425 Ga0207652_102944252 268
46 3300005336 Ga0070680_100090097 Ga0070680_1000900972 269
47 3300005436 Ga0070713_100044226 Ga0070713_1000442263 269
48 3300047472 Ga0495686_0247882 Ga0495686_0247882_14_937 271
49 3300031548 Ga0307408_100248068 Ga0307408_1002480682 272
50 3300049576 Ga0501040_0004056 Ga0501040_0004056_7534_8496 272
51 3300049578 Ga0501042_0000281 Ga0501042_0000281_23218_24180 272
52 3300053178 Ga0500637_0126377 Ga0500637_0126377_367_1371 272
53 3300005435 Ga0070714_100002674 Ga0070714_1000026748 274
54 3300036647 Ga0316582_0014214 Ga0316582_0014214_2699_3655 274
55 3300048912 Ga0496109_0088561 Ga0496109_0088561_1548_2528 274
56 3300009177 Ga0105248_10004566 Ga0105248_1000456612 275
57 3300014325 Ga0163163_10002246 Ga0163163_1000224613 275
58 3300014745 Ga0157377_10024514 Ga0157377_100245144 275
59 3300025928 Ga0207700_10069688 Ga0207700_100696884 275
60 3300026088 Ga0207641_10109701 Ga0207641_101097013 275
61 3300048915 Ga0496112_0104649 Ga0496112_0104649_1532_2500 275
62 3300009093 Ga0105240_10011252 Ga0105240_100112525 276
63 3300025913 Ga0207695_10230446 Ga0207695_102304462 276
64 3300028794 Ga0307515_10117445 Ga0307515_101174453 276
65 3300032005 Ga0307411_10331977 Ga0307411_103319771 276
66 3300009093 Ga0105240_10073573 Ga0105240_100735733 277
67 3300025913 Ga0207695_10082521 Ga0207695_100825213 277
68 3300037853 Ga0436364_0072161 Ga0436364_0072161_27_1013 277
69 3300053139 Ga0500568_0016777 Ga0500568_0016777_2175_3110 277
70 3300053178 Ga0500637_0122955 Ga0500637_0122955_460_1470 277
71 3300045049 Ga0466959_0001922 Ga0466959_0001922_11563_12546 278
72 3300005577 Ga0068857_100229553 Ga0068857_1002295532 279
73 3300005353 Ga0070669_100011734 Ga0070669_1000117343 280
74 3300005444 Ga0070694_100123187 Ga0070694_1001231872 280
75 3300005456 Ga0070678_100102214 Ga0070678_1001022142 280
76 3300005457 Ga0070662_100012511 Ga0070662_1000125113 280
77 3300005719 Ga0068861_100001653 Ga0068861_1000016536 280
78 3300005843 Ga0068860_100412421 Ga0068860_1004124212 280
79 3300005844 Ga0068862_100006150 Ga0068862_1000061506 280
80 3300009094 Ga0111539_10111782 Ga0111539_101117822 280
81 3300009553 Ga0105249_10012594 Ga0105249_100125942 280
82 3300025923 Ga0207681_10008992 Ga0207681_100089923 280
83 3300025933 Ga0207706_10023086 Ga0207706_100230864 280
84 3300025945 Ga0207679_10232688 Ga0207679_102326882 280
85 3300025961 Ga0207712_10006651 Ga0207712_100066515 280
86 3300025972 Ga0207668_10022473 Ga0207668_100224733 280
87 3300026116 Ga0207674_10084045 Ga0207674_100840452 280
88 3300026118 Ga0207675_100004048 Ga0207675_1000040487 280
89 3300027907 Ga0207428_10175561 Ga0207428_101755612 280
90 3300028380 Ga0268265_10004746 Ga0268265_100047462 280
91 3300031507 Ga0307509_10000044 Ga0307509_10000044157 280
92 3300050511 nmdc:mga08y16_288901_c1 nmdc:mga08y16_288901_c1_502_1527 280
93 3300053092 Ga0500583_0168342 Ga0500583_0168342_96_1058 280
94 3300009093 Ga0105240_10000096 Ga0105240_10000096129 281
95 3300025913 Ga0207695_10000836 Ga0207695_1000083641 281
96 3300031238 Ga0265332_10001510 Ga0265332_100015103 281
97 3300053156 Ga0500622_0001274 Ga0500622_0001274_11568_12497 281
98 3300053156 Ga0500622_0003006 Ga0500622_0003006_9628_10563 282
99 3300005293 Ga0065715_10162927 Ga0065715_101629272 284
100 3300005329 Ga0070683_100280055 Ga0070683_1002800552 284
101 3300005331 Ga0070670_100005911 Ga0070670_1000059115 284
102 3300005334 Ga0068869_100003974 Ga0068869_1000039748 284
103 3300005343 Ga0070687_100108165 Ga0070687_1001081652 284
104 3300005344 Ga0070661_100001598 Ga0070661_1000015987 284
105 3300005354 Ga0070675_100001686 Ga0070675_1000016864 284
106 3300005364 Ga0070673_100005658 Ga0070673_1000056584 284
107 3300005365 Ga0070688_100012064 Ga0070688_1000120642 284
108 3300005438 Ga0070701_10021355 Ga0070701_100213552 284
109 3300005440 Ga0070705_100055323 Ga0070705_1000553232 284
110 3300005441 Ga0070700_100004199 Ga0070700_1000041996 284
111 3300005457 Ga0070662_100056606 Ga0070662_1000566062 284
112 3300005535 Ga0070684_100001057 Ga0070684_10000105716 284
113 3300005543 Ga0070672_100004560 Ga0070672_1000045608 284
114 3300005544 Ga0070686_100004252 Ga0070686_1000042523 284
115 3300005547 Ga0070693_100039327 Ga0070693_1000393272 284
116 3300005548 Ga0070665_100095959 Ga0070665_1000959594 284
117 3300005564 Ga0070664_100001071 Ga0070664_1000010712 284
118 3300005577 Ga0068857_100004520 Ga0068857_1000045204 284
119 3300005615 Ga0070702_100017988 Ga0070702_1000179883 284
120 3300005617 Ga0068859_100011081 Ga0068859_1000110814 284
121 3300005618 Ga0068864_100021928 Ga0068864_1000219284 284
122 3300005719 Ga0068861_100130376 Ga0068861_1001303763 284
123 3300005840 Ga0068870_10001332 Ga0068870_100013329 284
124 3300005841 Ga0068863_100001758 Ga0068863_10000175815 284
125 3300005842 Ga0068858_100013050 Ga0068858_1000130502 284
126 3300005843 Ga0068860_100004234 Ga0068860_1000042346 284
127 3300005844 Ga0068862_100008872 Ga0068862_1000088723 284
128 3300006237 Ga0097621_100198214 Ga0097621_1001982142 284
129 3300006846 Ga0075430_100002011 Ga0075430_1000020115 284
130 3300006847 Ga0075431_100035529 Ga0075431_1000355293 284
131 3300006880 Ga0075429_100079238 Ga0075429_1000792382 284
132 3300006881 Ga0068865_100101109 Ga0068865_1001011092 284
133 3300006931 Ga0097620_100011081 Ga0097620_1000110814 284
134 3300013306 Ga0163162_10065045 Ga0163162_100650452 284
135 3300025908 Ga0207643_10024979 Ga0207643_100249794 284
136 3300025917 Ga0207660_10119322 Ga0207660_101193222 284
137 3300025918 Ga0207662_10015817 Ga0207662_100158172 284
138 3300025920 Ga0207649_10092824 Ga0207649_100928242 284
139 3300025925 Ga0207650_10014455 Ga0207650_100144555 284
140 3300025926 Ga0207659_10044845 Ga0207659_100448453 284
141 3300025934 Ga0207686_10253254 Ga0207686_102532542 284
142 3300025940 Ga0207691_10032418 Ga0207691_100324183 284
143 3300025942 Ga0207689_10011432 Ga0207689_100114327 284
144 3300025944 Ga0207661_10361542 Ga0207661_103615422 284
145 3300025945 Ga0207679_10001894 Ga0207679_100018943 284
146 3300025960 Ga0207651_10011781 Ga0207651_100117813 284
147 3300025961 Ga0207712_10077508 Ga0207712_100775081 284
148 3300026023 Ga0207677_10019724 Ga0207677_100197244 284
149 3300026075 Ga0207708_10012626 Ga0207708_100126262 284
150 3300026088 Ga0207641_10008113 Ga0207641_100081134 284
151 3300026089 Ga0207648_10022459 Ga0207648_100224595 284
152 3300026095 Ga0207676_10002322 Ga0207676_1000232211 284
153 3300026116 Ga0207674_10013849 Ga0207674_100138494 284
154 3300026118 Ga0207675_100024438 Ga0207675_1000244383 284
155 3300028379 Ga0268266_10362491 Ga0268266_103624912 284
156 3300028380 Ga0268265_10005102 Ga0268265_100051024 284
157 3300028381 Ga0268264_10035773 Ga0268264_100357732 284
158 3300048912 Ga0496109_0005785 Ga0496109_0005785_3160_4152 284
159 3300048915 Ga0496112_0138279 Ga0496112_0138279_173_1165 284
160 3300049576 Ga0501040_0032472 Ga0501040_0032472_2505_3467 284
161 3300049578 Ga0501042_0035437 Ga0501042_0035437_197_1159 284
162 3300050508 nmdc:mga09592_29393_c1 nmdc:mga09592_29393_c1_784_1764 284
163 3300050509 nmdc:mga0qj67_7592_c1 nmdc:mga0qj67_7592_c1_873_1853 284
164 3300050510 nmdc:mga06r32_1617_c1 nmdc:mga06r32_1617_c1_3039_4019 284
165 3300050512 nmdc:mga0n895_592015_c1 nmdc:mga0n895_592015_c1_17_1009 284
166 3300009093 Ga0105240_10058904 Ga0105240_100589045 285
167 3300009174 Ga0105241_10078528 Ga0105241_100785283 285
168 3300031240 Ga0265320_10019336 Ga0265320_100193362 285
169 3300031595 Ga0265313_10012748 Ga0265313_100127482 285
170 3300031711 Ga0265314_10027457 Ga0265314_100274573 285
171 3300035410 Ga0373924_0024450 Ga0373924_0024450_674_1651 285
172 3300046683 Ga0495658_0036053 Ga0495658_0036053_557_1534 285
173 3300046683 Ga0495658_0083383 Ga0495658_0083383_594_1571 285
174 3300009094 Ga0111539_10039348 Ga0111539_100393481 286
175 3300026118 Ga0207675_100105467 Ga0207675_1001054673 286
176 3300027671 Ga0209588_1005342 Ga0209588_10053424 286
177 3300050511 nmdc:mga08y16_55087_c1 nmdc:mga08y16_55087_c1_2048_3040 286
178 3300007265 Ga0099794_10009309 Ga0099794_100093092 287
179 3300035120 Ga0373957_0044049 Ga0373957_0044049_339_1322 287
180 3300046681 Ga0495647_0010086 Ga0495647_0010086_2143_3126 287
181 3300005355 Ga0070671_100003625 Ga0070671_1000036252 288
182 3300005364 Ga0070673_100220171 Ga0070673_1002201712 288
183 3300005618 Ga0068864_100118261 Ga0068864_1001182613 288
184 3300006358 Ga0068871_100025729 Ga0068871_1000257295 288
185 3300009177 Ga0105248_10010676 Ga0105248_100106769 288
186 3300014325 Ga0163163_10239692 Ga0163163_102396923 288
187 3300025321 Ga0207656_10022891 Ga0207656_100228912 288
188 3300025931 Ga0207644_10004850 Ga0207644_100048509 288
189 3300025941 Ga0207711_10030153 Ga0207711_100301535 288
190 3300025960 Ga0207651_10094319 Ga0207651_100943192 288
191 3300026088 Ga0207641_10436488 Ga0207641_104364882 288
192 3300026142 Ga0207698_10304390 Ga0207698_103043902 288
193 3300031728 Ga0316578_10253003 Ga0316578_102530031 288
194 3300039450 Ga0436363_1481939 Ga0436363_1481939_1622_2626 288
195 3300044656 Ga0466969_0026041 Ga0466969_0026041_1614_2618 288
196 3300045049 Ga0466959_0032766 Ga0466959_0032766_442_1446 288
197 3300045836 Ga0466958_0106370 Ga0466958_0106370_423_1427 288
198 3300048911 Ga0496108_0154282 Ga0496108_0154282_211_1194 288
199 3300005331 Ga0070670_100022417 Ga0070670_1000224175 289
200 3300005344 Ga0070661_100138761 Ga0070661_1001387613 289
201 3300005354 Ga0070675_100032057 Ga0070675_1000320573 289
202 3300005364 Ga0070673_100009675 Ga0070673_1000096756 289
203 3300005364 Ga0070673_100118833 Ga0070673_1001188332 289
204 3300005456 Ga0070678_100070283 Ga0070678_1000702833 289
205 3300005543 Ga0070672_100005290 Ga0070672_1000052906 289
206 3300005618 Ga0068864_100443925 Ga0068864_1004439252 289
207 3300005834 Ga0068851_10085805 Ga0068851_100858052 289
208 3300006358 Ga0068871_100016332 Ga0068871_1000163326 289
209 3300006844 Ga0075428_100001213 Ga0075428_1000012136 289
210 3300006847 Ga0075431_100001454 Ga0075431_10000145411 289
211 3300006880 Ga0075429_100002507 Ga0075429_1000025075 289
212 3300009094 Ga0111539_10001135 Ga0111539_1000113515 289
213 3300009147 Ga0114129_10076909 Ga0114129_100769094 289
214 3300014325 Ga0163163_10204168 Ga0163163_102041683 289
215 3300025893 Ga0207682_10129942 Ga0207682_101299422 289
216 3300025925 Ga0207650_10019257 Ga0207650_100192573 289
217 3300025925 Ga0207650_10122748 Ga0207650_101227483 289
218 3300025926 Ga0207659_10002887 Ga0207659_1000288710 289
219 3300025933 Ga0207706_10183703 Ga0207706_101837033 289
220 3300026095 Ga0207676_10019621 Ga0207676_100196212 289
221 3300026121 Ga0207683_10004944 Ga0207683_1000494410 289
222 3300031665 Ga0316575_10015296 Ga0316575_100152964 289
223 3300031911 Ga0307412_10092689 Ga0307412_100926892 289
224 3300035398 Ga0316574_0010958 Ga0316574_0010958_3231_4175 289
225 3300036647 Ga0316582_0142951 Ga0316582_0142951_232_1176 289
226 3300005329 Ga0070683_100012793 Ga0070683_1000127936 290
227 3300005344 Ga0070661_100025127 Ga0070661_1000251273 290
228 3300005367 Ga0070667_100046791 Ga0070667_1000467912 290
229 3300005547 Ga0070693_100081677 Ga0070693_1000816773 290
230 3300009174 Ga0105241_10022727 Ga0105241_100227275 290
231 3300013307 Ga0157372_10032168 Ga0157372_100321682 290
232 3300025321 Ga0207656_10024425 Ga0207656_100244253 290
233 3300025911 Ga0207654_10208269 Ga0207654_102082692 290
234 3300025945 Ga0207679_10002428 Ga0207679_100024286 290
235 3300026035 Ga0207703_10016967 Ga0207703_100169677 290
236 3300026041 Ga0207639_10159709 Ga0207639_101597093 290
237 3300026078 Ga0207702_10013192 Ga0207702_100131926 290
238 3300026142 Ga0207698_10041982 Ga0207698_100419822 290
239 3300045051 Ga0451576_0075815 Ga0451576_0075815_473_1441 290
240 3300048916 Ga0496113_0274887 Ga0496113_0274887_25_993 290
241 3300005330 Ga0070690_100008889 Ga0070690_1000088895 291
242 3300005331 Ga0070670_100076133 Ga0070670_1000761334 291
243 3300005334 Ga0068869_100001748 Ga0068869_1000017484 291
244 3300005335 Ga0070666_10002222 Ga0070666_100022229 291
245 3300005338 Ga0068868_100026324 Ga0068868_1000263242 291
246 3300005344 Ga0070661_100179430 Ga0070661_1001794302 291
247 3300005353 Ga0070669_100001338 Ga0070669_10000133813 291
248 3300005356 Ga0070674_100011127 Ga0070674_1000111275 291
249 3300005367 Ga0070667_100001252 Ga0070667_10000125215 291
250 3300005441 Ga0070700_100124899 Ga0070700_1001248993 291
251 3300005456 Ga0070678_100061140 Ga0070678_1000611404 291
252 3300005544 Ga0070686_100053487 Ga0070686_1000534872 291
253 3300005617 Ga0068859_100143017 Ga0068859_1001430173 291
254 3300005618 Ga0068864_100098119 Ga0068864_1000981192 291
255 3300005718 Ga0068866_10018788 Ga0068866_100187882 291
256 3300005719 Ga0068861_100034834 Ga0068861_1000348343 291
257 3300005834 Ga0068851_10029029 Ga0068851_100290294 291
258 3300005841 Ga0068863_100001027 Ga0068863_10000102714 291
259 3300005842 Ga0068858_100001384 Ga0068858_10000138417 291
260 3300005843 Ga0068860_100001335 Ga0068860_10000133513 291
261 3300005844 Ga0068862_100019417 Ga0068862_1000194175 291
262 3300006931 Ga0097620_100143021 Ga0097620_1001430213 291
263 3300009094 Ga0111539_10651596 Ga0111539_106515961 291
264 3300009148 Ga0105243_10012980 Ga0105243_100129803 291
265 3300009177 Ga0105248_10092366 Ga0105248_100923665 291
266 3300009553 Ga0105249_10013374 Ga0105249_100133746 291
267 3300013306 Ga0163162_10005389 Ga0163162_100053893 291
268 3300013308 Ga0157375_10007311 Ga0157375_100073119 291
269 3300014968 Ga0157379_10032160 Ga0157379_100321603 291
270 3300025899 Ga0207642_10002231 Ga0207642_100022315 291
271 3300025903 Ga0207680_10007990 Ga0207680_100079905 291
272 3300025923 Ga0207681_10000103 Ga0207681_1000010319 291
273 3300025925 Ga0207650_10049078 Ga0207650_100490782 291
274 3300025926 Ga0207659_10016157 Ga0207659_100161573 291
275 3300025933 Ga0207706_10027553 Ga0207706_100275533 291
276 3300025933 Ga0207706_10028083 Ga0207706_100280835 291
277 3300025941 Ga0207711_10113326 Ga0207711_101133264 291
278 3300025941 Ga0207711_10138086 Ga0207711_101380862 291
279 3300025942 Ga0207689_10009879 Ga0207689_100098795 291
280 3300025972 Ga0207668_10022330 Ga0207668_100223304 291
281 3300025986 Ga0207658_10000115 Ga0207658_1000011515 291
282 3300026023 Ga0207677_10015385 Ga0207677_100153855 291
283 3300026035 Ga0207703_10000944 Ga0207703_1000094415 291
284 3300026075 Ga0207708_10026469 Ga0207708_100264695 291
285 3300026088 Ga0207641_10000656 Ga0207641_1000065621 291
286 3300026095 Ga0207676_10040892 Ga0207676_100408924 291
287 3300026118 Ga0207675_100050743 Ga0207675_1000507434 291
288 3300026121 Ga0207683_10057780 Ga0207683_100577802 291
289 3300028380 Ga0268265_10006018 Ga0268265_100060187 291
290 3300028381 Ga0268264_10001008 Ga0268264_1000100816 291
291 3300031731 Ga0307405_10011104 Ga0307405_100111043 291
292 3300031903 Ga0307407_10214352 Ga0307407_102143522 291
293 3300031995 Ga0307409_100001798 Ga0307409_1000017982 291
294 3300032126 Ga0307415_100034430 Ga0307415_1000344302 291
295 3300035170 Ga0373943_0072691 Ga0373943_0072691_263_1246 291
296 3300046533 Ga0495640_0111279 Ga0495640_0111279_238_1215 291
297 3300046543 Ga0495645_0017626 Ga0495645_0017626_3079_4050 291
298 3300046683 Ga0495658_0032741 Ga0495658_0032741_998_1981 291
299 3300025907 Ga0207645_10078095 Ga0207645_100780952 292
300 3300031665 Ga0316575_10002587 Ga0316575_100025876 292
301 3300005937 Ga0081455_10000032 Ga0081455_1000003221 293
302 3300031727 Ga0316576_10066094 Ga0316576_100660942 293
303 3300031727 Ga0316576_10070978 Ga0316576_100709783 293
304 3300035398 Ga0316574_0033178 Ga0316574_0033178_1180_2127 293
305 3300036647 Ga0316582_0176066 Ga0316582_0176066_471_1403 293
306 3300050507 nmdc:mga05p37_135_c1 nmdc:mga05p37_135_c1_16448_17413 293
307 3300050508 nmdc:mga09592_204_c1 nmdc:mga09592_204_c1_6824_7789 293
308 3300050509 nmdc:mga0qj67_507_c1 nmdc:mga0qj67_507_c1_13836_14801 293
309 3300050510 nmdc:mga06r32_96_c1 nmdc:mga06r32_96_c1_18603_19568 293
310 3300031727 Ga0316576_10019377 Ga0316576_100193772 294
311 3300031728 Ga0316578_10090963 Ga0316578_100909632 294
312 3300035398 Ga0316574_0008015 Ga0316574_0008015_4713_5654 294
313 3300005455 Ga0070663_100024312 Ga0070663_1000243123 295
314 3300005548 Ga0070665_100304555 Ga0070665_1003045552 295
315 3300006038 Ga0075365_10179954 Ga0075365_101799542 295
316 3300006237 Ga0097621_100243247 Ga0097621_1002432471 295
317 3300013296 Ga0157374_10335413 Ga0157374_103354131 295
318 3300013308 Ga0157375_10140485 Ga0157375_101404852 295
319 3300025940 Ga0207691_10069347 Ga0207691_100693472 295
320 3300026041 Ga0207639_10192419 Ga0207639_101924193 295
321 3300026121 Ga0207683_10139711 Ga0207683_101397111 295
322 3300026142 Ga0207698_10114562 Ga0207698_101145622 295
323 3300031665 Ga0316575_10098284 Ga0316575_100982841 295
324 3300031691 Ga0316579_10006265 Ga0316579_100062652 295
325 3300031728 Ga0316578_10058463 Ga0316578_100584632 295
326 3300031733 Ga0316577_10039258 Ga0316577_100392582 295
327 3300032133 Ga0316583_10011116 Ga0316583_100111165 295
328 3300032137 Ga0316585_10022979 Ga0316585_100229791 295
329 3300032139 Ga0316580_10008612 Ga0316580_100086124 295
330 3300035398 Ga0316574_0005449 Ga0316574_0005449_49_981 295
331 3300050492 nmdc:mga0yw44_159238_c1 nmdc:mga0yw44_159238_c1_314_1267 295
332 3300014968 Ga0157379_10162115 Ga0157379_101621153 296
333 3300025940 Ga0207691_10182183 Ga0207691_101821833 296
334 3300031733 Ga0316577_10248935 Ga0316577_102489351 296
335 3300036647 Ga0316582_0102044 Ga0316582_0102044_921_1865 296
336 3300036712 Ga0316584_0097996 Ga0316584_0097996_412_1356 296
337 3300045051 Ga0451576_0027133 Ga0451576_0027133_4600_5589 296
338 3300048917 Ga0496114_0022175 Ga0496114_0022175_2358_3341 296
339 3300046471 Ga0495650_0007004 Ga0495650_0007004_1960_2907 297
340 3300005530 Ga0070679_100294897 Ga0070679_1002948972 298
341 3300005563 Ga0068855_100006843 Ga0068855_10000684311 298
342 3300005614 Ga0068856_100026018 Ga0068856_1000260186 298
343 3300009093 Ga0105240_10176441 Ga0105240_101764413 298
344 3300025913 Ga0207695_10036069 Ga0207695_100360693 298
345 3300025921 Ga0207652_10092903 Ga0207652_100929032 298
346 3300025949 Ga0207667_10003206 Ga0207667_100032068 298
347 3300026078 Ga0207702_10015302 Ga0207702_100153026 298
348 3300031727 Ga0316576_10024120 Ga0316576_100241206 298
349 3300033541 Ga0316596_1025763 Ga0316596_10257632 298
350 3300035398 Ga0316574_0091495 Ga0316574_0091495_791_1735 298
351 3300035398 Ga0316574_0102284 Ga0316574_0102284_659_1618 298
352 3300050507 nmdc:mga05p37_18037_c1 nmdc:mga05p37_18037_c1_6138_7106 298
353 3300050508 nmdc:mga09592_13735_c1 nmdc:mga09592_13735_c1_1885_2853 298
354 3300050510 nmdc:mga06r32_3_c1 nmdc:mga06r32_3_c1_3622_4590 298
355 3300050511 nmdc:mga08y16_13179_c1 nmdc:mga08y16_13179_c1_4898_5866 298
356 3300053092 Ga0500583_0106299 Ga0500583_0106299_114_1067 298
357 3300053124 Ga0500617_075075 Ga0500617_075075_199_1152 298
358 3300053146 Ga0500588_0004235 Ga0500588_0004235_2026_2979 298
359 3300009094 Ga0111539_10019168 Ga0111539_100191684 299
360 3300013308 Ga0157375_10011126 Ga0157375_100111267 299
361 3300027907 Ga0207428_10066288 Ga0207428_100662883 299
362 3300031852 Ga0307410_10154037 Ga0307410_101540371 299
363 3300047320 Ga0495672_0104727 Ga0495672_0104727_553_1503 299
364 3300048913 Ga0496110_0552692 Ga0496110_0552692_25_975 299
365 3300048917 Ga0496114_0134177 Ga0496114_0134177_15_965 299
366 3300050511 nmdc:mga08y16_25133_c1 nmdc:mga08y16_25133_c1_1018_1989 299
367 3300032002 Ga0307416_100077656 Ga0307416_1000776562 300
368 3300009093 Ga0105240_10218465 Ga0105240_102184652 301
369 3300006844 Ga0075428_100004004 Ga0075428_10000400413 302
370 3300006846 Ga0075430_100000626 Ga0075430_10000062611 302
371 3300006847 Ga0075431_100003248 Ga0075431_1000032485 302
372 3300006880 Ga0075429_100001409 Ga0075429_1000014095 302
373 3300009147 Ga0114129_10000072 Ga0114129_1000007272 302
374 3300031548 Ga0307408_100179438 Ga0307408_1001794382 302
375 3300003203 JGI25406J46586_10001253 JGI25406J46586_100012539 306
376 3300005985 Ga0081539_10000007 Ga0081539_10000007356 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

17

78

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

156

310

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ucs-assembly1.cif.gz_D crystal structure of the complex between cbpa j-domain and cbpm 0.9642 3 70
6byr-assembly1.cif.gz_A structures of the pka ri alpha holoenzyme with the flhcc driver j-pkac alpha or native pkac alpha 0.9484 3 71
8glv-assembly1.cif.gz_In 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.9464 5 67
3ucs-assembly1.cif.gz_C crystal structure of the complex between cbpa j-domain and cbpm 0.9454 1 73
8fe2-assembly2.cif.gz_B structure of j-pkac chimera complexed with aplithianine a 0.9437 5 71
ID Description Score Start End Superfamily
af_A4I249_279_389_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9838 5 67 1.10.287.110
4wb7A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9756 3 58 1.10.287.110
af_P36659_200_276_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9715 203 278 2.60.260.20
af_P46997_4_92_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9708 6 71 1.10.287.110
4wb7B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9708 3 58 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A7Y1XJL3-F1-model_v4 DnaJ domain-containing protein 0.9886 1 69 GO:0036503
GO:0051087
GO:0051787
AF-J4CC58-F1-model_v4 Molecular chaperone 0.9799 4 71 GO:0005737
GO:0016020
GO:0042026
GO:0051082
GO:0051085
AF-T0ZXU1-F1-model_v4 Heat shock protein DnaJ domain-containing protein 0.9715 181 301 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A7Y1XJL3-F1-model_v4 DnaJ domain-containing protein 0.961 1 69 GO:0036503
GO:0051087
GO:0051787
AF-A0A1B6LC45-F1-model_v4 J domain-containing protein 0.9586 4 71 GO:0012505
GO:0016020

Feature Viewer

pLDDT pTM Quality
81.34 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map