F427302

General Info

Members Datasets Scaffolds Average Seq Length
376 194 752 199

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100064845|Ga0075363_1000648453
Length 226
Sequence LSPDERLGRLARERMIVSIPGRSWPNRLMSGTDPVVTLRPVRRGDARAWRDARRRNAAWLSQWDATVPPGGDARPTTFKALVRRLSRAARQGTTFPFVIEVDGAFAGQVSINNIVRGSAQFASVGYWIDQQYAGRGVMPRAVAMAADHCFFTAKLHRLEICIRPENTNSLRVVEKLGLREIGYAPRFLHIDGEWRDHRIFAVTKEEAPRGLLARLEESGGDASAGR

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
105 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
106 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
107 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2643221561 Nocardioides sp. Root151 Isolate Unclassified
177 2643221576 Nocardioides sp. Root614 Isolate Unclassified
178 2643221590 Nocardioides sp. Root682 Isolate Unclassified
179 2643221604 Nocardioides sp. Root190 Isolate Unclassified
180 2643221615 Nocardioides sp. Root224 Isolate Unclassified
181 2643221617 Nocardioides sp. Root79 Isolate Unclassified
182 2643221620 Nocardioides sp. Root240 Isolate Unclassified
183 2643221641 Nocardioides sp. Root122 Isolate Unclassified
184 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
185 2643221696 Nocardioides sp. Root140 Isolate Unclassified
186 2738541305 Nocardioides sp. CF167 Isolate Unclassified
187 2739367898 Nocardioides sp. CF479 Isolate Unclassified
188 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
189 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
190 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
191 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
192 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
193 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
194 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.68
Metatranscriptomes 0.27
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 7.18
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100064845 3300006048 Bacteria 1974
2 LJQas_1011842 3300000549 Bacteria 1035
3 JGI24740J21852_10044252 3300001979 Bacteria 1322
4 JGI24735J21928_10063608 3300002067 Bacteria 1059
5 Ga0070658_10033770 3300005327 Bacteria 4116
6 Ga0070658_10127187 3300005327 Bacteria 2121
7 Ga0070683_100026991 3300005329 Bacteria 5176
8 Ga0070683_100089745 3300005329 Bacteria 2885
9 Ga0070690_100161197 3300005330 Bacteria 1537
10 Ga0068869_100021880 3300005334 Bacteria 4401
11 Ga0070682_100049184 3300005337 Bacteria 2628
12 Ga0070682_100400603 3300005337 Bacteria 1038
13 Ga0070660_100165290 3300005339 Bacteria 1785
14 Ga0070660_100217396 3300005339 Bacteria 1553
15 Ga0070687_100246165 3300005343 Bacteria 1108
16 Ga0070692_10074089 3300005345 Bacteria 1820
17 Ga0070668_101004149 3300005347 Bacteria 750
18 Ga0070659_100028152 3300005366 Bacteria 4337
19 Ga0070659_100034449 3300005366 Bacteria 3939
20 Ga0070701_10282621 3300005438 Bacteria 1014
21 Ga0070705_100733913 3300005440 Bacteria 779
22 Ga0070700_100019598 3300005441 Bacteria 3906
23 Ga0070678_100550199 3300005456 Bacteria 1024
24 Ga0070681_10368849 3300005458 Bacteria 1346
25 Ga0070681_11327703 3300005458 Bacteria 642
26 Ga0070685_10406229 3300005466 Bacteria 944
27 Ga0070679_100104194 3300005530 Bacteria 2823
28 Ga0070684_100007783 3300005535 Bacteria 8356
29 Ga0070684_100314945 3300005535 Bacteria 1437
30 Ga0070672_100324740 3300005543 Bacteria 1308
31 Ga0070693_100134749 3300005547 Bacteria 1548
32 Ga0070665_100001294 3300005548 Bacteria 29946
33 Ga0068855_100853017 3300005563 Bacteria 965
34 Ga0068856_100234081 3300005614 Bacteria 1852
35 Ga0068856_100240410 3300005614 Bacteria 1826
36 Ga0070702_100621280 3300005615 Bacteria 813
37 Ga0068864_100205068 3300005618 Bacteria 1813
38 Ga0068864_100473674 3300005618 Bacteria 1201
39 Ga0068864_100604153 3300005618 Bacteria 1065
40 Ga0068870_10127490 3300005840 Bacteria 1474
41 Ga0068870_10264957 3300005840 Bacteria 1071
42 Ga0068863_100237734 3300005841 Bacteria 1758
43 Ga0068858_100586408 3300005842 Bacteria 1081
44 Ga0068860_100526266 3300005843 Bacteria 1183
45 Ga0075365_10015933 3300006038 Bacteria 4558
46 Ga0075365_10045593 3300006038 Bacteria 2877
47 Ga0075367_10029508 3300006178 Bacteria 3138
48 Ga0075367_10343281 3300006178 Bacteria 942
49 Ga0075434_101462055 3300006871 Bacteria 693
50 Ga0068865_100126472 3300006881 Bacteria 1908
51 Ga0105245_10005158 3300009098 Bacteria 11479
52 Ga0105245_10335294 3300009098 Bacteria 1494
53 Ga0105245_10745248 3300009098 Bacteria 1015
54 Ga0105245_10812740 3300009098 Bacteria 973
55 Ga0105243_10233032 3300009148 Bacteria 1634
56 Ga0105243_10366091 3300009148 Bacteria 1329
57 Ga0105237_10139301 3300009545 Bacteria 2420
58 Ga0105238_10236203 3300009551 Bacteria 1805
59 Ga0105238_10448398 3300009551 Bacteria 1287
60 Ga0105249_10067624 3300009553 Bacteria 3293
61 Ga0105249_10519276 3300009553 Bacteria 1238
62 Ga0105249_10557122 3300009553 Bacteria 1197
63 Ga0105249_10839599 3300009553 Bacteria 984
64 Ga0105239_10041653 3300010375 Bacteria 5032
65 Ga0105239_10921342 3300010375 Bacteria 1003
66 Ga0105246_10152321 3300011119 Bacteria 1751
67 Ga0157369_10064875 3300013105 Bacteria 3932
68 Ga0157374_11689077 3300013296 Bacteria 658
69 Ga0163162_10041146 3300013306 Bacteria 4623
70 Ga0163162_10666782 3300013306 Bacteria 1163
71 Ga0163162_11392917 3300013306 Bacteria 798
72 Ga0157372_10009899 3300013307 Bacteria 10139
73 Ga0157372_11313140 3300013307 Bacteria 835
74 Ga0157375_10010740 3300013308 Bacteria 8070
75 Ga0157375_10144729 3300013308 Bacteria 2507
76 Ga0157375_10638060 3300013308 Bacteria 1222
77 Ga0157375_10906989 3300013308 Bacteria 1025
78 Ga0163163_10026886 3300014325 Bacteria 5505
79 Ga0163163_10075350 3300014325 Bacteria 3368
80 Ga0163163_10116832 3300014325 Bacteria 2699
81 Ga0157380_10202754 3300014326 Bacteria 1761
82 Ga0157380_10642971 3300014326 Bacteria 1057
83 Ga0157380_10943463 3300014326 Bacteria 892
84 Ga0157377_10086955 3300014745 Bacteria 1838
85 Ga0157379_10131173 3300014968 Bacteria 2256
86 Ga0157379_10341614 3300014968 Bacteria 1369
87 Ga0163161_10081809 3300017792 Bacteria 2379
88 Ga0206353_10948642 3300020082 Bacteria 2345
89 Ga0207642_10045083 3300025899 Bacteria 1956
90 Ga0207688_10490478 3300025901 Bacteria 769
91 Ga0207647_10015524 3300025904 Bacteria 5217
92 Ga0207647_10028523 3300025904 Bacteria 3623
93 Ga0207705_10166992 3300025909 Bacteria 1655
94 Ga0207705_10191993 3300025909 Bacteria 1545
95 Ga0207705_10314519 3300025909 Bacteria 1202
96 Ga0207707_11066883 3300025912 Bacteria 660
97 Ga0207671_10101469 3300025914 Unclassified 2180
98 Ga0207662_10154401 3300025918 Bacteria 1462
99 Ga0207662_10254588 3300025918 Bacteria 1154
100 Ga0207657_10107581 3300025919 Bacteria 2307
101 Ga0207657_10154989 3300025919 Bacteria 1863
102 Ga0207657_10178849 3300025919 Bacteria 1715
103 Ga0207652_10056093 3300025921 Bacteria 3391
104 Ga0207652_10691096 3300025921 Bacteria 911
105 Ga0207687_10012105 3300025927 Bacteria 5642
106 Ga0207687_10228363 3300025927 Bacteria 1469
107 Ga0207690_10011827 3300025932 Bacteria 5219
108 Ga0207690_10152439 3300025932 Bacteria 1714
109 Ga0207706_10706739 3300025933 Bacteria 861
110 Ga0207709_10104271 3300025935 Bacteria 1881
111 Ga0207704_10131122 3300025938 Bacteria 1736
112 Ga0207691_10080768 3300025940 Bacteria 2924
113 Ga0207691_10864474 3300025940 Bacteria 758
114 Ga0207689_10059612 3300025942 Bacteria 3139
115 Ga0207661_10096198 3300025944 Bacteria 2477
116 Ga0207661_10117251 3300025944 Bacteria 2261
117 Ga0207661_10365818 3300025944 Bacteria 1303
118 Ga0207667_10665701 3300025949 Bacteria 1045
119 Ga0207712_10116124 3300025961 Bacteria 2016
120 Ga0207712_10162415 3300025961 Bacteria 1738
121 Ga0207668_10143803 3300025972 Bacteria 1838
122 Ga0207668_10787215 3300025972 Bacteria 841
123 Ga0207658_10065736 3300025986 Bacteria 2725
124 Ga0207658_10134842 3300025986 Bacteria 1989
125 Ga0207703_10539832 3300026035 Bacteria 1099
126 Ga0207639_10271249 3300026041 Bacteria 1488
127 Ga0207708_10006114 3300026075 Bacteria 8926
128 Ga0207702_10016612 3300026078 Bacteria 6091
129 Ga0207702_10345268 3300026078 Bacteria 1423
130 Ga0207641_10200644 3300026088 Bacteria 1839
131 Ga0207676_10473199 3300026095 Bacteria 1185
132 Ga0207674_10011985 3300026116 Bacteria 9716
133 Ga0207675_100007118 3300026118 Bacteria 10573
134 Ga0207675_100114320 3300026118 Bacteria 2549
135 Ga0207683_10028535 3300026121 Bacteria 4825
136 Ga0268266_10001059 3300028379 Bacteria 34495
137 Ga0268266_10675476 3300028379 Bacteria 995
138 Ga0268265_10816714 3300028380 Bacteria 910
139 Ga0307405_10044265 3300031731 Bacteria 2722
140 Ga0307405_10378138 3300031731 Bacteria 1102
141 Ga0307405_10901597 3300031731 Bacteria 748
142 Ga0307413_10532038 3300031824 Bacteria 950
143 Ga0307410_10185656 3300031852 Bacteria 1578
144 Ga0307410_10619386 3300031852 Bacteria 905
145 Ga0307407_10113545 3300031903 Bacteria 1705
146 Ga0307407_10278182 3300031903 Bacteria 1158
147 Ga0307412_10033758 3300031911 Bacteria 3255
148 Ga0307409_100064335 3300031995 Bacteria 2881
149 Ga0307409_100812184 3300031995 Bacteria 943
150 Ga0307416_100026382 3300032002 Bacteria 4280
151 Ga0307416_100125589 3300032002 Bacteria 2298
152 Ga0307415_100001428 3300032126 Bacteria 11416
153 Ga0307415_100328498 3300032126 Bacteria 1278
154 Ga0307415_100594395 3300032126 Bacteria 984
155 Ga0395900_0356170 3300037418 Bacteria 1436
156 Ga0395898_0266805 3300037466 Bacteria 1633
157 Ga0395898_0686424 3300037466 Bacteria 966
158 Ga0395905_0140895 3300037471 Bacteria 2268
159 Ga0395905_1009980 3300037471 Bacteria 735
160 Ga0395901_0055482 3300038443 Bacteria 4121
161 Ga0436365_1234983 3300039437 Bacteria 2027
162 Ga0439447_034083 3300041407 Bacteria 1267
163 Ga0439465_0067039 3300041413 Bacteria 1197
164 Ga0451793_1151039 3300041452 Bacteria 1637
165 Ga0451841_0719786 3300041498 Bacteria 838
166 Ga0439431_0008606 3300041997 Bacteria 2297
167 Ga0439442_027463 3300042002 Bacteria 1186
168 Ga0450906_024546 3300042145 Bacteria 1071
169 Ga0439446_0033845 3300042156 Bacteria 1485
170 Ga0439434_0003982 3300042435 Bacteria 4312
171 Ga0466972_0039054 3300044658 Bacteria 2318
172 Ga0466972_0073788 3300044658 Bacteria 1626
173 Ga0466972_0126919 3300044658 Bacteria 1202
174 Ga0466972_0132772 3300044658 Bacteria 1172
175 Ga0466965_0004601 3300044683 Bacteria 6142
176 Ga0466965_0017085 3300044683 Bacteria 3463
177 Ga0466965_0130250 3300044683 Bacteria 1304
178 Ga0466965_0156514 3300044683 Bacteria 1193
179 Ga0466966_0019851 3300044684 Bacteria 4420
180 Ga0466966_0170477 3300044684 Bacteria 1323
181 Ga0466966_0186208 3300044684 Bacteria 1258
182 Ga0466966_0327226 3300044684 Bacteria 921
183 Ga0466961_0180591 3300044693 Bacteria 1310
184 Ga0466961_0256666 3300044693 Bacteria 1072
185 Ga0466963_0079897 3300044694 Bacteria 2213
186 Ga0466963_0085649 3300044694 Bacteria 2140
187 Ga0466963_0107921 3300044694 Bacteria 1909
188 Ga0466963_0172313 3300044694 Bacteria 1509
189 Ga0466963_0393349 3300044694 Bacteria 977
190 Ga0466971_0007449 3300044719 Bacteria 4768
191 Ga0466971_0039892 3300044719 Bacteria 2108
192 Ga0466971_0063041 3300044719 Bacteria 1678
193 Ga0466968_0085951 3300044735 Bacteria 1388
194 Ga0466970_0010617 3300044765 Bacteria 4677
195 Ga0466970_0049014 3300044765 Bacteria 2253
196 Ga0466970_0078492 3300044765 Bacteria 1781
197 Ga0466970_0253452 3300044765 Bacteria 986
198 Ga0466970_0565568 3300044765 Bacteria 658
199 Ga0466957_0083179 3300044842 Bacteria 1996
200 Ga0466957_0269018 3300044842 Bacteria 1137
201 Ga0466957_0295647 3300044842 Bacteria 1087
202 Ga0466957_0448799 3300044842 Bacteria 888
203 Ga0466960_0011774 3300044901 Bacteria 3673
204 Ga0466960_0031786 3300044901 Bacteria 2438
205 Ga0466960_0101935 3300044901 Bacteria 1479
206 Ga0466960_0148359 3300044901 Bacteria 1251
207 Ga0466958_0010214 3300045836 Bacteria 5251
208 Ga0466958_0218017 3300045836 Bacteria 1217
209 Ga0466967_0012616 3300045976 Bacteria 6477
210 Ga0466967_0042088 3300045976 Bacteria 3945
211 Ga0466967_0058814 3300045976 Bacteria 3399
212 Ga0466967_0064936 3300045976 Bacteria 3247
213 Ga0466967_0163547 3300045976 Bacteria 2090
214 Ga0466967_0186374 3300045976 Bacteria 1959
215 Ga0466967_0186994 3300045976 Bacteria 1956
216 Ga0466967_0216507 3300045976 Bacteria 1818
217 Ga0466967_0319661 3300045976 Bacteria 1496
218 Ga0466967_0371293 3300045976 Bacteria 1387
219 Ga0466967_1637501 3300045976 Bacteria 641
220 Ga0495603_0018026 3300046455 Bacteria 4272
221 Ga0495582_0267883 3300046473 Bacteria 980
222 Ga0495658_0081699 3300046683 Bacteria 1898
223 Ga0496100_0170704 3300048903 Bacteria 1566
224 Ga0496100_0391661 3300048903 Bacteria 1057
225 Ga0496101_0289435 3300048904 Bacteria 1281
226 Ga0496102_0062029 3300048905 Bacteria 3423
227 Ga0496102_0231251 3300048905 Bacteria 1743
228 Ga0496102_0571659 3300048905 Bacteria 1053
229 Ga0496103_0020750 3300048906 Bacteria 3950
230 Ga0496103_0172528 3300048906 Bacteria 1389
231 Ga0496103_0345908 3300048906 Bacteria 956
232 Ga0496104_0018459 3300048907 Bacteria 6363
233 Ga0496104_0150317 3300048907 Bacteria 2236
234 Ga0496106_0034534 3300048909 Bacteria 3778
235 Ga0496106_0273315 3300048909 Bacteria 1353
236 Ga0496107_0017214 3300048910 Bacteria 5084
237 Ga0496107_0209331 3300048910 Bacteria 1450
238 Ga0496107_0362377 3300048910 Bacteria 1079
239 Ga0496107_0420214 3300048910 Bacteria 994
240 Ga0496109_0035628 3300048912 Bacteria 4490
241 Ga0496109_0070063 3300048912 Bacteria 3217
242 Ga0496109_0696708 3300048912 Bacteria 953
243 Ga0496110_0340665 3300048913 Bacteria 1366
244 Ga0496111_0013490 3300048914 Bacteria 5563
245 Ga0496111_0137275 3300048914 Bacteria 1812
246 Ga0496114_0062609 3300048917 Bacteria 3114
247 Ga0496114_0129801 3300048917 Bacteria 2175
248 Ga0496115_0422953 3300048918 Bacteria 1079
249 Ga0501031_0004544 3300049568 Bacteria 8996
250 Ga0501031_0114365 3300049568 Bacteria 1762
251 Ga0501032_0007594 3300049569 Bacteria 7913
252 Ga0501032_0183521 3300049569 Bacteria 1369
253 Ga0501033_0007864 3300049570 Bacteria 8262
254 Ga0501033_0193265 3300049570 Bacteria 1456
255 Ga0501033_0395641 3300049570 Bacteria 964
256 Ga0501034_0006864 3300049571 Bacteria 12176
257 Ga0501034_0058824 3300049571 Bacteria 3861
258 Ga0501034_0068951 3300049571 Bacteria 3547
259 Ga0501034_0740516 3300049571 Bacteria 879
260 Ga0501034_0808638 3300049571 Bacteria 830
261 Ga0501036_0012751 3300049572 Bacteria 6973
262 Ga0501036_0106051 3300049572 Bacteria 2376
263 Ga0501036_0174124 3300049572 Bacteria 1812
264 Ga0501037_0004316 3300049573 Bacteria 10312
265 Ga0501037_0022081 3300049573 Bacteria 4710
266 Ga0501037_0083376 3300049573 Bacteria 2316
267 Ga0501037_0085951 3300049573 Bacteria 2277
268 Ga0501038_0009746 3300049574 Bacteria 8807
269 Ga0501038_0015953 3300049574 Bacteria 6827
270 Ga0501038_0094943 3300049574 Bacteria 2492
271 Ga0501038_0397895 3300049574 Bacteria 1066
272 Ga0501039_0001126 3300049575 Bacteria 19670
273 Ga0501039_0058159 3300049575 Bacteria 2994
274 Ga0501039_0061545 3300049575 Bacteria 2907
275 Ga0501039_0206404 3300049575 Bacteria 1545
276 Ga0501039_0394236 3300049575 Bacteria 1087
277 Ga0501040_0097808 3300049576 Bacteria 2045
278 Ga0501040_0695971 3300049576 Bacteria 735
279 Ga0501041_0022441 3300049577 Bacteria 3779
280 Ga0501042_0003218 3300049578 Bacteria 10204
281 Ga0501042_0009337 3300049578 Bacteria 6533
282 Ga0501042_0102504 3300049578 Bacteria 2059
283 Ga0501042_0111832 3300049578 Bacteria 1967
284 Ga0501042_0224305 3300049578 Bacteria 1355
285 Ga0501042_0250206 3300049578 Bacteria 1279
286 Ga0501042_0379078 3300049578 Bacteria 1024
287 Ga0501043_0103773 3300049579 Bacteria 2234
288 Ga0501043_0133738 3300049579 Bacteria 1943
289 Ga0501046_0000508 3300049580 Bacteria 38646
290 Ga0501046_0014878 3300049580 Bacteria 6548
291 Ga0501046_0117067 3300049580 Bacteria 2030
292 Ga0501047_0050530 3300049581 Bacteria 4016
293 Ga0501047_0181595 3300049581 Bacteria 1970
294 Ga0501047_0225697 3300049581 Bacteria 1728
295 Ga0501048_0001793 3300049582 Bacteria 16318
296 Ga0501048_0056726 3300049582 Bacteria 2778
297 Ga0501048_0279472 3300049582 Bacteria 1187
298 Ga0501048_0391582 3300049582 Bacteria 993
299 Ga0501067_0000956 3300049583 Bacteria 15478
300 Ga0501067_0006282 3300049583 Bacteria 6590
301 Ga0501067_0221151 3300049583 Bacteria 1055
302 Ga0501068_0009207 3300049584 Bacteria 5518
303 Ga0501068_0403739 3300049584 Bacteria 881
304 Ga0501070_0018991 3300049586 Bacteria 5765
305 Ga0501070_0061316 3300049586 Bacteria 3116
306 Ga0501070_0099565 3300049586 Bacteria 2405
307 Ga0501070_0257967 3300049586 Bacteria 1425
308 Ga0501071_0006177 3300049587 Bacteria 7767
309 Ga0501071_0031560 3300049587 Bacteria 3756
310 Ga0501071_0089826 3300049587 Bacteria 2255
311 Ga0501071_0130185 3300049587 Bacteria 1869
312 Ga0501071_0387516 3300049587 Bacteria 1066
313 Ga0501072_0004451 3300049588 Bacteria 10643
314 Ga0501072_0144306 3300049588 Bacteria 1898
315 Ga0501072_0164411 3300049588 Bacteria 1770
316 Ga0501072_0284085 3300049588 Bacteria 1316
317 Ga0501072_0514149 3300049588 Bacteria 947
318 Ga0501073_0035886 3300049589 Bacteria 3522
319 Ga0501073_0039309 3300049589 Bacteria 3351
320 Ga0501073_0088965 3300049589 Bacteria 2147
321 Ga0501073_0266819 3300049589 Bacteria 1181
322 Ga0501074_0003804 3300049590 Bacteria 10731
323 Ga0501074_0028141 3300049590 Bacteria 4073
324 Ga0501076_0047313 3300049592 Bacteria 3400
325 Ga0501077_0035549 3300049593 Bacteria 3172
326 Ga0501077_0047234 3300049593 Bacteria 2735
327 Ga0501079_0042941 3300049741 Bacteria 3490
328 Ga0501079_0098497 3300049741 Bacteria 2266
329 Ga0501080_0007872 3300049742 Bacteria 9645
330 Ga0501080_0087942 3300049742 Bacteria 2886
331 Ga0501081_0176017 3300049743 Bacteria 1546
332 Ga0501083_0001725 3300049744 Bacteria 14895
333 Ga0501083_0097656 3300049744 Bacteria 1938
334 Ga0501035_0005416 3300049822 Bacteria 12065
335 Ga0501035_0114646 3300049822 Bacteria 2359
336 Ga0501035_0266370 3300049822 Bacteria 1451
337 Ga0501035_0277272 3300049822 Bacteria 1418
338 Ga0501044_0092195 3300049823 Bacteria 3055
339 Ga0501044_0106300 3300049823 Bacteria 2818
340 Ga0501044_0578625 3300049823 Bacteria 1018
341 Ga0501045_0035699 3300049824 Bacteria 3610
342 Ga0501045_0064967 3300049824 Bacteria 2679
343 Ga0501045_0210817 3300049824 Bacteria 1447
344 nmdc:mga03n38_229716_c1 3300050490 Bacteria 972
345 nmdc:mga0yw44_28869_c1 3300050492 Bacteria 3196
346 nmdc:mga0yw44_288700_c1 3300050492 Bacteria 1097
347 nmdc:mga0yw44_56297_c1 3300050492 Bacteria 2395
348 nmdc:mga06z11_58710_c1 3300050494 Bacteria 1997
349 nmdc:mga04h51_14532_c1 3300050495 Bacteria 2251
350 nmdc:mga0n895_1261907_c1 3300050512 Bacteria 711
351 Ga0501084_0195335 3300054114 Bacteria 1707
352 Ga0501084_0327610 3300054114 Bacteria 1294
353 Ga0501084_0496476 3300054114 Bacteria 1031
354 Ga0501082_0055615 3300060353 Bacteria 3408
355 Ga0501082_0111968 3300060353 Bacteria 2363
356 Ga0501082_0879997 3300060353 Bacteria 784
357 Ga0530510_0039594 3300061734 Bacteria 3403
358 2643827453 2643221561 Bacteria 4984412
359 2643892072 2643221576 Bacteria 5214352
360 2643961124 2643221590 Bacteria 5214697
361 2644031830 2643221604 Bacteria 5014917
362 2644094087 2643221615 Bacteria 5487866
363 2644099800 2643221617 Bacteria 5139111
364 2644117406 2643221620 Bacteria 5134593
365 2644228584 2643221641 Bacteria 4490190
366 2644323930 2643221657 Bacteria 5490246
367 2644533719 2643221696 Bacteria 5431823
368 2738870737 2738541305 Bacteria 4910150
369 2740166058 2739367898 Bacteria 4367674
370 2774394789 2773857762 Bacteria 5971770
371 2784472989 2784132109 Bacteria 3141763
372 2809194349 2808606439 Bacteria 5952208
373 2812334648 2811994874 Bacteria 5367947
374 2812349112 2811994878 Bacteria 5992952
375 2819667178 2818991458 Bacteria 4794049
376 2891973137 2891968417 Bacteria 5821697
377 Ga0075363_100064845
378 LJQas_1011842
379 JGI24740J21852_10044252
380 JGI24735J21928_10063608
381 Ga0070658_10033770
382 Ga0070658_10127187
383 Ga0070683_100026991
384 Ga0070683_100089745
385 Ga0070690_100161197
386 Ga0068869_100021880
387 Ga0070682_100049184
388 Ga0070682_100400603
389 Ga0070660_100165290
390 Ga0070660_100217396
391 Ga0070687_100246165
392 Ga0070692_10074089
393 Ga0070668_101004149
394 Ga0070659_100028152
395 Ga0070659_100034449
396 Ga0070701_10282621
397 Ga0070705_100733913
398 Ga0070700_100019598
399 Ga0070678_100550199
400 Ga0070681_10368849
401 Ga0070681_11327703
402 Ga0070685_10406229
403 Ga0070679_100104194
404 Ga0070684_100007783
405 Ga0070684_100314945
406 Ga0070672_100324740
407 Ga0070693_100134749
408 Ga0070665_100001294
409 Ga0068855_100853017
410 Ga0068856_100234081
411 Ga0068856_100240410
412 Ga0070702_100621280
413 Ga0068864_100205068
414 Ga0068864_100473674
415 Ga0068864_100604153
416 Ga0068870_10127490
417 Ga0068870_10264957
418 Ga0068863_100237734
419 Ga0068858_100586408
420 Ga0068860_100526266
421 Ga0075365_10015933
422 Ga0075365_10045593
423 Ga0075367_10029508
424 Ga0075367_10343281
425 Ga0075434_101462055
426 Ga0068865_100126472
427 Ga0105245_10005158
428 Ga0105245_10335294
429 Ga0105245_10745248
430 Ga0105245_10812740
431 Ga0105243_10233032
432 Ga0105243_10366091
433 Ga0105237_10139301
434 Ga0105238_10236203
435 Ga0105238_10448398
436 Ga0105249_10067624
437 Ga0105249_10519276
438 Ga0105249_10557122
439 Ga0105249_10839599
440 Ga0105239_10041653
441 Ga0105239_10921342
442 Ga0105246_10152321
443 Ga0157369_10064875
444 Ga0157374_11689077
445 Ga0163162_10041146
446 Ga0163162_10666782
447 Ga0163162_11392917
448 Ga0157372_10009899
449 Ga0157372_11313140
450 Ga0157375_10010740
451 Ga0157375_10144729
452 Ga0157375_10638060
453 Ga0157375_10906989
454 Ga0163163_10026886
455 Ga0163163_10075350
456 Ga0163163_10116832
457 Ga0157380_10202754
458 Ga0157380_10642971
459 Ga0157380_10943463
460 Ga0157377_10086955
461 Ga0157379_10131173
462 Ga0157379_10341614
463 Ga0163161_10081809
464 Ga0206353_10948642
465 Ga0207642_10045083
466 Ga0207688_10490478
467 Ga0207647_10015524
468 Ga0207647_10028523
469 Ga0207705_10166992
470 Ga0207705_10191993
471 Ga0207705_10314519
472 Ga0207707_11066883
473 Ga0207671_10101469
474 Ga0207662_10154401
475 Ga0207662_10254588
476 Ga0207657_10107581
477 Ga0207657_10154989
478 Ga0207657_10178849
479 Ga0207652_10056093
480 Ga0207652_10691096
481 Ga0207687_10012105
482 Ga0207687_10228363
483 Ga0207690_10011827
484 Ga0207690_10152439
485 Ga0207706_10706739
486 Ga0207709_10104271
487 Ga0207704_10131122
488 Ga0207691_10080768
489 Ga0207691_10864474
490 Ga0207689_10059612
491 Ga0207661_10096198
492 Ga0207661_10117251
493 Ga0207661_10365818
494 Ga0207667_10665701
495 Ga0207712_10116124
496 Ga0207712_10162415
497 Ga0207668_10143803
498 Ga0207668_10787215
499 Ga0207658_10065736
500 Ga0207658_10134842
501 Ga0207703_10539832
502 Ga0207639_10271249
503 Ga0207708_10006114
504 Ga0207702_10016612
505 Ga0207702_10345268
506 Ga0207641_10200644
507 Ga0207676_10473199
508 Ga0207674_10011985
509 Ga0207675_100007118
510 Ga0207675_100114320
511 Ga0207683_10028535
512 Ga0268266_10001059
513 Ga0268266_10675476
514 Ga0268265_10816714
515 Ga0307405_10044265
516 Ga0307405_10378138
517 Ga0307405_10901597
518 Ga0307413_10532038
519 Ga0307410_10185656
520 Ga0307410_10619386
521 Ga0307407_10113545
522 Ga0307407_10278182
523 Ga0307412_10033758
524 Ga0307409_100064335
525 Ga0307409_100812184
526 Ga0307416_100026382
527 Ga0307416_100125589
528 Ga0307415_100001428
529 Ga0307415_100328498
530 Ga0307415_100594395
531 Ga0395900_0356170
532 Ga0395898_0266805
533 Ga0395898_0686424
534 Ga0395905_0140895
535 Ga0395905_1009980
536 Ga0395901_0055482
537 Ga0436365_1234983
538 Ga0439447_034083
539 Ga0439465_0067039
540 Ga0451793_1151039
541 Ga0451841_0719786
542 Ga0439431_0008606
543 Ga0439442_027463
544 Ga0450906_024546
545 Ga0439446_0033845
546 Ga0439434_0003982
547 Ga0466972_0039054
548 Ga0466972_0073788
549 Ga0466972_0126919
550 Ga0466972_0132772
551 Ga0466965_0004601
552 Ga0466965_0017085
553 Ga0466965_0130250
554 Ga0466965_0156514
555 Ga0466966_0019851
556 Ga0466966_0170477
557 Ga0466966_0186208
558 Ga0466966_0327226
559 Ga0466961_0180591
560 Ga0466961_0256666
561 Ga0466963_0079897
562 Ga0466963_0085649
563 Ga0466963_0107921
564 Ga0466963_0172313
565 Ga0466963_0393349
566 Ga0466971_0007449
567 Ga0466971_0039892
568 Ga0466971_0063041
569 Ga0466968_0085951
570 Ga0466970_0010617
571 Ga0466970_0049014
572 Ga0466970_0078492
573 Ga0466970_0253452
574 Ga0466970_0565568
575 Ga0466957_0083179
576 Ga0466957_0269018
577 Ga0466957_0295647
578 Ga0466957_0448799
579 Ga0466960_0011774
580 Ga0466960_0031786
581 Ga0466960_0101935
582 Ga0466960_0148359
583 Ga0466958_0010214
584 Ga0466958_0218017
585 Ga0466967_0012616
586 Ga0466967_0042088
587 Ga0466967_0058814
588 Ga0466967_0064936
589 Ga0466967_0163547
590 Ga0466967_0186374
591 Ga0466967_0186994
592 Ga0466967_0216507
593 Ga0466967_0319661
594 Ga0466967_0371293
595 Ga0466967_1637501
596 Ga0495603_0018026
597 Ga0495582_0267883
598 Ga0495658_0081699
599 Ga0496100_0170704
600 Ga0496100_0391661
601 Ga0496101_0289435
602 Ga0496102_0062029
603 Ga0496102_0231251
604 Ga0496102_0571659
605 Ga0496103_0020750
606 Ga0496103_0172528
607 Ga0496103_0345908
608 Ga0496104_0018459
609 Ga0496104_0150317
610 Ga0496106_0034534
611 Ga0496106_0273315
612 Ga0496107_0017214
613 Ga0496107_0209331
614 Ga0496107_0362377
615 Ga0496107_0420214
616 Ga0496109_0035628
617 Ga0496109_0070063
618 Ga0496109_0696708
619 Ga0496110_0340665
620 Ga0496111_0013490
621 Ga0496111_0137275
622 Ga0496114_0062609
623 Ga0496114_0129801
624 Ga0496115_0422953
625 Ga0501031_0004544
626 Ga0501031_0114365
627 Ga0501032_0007594
628 Ga0501032_0183521
629 Ga0501033_0007864
630 Ga0501033_0193265
631 Ga0501033_0395641
632 Ga0501034_0006864
633 Ga0501034_0058824
634 Ga0501034_0068951
635 Ga0501034_0740516
636 Ga0501034_0808638
637 Ga0501036_0012751
638 Ga0501036_0106051
639 Ga0501036_0174124
640 Ga0501037_0004316
641 Ga0501037_0022081
642 Ga0501037_0083376
643 Ga0501037_0085951
644 Ga0501038_0009746
645 Ga0501038_0015953
646 Ga0501038_0094943
647 Ga0501038_0397895
648 Ga0501039_0001126
649 Ga0501039_0058159
650 Ga0501039_0061545
651 Ga0501039_0206404
652 Ga0501039_0394236
653 Ga0501040_0097808
654 Ga0501040_0695971
655 Ga0501041_0022441
656 Ga0501042_0003218
657 Ga0501042_0009337
658 Ga0501042_0102504
659 Ga0501042_0111832
660 Ga0501042_0224305
661 Ga0501042_0250206
662 Ga0501042_0379078
663 Ga0501043_0103773
664 Ga0501043_0133738
665 Ga0501046_0000508
666 Ga0501046_0014878
667 Ga0501046_0117067
668 Ga0501047_0050530
669 Ga0501047_0181595
670 Ga0501047_0225697
671 Ga0501048_0001793
672 Ga0501048_0056726
673 Ga0501048_0279472
674 Ga0501048_0391582
675 Ga0501067_0000956
676 Ga0501067_0006282
677 Ga0501067_0221151
678 Ga0501068_0009207
679 Ga0501068_0403739
680 Ga0501070_0018991
681 Ga0501070_0061316
682 Ga0501070_0099565
683 Ga0501070_0257967
684 Ga0501071_0006177
685 Ga0501071_0031560
686 Ga0501071_0089826
687 Ga0501071_0130185
688 Ga0501071_0387516
689 Ga0501072_0004451
690 Ga0501072_0144306
691 Ga0501072_0164411
692 Ga0501072_0284085
693 Ga0501072_0514149
694 Ga0501073_0035886
695 Ga0501073_0039309
696 Ga0501073_0088965
697 Ga0501073_0266819
698 Ga0501074_0003804
699 Ga0501074_0028141
700 Ga0501076_0047313
701 Ga0501077_0035549
702 Ga0501077_0047234
703 Ga0501079_0042941
704 Ga0501079_0098497
705 Ga0501080_0007872
706 Ga0501080_0087942
707 Ga0501081_0176017
708 Ga0501083_0001725
709 Ga0501083_0097656
710 Ga0501035_0005416
711 Ga0501035_0114646
712 Ga0501035_0266370
713 Ga0501035_0277272
714 Ga0501044_0092195
715 Ga0501044_0106300
716 Ga0501044_0578625
717 Ga0501045_0035699
718 Ga0501045_0064967
719 Ga0501045_0210817
720 nmdc:mga03n38_229716_c1
721 nmdc:mga0yw44_28869_c1
722 nmdc:mga0yw44_288700_c1
723 nmdc:mga0yw44_56297_c1
724 nmdc:mga06z11_58710_c1
725 nmdc:mga04h51_14532_c1
726 nmdc:mga0n895_1261907_c1
727 Ga0501084_0195335
728 Ga0501084_0327610
729 Ga0501084_0496476
730 Ga0501082_0055615
731 Ga0501082_0111968
732 Ga0501082_0879997
733 Ga0530510_0039594
734 2643827453
735 2643892072
736 2643961124
737 2644031830
738 2644094087
739 2644099800
740 2644117406
741 2644228584
742 2644323930
743 2644533719
744 2738870737
745 2740166058
746 2774394789
747 2784472989
748 2809194349
749 2812334648
750 2812349112
751 2819667178
752 2891973137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

38

199

0.89

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

36

179

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

56

178

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.8885 10 180
1s7k-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo) 0.8868 10 181
1z9u-assembly1.cif.gz_A structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium 0.8812 10 180
6c37-assembly1.cif.gz_A mycobacterium smegmatis rimj in complex with coa-disulfide 0.8775 3 191
1s7n-assembly1.cif.gz_B ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl) 0.8729 10 180
ID Description Score Start End Superfamily
1z9uA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8812 10 180 3.40.630.30
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8773 10 180 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.877 71 181 3.40.630.30
af_I1LXV4_19_208_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8765 79 180 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8746 113 182 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0S9PYI5-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9722 6 193 GO:0005737
GO:0008999
AF-A0A0S9PYI5-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9672 6 193 GO:0005737
GO:0008999
AF-A0A4S2TD88-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.961 6 191 GO:0005737
GO:0008999
AF-A0A7X7JAQ7-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9609 2 191 GO:0005737
GO:0008999
AF-A0A3A3Z7D8-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9573 6 191 GO:0005737
GO:0008999

Map