F427286

General Info

Members Datasets Scaffolds Average Seq Length
376 268 266 140

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100218738|Ga0068855_1002187383
Length 153
Sequence MNVTIYHNPACGTSRNTLAMIRNAGIDPTVIEYLKTPPSREELAKMIADARLSVREAIRQKDTPYAELGLDNPALTDDQLLDAMLKDPILINRPFVITPLGTRLSRPSEVVLEILPETHKGAFTKEDGEKVIDEFGNRIAGGKDAGPAAAPGG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
7 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
8 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
9 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
10 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
13 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
17 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
18 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
19 2519899620 Rhizobium sp. Pop5 Isolate Nodule
20 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
21 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
22 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
23 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
24 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
25 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
26 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
27 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
28 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
29 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
30 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
31 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
32 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
33 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
34 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
35 2643221599 Rhizobium sp. Root708 Isolate Unclassified
36 2643221618 Ensifer sp. Root231 Isolate Unclassified
37 2643221626 Ensifer sp. Root31 Isolate Unclassified
38 2643221655 Ensifer sp. Root1252 Isolate Unclassified
39 2643221659 Ensifer sp. Root127 Isolate Unclassified
40 2643221698 Ensifer sp. Root142 Isolate Unclassified
41 2643221712 Ensifer sp. Root258 Isolate Unclassified
42 2643221723 Ensifer sp. Root278 Isolate Unclassified
43 2718218365 Rhizobium sp. N731 Isolate Nodule
44 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
45 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
46 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
47 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
48 2728369397 Rhizobium sp. N1314 Isolate Nodule
49 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
50 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
51 2791355256 Rhizobium sp. M10 Isolate Nodule
52 2791355262 Rhizobium sp. M1 Isolate Nodule
53 2791355263 Rhizobium chutanense C5 Isolate Nodule
54 2791355265 Rhizobium sp. H4 Isolate Nodule
55 2802429633 Rhizobium anhuiense J3 Isolate Nodule
56 2802429634 Rhizobium anhuiense S10 Isolate Nodule
57 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
58 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
59 2802429637 Rhizobium anhuiense C15 Isolate Nodule
60 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
61 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
62 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
63 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
64 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
65 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
66 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
67 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
68 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
69 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
70 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
71 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
72 2844163670 Ensifer sp. 1H6 Isolate Unclassified
73 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
74 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
75 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
76 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
77 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
78 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
79 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
80 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
81 2936381700 Rhizobium chutanense C16 Isolate Unclassified
82 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
83 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
84 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
85 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
86 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
87 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
88 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
89 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
90 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
91 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
92 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
93 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
94 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
95 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
96 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
97 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
98 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
99 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
100 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
101 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
102 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
103 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
104 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
105 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
109 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
110 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
126 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
174 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
175 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
176 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
177 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
178 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
179 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
244 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
248 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
252 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
255 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
256 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
257 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
258 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
259 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
260 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
261 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
262 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
263 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
264 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
265 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
266 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
267 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
268 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.74
Metatranscriptomes 0
Isolates 29.26

Biome Distribution

Category Percentage (%)
Aerial Root 1.06
Bulb 0
Endosphere 30.05
Nodule 17.29
Rhizoplane 3.99
Rhizosphere 30.59
Stem 0
Stem Tuber 0
Unclassified 17.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000481 3300002737 Bacteria 30539
2 JGI25158J39367_1000149 3300002739 Bacteria 16457
3 JGI25150J39212_1021308 3300002774 Bacteria 987
4 JGI25159J45721_1000183 3300002987 Bacteria 28912
5 JGI25159J45721_1000251 3300002987 Bacteria 25319
6 JGI25151J46595_10000282 3300003187 Bacteria 57997
7 JGI25151J46595_10015235 3300003187 Bacteria 3398
8 JGI25165J46597_1002127 3300003214 Bacteria 7154
9 JGI25165J46597_1021663 3300003214 Bacteria 839
10 JGI25153J46596_10010822 3300003215 Bacteria 4090
11 JGI25160J50197_1000001 3300003354 Bacteria 782301
12 JGI25160J50197_1002049 3300003354 Bacteria 9606
13 JGI25160J50197_1004330 3300003354 Bacteria 6152
14 JGI25160J50197_1095059 3300003354 Bacteria 536
15 JGI25161J50226_1000001 3300003374 Bacteria 655036
16 JGI25161J50226_1000295 3300003374 Bacteria 28072
17 JGI25161J50226_1003455 3300003374 Bacteria 3606
18 Ga0055526_1002502 3300003771 Bacteria 12378
19 Ga0055526_1012763 3300003771 Bacteria 3628
20 Ga0055524_1002083 3300003775 Bacteria 10571
21 Ga0055524_1027970 3300003775 Bacteria 1698
22 Ga0055528_1000064 3300003790 Bacteria 85584
23 Ga0055528_1002295 3300003790 Bacteria 10352
24 Ga0055528_1011180 3300003790 Bacteria 3588
25 Ga0055528_1027997 3300003790 Bacteria 1566
26 Ga0055540_1006691 3300003792 Bacteria 4519
27 Ga0058692_1002907 3300003856 Bacteria 5538
28 Ga0055543_1000066 3300004625 Bacteria 97081
29 Ga0055543_1000089 3300004625 Bacteria 79924
30 Ga0055543_1001222 3300004625 Bacteria 10771
31 Ga0065165_1000008 3300005262 Bacteria 334429
32 Ga0065165_1006873 3300005262 Bacteria 5785
33 Ga0065165_1008827 3300005262 Bacteria 4635
34 Ga0065165_1022864 3300005262 Bacteria 2132
35 Ga0070670_100016136 3300005331 Bacteria 6411
36 Ga0070670_101293348 3300005331 Bacteria 667
37 Ga0070682_100613481 3300005337 Bacteria 861
38 Ga0070671_100033364 3300005355 Bacteria 4257
39 Ga0070667_100105126 3300005367 Bacteria 2443
40 Ga0070665_100265416 3300005548 Bacteria 1718
41 Ga0068855_100218738 3300005563 Bacteria 2137
42 Ga0070664_101375141 3300005564 Bacteria 667
43 Ga0068852_100058602 3300005616 Bacteria 3337
44 Ga0075365_10098754 3300006038 Bacteria 1998
45 Ga0075368_10009721 3300006042 Bacteria 3464
46 Ga0075368_10038030 3300006042 Bacteria 1883
47 Ga0075363_100132121 3300006048 Bacteria 1401
48 Ga0075367_10000754 3300006178 Bacteria 12622
49 Ga0075367_10019863 3300006178 Bacteria 3732
50 Ga0075367_10686353 3300006178 Bacteria 651
51 Ga0075366_10019853 3300006195 Bacteria 3893
52 Ga0075370_10002806 3300006353 Bacteria 8169
53 Ga0075370_10642240 3300006353 Bacteria 644
54 Ga0105244_10031057 3300009036 Bacteria 2837
55 Ga0105240_10001761 3300009093 Bacteria 36533
56 Ga0105248_10044345 3300009177 Bacteria 4987
57 Ga0105248_12966100 3300009177 Bacteria 541
58 Ga0105237_10001133 3300009545 Bacteria 35775
59 Ga0123341_1000282 3300009765 Bacteria 28101
60 Ga0123342_1010026 3300009766 Bacteria 11023
61 Ga0123342_1018102 3300009766 Bacteria 5700
62 Ga0105239_10023161 3300010375 Bacteria 6844
63 Ga0157370_10001556 3300013104 Bacteria 28420
64 Ga0157374_10092156 3300013296 Bacteria 2891
65 Ga0182007_10003450 3300015262 Bacteria 7448
66 Ga0182005_1004085 3300015265 Bacteria 4781
67 Ga0209760_103175 3300025207 Bacteria 1471
68 Ga0209436_100014 3300025208 Bacteria 127004
69 Ga0209436_109209 3300025208 Bacteria 1903
70 Ga0209437_100023 3300025233 Bacteria 614195
71 Ga0207425_1001234 3300025245 Bacteria 11206
72 Ga0207425_1002908 3300025245 Bacteria 5739
73 Ga0209677_102943 3300025253 Bacteria 5947
74 Ga0209129_1000167 3300025258 Bacteria 97701
75 Ga0209129_1002720 3300025258 Bacteria 8286
76 Ga0209129_1006603 3300025258 Bacteria 3692
77 Ga0209129_1013161 3300025258 Bacteria 1841
78 Ga0209233_1000219 3300025261 Bacteria 104797
79 Ga0209233_1000345 3300025261 Bacteria 45341
80 Ga0209673_1000013 3300025273 Bacteria 571633
81 Ga0209673_1000341 3300025273 Bacteria 85808
82 Ga0209673_1001119 3300025273 Bacteria 29848
83 Ga0209673_1003671 3300025273 Bacteria 8855
84 Ga0209673_1009269 3300025273 Bacteria 4287
85 Ga0209673_1027066 3300025273 Bacteria 1871
86 Ga0209130_1000003 3300025284 Bacteria 677988
87 Ga0209130_1000004 3300025284 Bacteria 633436
88 Ga0209675_1060276 3300025291 Bacteria 753
89 Ga0209676_1095692 3300025292 Bacteria 643
90 Ga0209025_1000695 3300025294 Bacteria 57400
91 Ga0209025_1002595 3300025294 Bacteria 18674
92 Ga0209025_1005846 3300025294 Bacteria 9841
93 Ga0209025_1006552 3300025294 Bacteria 8988
94 Ga0209025_1015638 3300025294 Bacteria 4554
95 Ga0209564_1000807 3300025295 Bacteria 42868
96 Ga0209564_1001512 3300025295 Bacteria 23269
97 Ga0209564_1001590 3300025295 Bacteria 22195
98 Ga0209564_1040410 3300025295 Bacteria 1267
99 Ga0209758_1000598 3300025297 Bacteria 56164
100 Ga0209758_1038265 3300025297 Bacteria 1841
101 Ga0209758_1081891 3300025297 Bacteria 973
102 Ga0209758_1083580 3300025297 Bacteria 957
103 Ga0209256_1000308 3300025299 Bacteria 85808
104 Ga0209256_1000769 3300025299 Bacteria 41649
105 Ga0209256_1001491 3300025299 Bacteria 23822
106 Ga0209256_1049305 3300025299 Bacteria 1026
107 Ga0207426_1000003 3300025302 Bacteria 1063212
108 Ga0207426_1000011 3300025302 Bacteria 791203
109 Ga0207426_1000039 3300025302 Bacteria 439937
110 Ga0207426_1021139 3300025302 Bacteria 2252
111 Ga0209051_1001029 3300025303 Bacteria 26488
112 Ga0209257_1020425 3300025304 Bacteria 2449
113 Ga0207655_1095736 3300025728 Bacteria 1034
114 Ga0207655_1237308 3300025728 Bacteria 523
115 Ga0207647_10402005 3300025904 Bacteria 772
116 Ga0207695_10000842 3300025913 Bacteria 56321
117 Ga0207671_10000903 3300025914 Bacteria 37499
118 Ga0207694_10134245 3300025924 Bacteria 1986
119 Ga0207709_11197397 3300025935 Bacteria 626
120 Ga0207667_10018672 3300025949 Bacteria 7769
121 Ga0207667_10900041 3300025949 Bacteria 877
122 Ga0207668_11218928 3300025972 Bacteria 676
123 Ga0207658_10076220 3300025986 Bacteria 2554
124 Ga0207702_10106234 3300026078 Bacteria 2487
125 Ga0207698_10037118 3300026142 Bacteria 3585
126 Ga0209371_1000280 3300027312 Bacteria 58641
127 Ga0209371_1001094 3300027312 Bacteria 20193
128 Ga0209371_1002832 3300027312 Bacteria 9207
129 Ga0209371_1003589 3300027312 Bacteria 7416
130 Ga0209371_1018359 3300027312 Bacteria 1780
131 Ga0209813_10033934 3300027866 Bacteria 1520
132 Ga0209813_10274925 3300027866 Bacteria 647
133 Ga0268266_10093869 3300028379 Bacteria 2633
134 Ga0268266_10211619 3300028379 Bacteria 1778
135 Ga0268265_10957254 3300028380 Bacteria 844
136 Ga0307515_10022261 3300028794 Bacteria 11178
137 Ga0268256_1000234 3300030500 Bacteria 58641
138 Ga0268256_1001474 3300030500 Bacteria 14020
139 Ga0268256_1002532 3300030500 Bacteria 9207
140 Ga0268256_1015358 3300030500 Bacteria 2239
141 Ga0268256_1015498 3300030500 Bacteria 2221
142 Ga0307405_10000430 3300031731 Bacteria 15691
143 Ga0307412_10160625 3300031911 Bacteria 1669
144 Ga0307416_101513047 3300032002 Bacteria 777
145 Ga0439436_0162432 3300041404 Bacteria 632
146 Ga0439465_0041712 3300041413 Bacteria 1486
147 Ga0451802_0705652 3300041460 Bacteria 1281
148 Ga0451833_0512897 3300041491 Bacteria 2096
149 Ga0451837_0890765 3300041494 Bacteria 4567
150 Ga0451839_1006201 3300041496 Bacteria 5423
151 Ga0451845_0414771 3300041501 Bacteria 604
152 Ga0451845_0736367 3300041501 Bacteria 2512
153 Ga0451847_0140940 3300041503 Bacteria 2847
154 Ga0451849_0948916 3300041505 Bacteria 2861
155 Ga0451851_0205427 3300041507 Bacteria 4145
156 Ga0451851_1211284 3300041507 Bacteria 1860
157 Ga0451843_0599589 3300041509 Bacteria 1552
158 Ga0451855_0267958 3300041511 Bacteria 3114
159 Ga0451853_0264502 3300041512 Bacteria 1550
160 Ga0439431_0085232 3300041997 Bacteria 856
161 Ga0495638_0000323 3300046460 Bacteria 60784
162 Ga0495638_0109797 3300046460 Bacteria 1640
163 Ga0495585_0022058 3300046492 Bacteria 3655
164 Ga0495585_0027310 3300046492 Bacteria 3257
165 Ga0495607_0116384 3300046501 Bacteria 1410
166 Ga0495583_0049520 3300046506 Bacteria 1924
167 Ga0495606_0000485 3300046507 Bacteria 65008
168 Ga0495606_0011182 3300046507 Bacteria 7347
169 Ga0495606_0094546 3300046507 Bacteria 1832
170 Ga0495606_0239484 3300046507 Bacteria 1012
171 Ga0495610_0041427 3300046512 Bacteria 2312
172 Ga0495631_0081500 3300046518 Bacteria 1396
173 Ga0495631_0093432 3300046518 Bacteria 1295
174 Ga0495663_0043405 3300046525 Bacteria 1373
175 Ga0495597_0118766 3300046542 Bacteria 1103
176 Ga0495633_0013899 3300046558 Bacteria 4221
177 Ga0495633_0163344 3300046558 Bacteria 1027
178 Ga0495668_0041009 3300046616 Bacteria 2581
179 Ga0495625_0005963 3300046660 Bacteria 10954
180 Ga0495625_0019590 3300046660 Bacteria 5243
181 Ga0495625_0633914 3300046660 Bacteria 638
182 Ga0495625_0668884 3300046660 Bacteria 616
183 Ga0495661_0039051 3300046665 Bacteria 2952
184 Ga0495670_0045562 3300046691 Bacteria 2190
185 Ga0495649_0217446 3300046694 Bacteria 989
186 Ga0495636_0595718 3300047318 Bacteria 540
187 Ga0495672_0010083 3300047320 Bacteria 6763
188 Ga0495687_001125 3300047443 Bacteria 25971
189 Ga0495679_074302 3300047446 Bacteria 974
190 Ga0495673_0134277 3300047469 Bacteria 970
191 Ga0495686_0072228 3300047472 Bacteria 2122
192 Ga0495686_0198724 3300047472 Bacteria 1152
193 Ga0495686_0404024 3300047472 Bacteria 733
194 Ga0495686_0463655 3300047472 Bacteria 671
195 Ga0496100_0017328 3300048903 Bacteria 4250
196 Ga0496101_0790291 3300048904 Bacteria 748
197 Ga0496102_0342606 3300048905 Bacteria 1407
198 Ga0496103_0001155 3300048906 Bacteria 18233
199 Ga0496105_0466035 3300048908 Bacteria 996
200 Ga0496106_0000038 3300048909 Bacteria 111983
201 Ga0496108_0215487 3300048911 Bacteria 1667
202 Ga0496110_0009481 3300048913 Bacteria 7881
203 Ga0496111_0117993 3300048914 Bacteria 1958
204 Ga0496113_0477825 3300048916 Bacteria 1001
205 Ga0496116_0065742 3300048919 Bacteria 2324
206 Ga0496116_0065867 3300048919 Bacteria 2321
207 Ga0496116_0078313 3300048919 Bacteria 2062
208 Ga0496116_0099052 3300048919 Bacteria 1747
209 Ga0496116_0364011 3300048919 Bacteria 656
210 Ga0496117_0006094 3300048920 Bacteria 12348
211 Ga0496117_0065712 3300048920 Bacteria 2464
212 Ga0496118_0015803 3300048921 Bacteria 6962
213 Ga0496118_0113916 3300048921 Bacteria 1785
214 Ga0496119_0047648 3300048922 Bacteria 2664
215 Ga0496120_0017520 3300048923 Bacteria 4641
216 Ga0496120_0131865 3300048923 Bacteria 1279
217 Ga0496121_0003855 3300048924 Bacteria 20864
218 Ga0496121_0006197 3300048924 Bacteria 14994
219 Ga0496121_0007782 3300048924 Bacteria 12834
220 Ga0496121_0023389 3300048924 Bacteria 5953
221 Ga0496121_0101002 3300048924 Bacteria 2226
222 Ga0496122_0000462 3300048925 Bacteria 84546
223 Ga0496122_0011645 3300048925 Bacteria 8868
224 Ga0496122_0092096 3300048925 Bacteria 2062
225 Ga0496123_0000048 3300048926 Bacteria 244152
226 Ga0496123_0013941 3300048926 Bacteria 6697
227 Ga0496123_0062559 3300048926 Bacteria 2384
228 Ga0496124_0021877 3300048927 Bacteria 5882
229 Ga0496124_0394186 3300048927 Bacteria 963
230 Ga0496124_0732771 3300048927 Bacteria 622
231 Ga0496125_0009162 3300048928 Bacteria 10230
232 Ga0496125_0047511 3300048928 Bacteria 3588
233 Ga0496125_0070486 3300048928 Bacteria 2736
234 Ga0496126_0308867 3300048929 Bacteria 1302
235 Ga0495682_0293428 3300049460 Bacteria 574
236 Ga0501033_0700540 3300049570 Bacteria 689
237 Ga0501034_0297730 3300049571 Bacteria 1550
238 Ga0501036_0140203 3300049572 Bacteria 2040
239 Ga0501038_0086706 3300049574 Bacteria 2630
240 Ga0501039_0034120 3300049575 Bacteria 3927
241 Ga0501068_0330057 3300049584 Bacteria 979
242 Ga0501073_0089250 3300049589 Bacteria 2143
243 Ga0501074_0119843 3300049590 Bacteria 1882
244 Ga0501035_0118163 3300049822 Bacteria 2320
245 nmdc:mga03683_12148_c1 3300050489 Bacteria 3138
246 nmdc:mga03n38_182566_c1 3300050490 Bacteria 1076
247 nmdc:mga0yw44_103865_c1 3300050492 Bacteria 1813
248 nmdc:mga0yw44_11627_c1 3300050492 Bacteria 4555
249 nmdc:mga0k408_42482_c1 3300050493 Bacteria 2619
250 nmdc:mga06z11_130508_c1 3300050494 Bacteria 1411
251 nmdc:mga06z11_694092_c1 3300050494 Bacteria 620
252 nmdc:mga04h51_307110_c1 3300050495 Bacteria 648
253 nmdc:mga07m45_552485_c1 3300050496 Bacteria 666
254 Ga0500610_0229379 3300053079 Bacteria 872
255 Ga0500658_0026682 3300053134 Bacteria 2227
256 Ga0500568_0000280 3300053139 Bacteria 42298
257 Ga0500568_0000424 3300053139 Bacteria 31935
258 Ga0500573_0000575 3300053140 Bacteria 16057
259 Ga0500604_0133656 3300053151 Bacteria 835
260 Ga0500606_085435 3300053152 Bacteria 1068
261 Ga0500616_0001884 3300053153 Bacteria 18878
262 Ga0500622_0000170 3300053156 Bacteria 70088
263 Ga0500622_0349880 3300053156 Bacteria 614
264 Ga0500633_0000432 3300053160 Bacteria 6576
265 Ga0500638_000485 3300053162 Bacteria 9739
266 Ga0500636_0120936 3300053177 Bacteria 1469

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053079 Ga0500610_0229379 Ga0500610_0229379_28_411 121
2 iso_pu_bacteria 2509276021 2509392438 136
3 iso_pu_bacteria 2513237088 2513599441 136
4 iso_pu_bacteria 2513237138 2513865395 136
5 iso_pu_bacteria 2513237144 2513914505 136
6 iso_pu_bacteria 2513237146 2513928246 136
7 iso_pu_bacteria 2515075009 2515112524 136
8 iso_pu_bacteria 2519899620 2520378589 136
9 iso_pu_bacteria 2582581299 2585228617 136
10 iso_pu_bacteria 2582581308 2585281291 136
11 iso_pu_bacteria 2582581308 2585282729 136
12 iso_pu_bacteria 2582581315 2585325164 136
13 iso_pu_bacteria 2582581316 2585336419 136
14 iso_pu_bacteria 2585427527 2585535513 136
15 iso_pu_bacteria 2585427530 2585556127 136
16 iso_pu_bacteria 2599185156 2599331671 136
17 iso_pu_bacteria 2599185156 2599335633 136
18 iso_pu_bacteria 2599185170 2599416861 136
19 iso_pu_bacteria 2599185210 2599602701 136
20 iso_pu_bacteria 2599185236 2599723361 136
21 iso_pu_bacteria 2615840626 2616310403 136
22 iso_pu_bacteria 2643221599 2644005706 136
23 iso_pu_bacteria 2643221618 2644109410 136
24 iso_pu_bacteria 2643221626 2644145095 136
25 iso_pu_bacteria 2643221655 2644307675 136
26 iso_pu_bacteria 2643221659 2644332451 136
27 iso_pu_bacteria 2643221698 2644544198 136
28 iso_pu_bacteria 2643221712 2644613764 136
29 iso_pu_bacteria 2643221723 2644672968 136
30 iso_pu_bacteria 2718218365 2721158999 136
31 iso_pu_bacteria 2721755556 2723027786 136
32 iso_pu_bacteria 2721755684 2723561415 136
33 iso_pu_bacteria 2728369352 2730108722 136
34 iso_pu_bacteria 2728369397 2730298631 136
35 iso_pu_bacteria 2791355256 2793294877 136
36 iso_pu_bacteria 2791355262 2793335857 136
37 iso_pu_bacteria 2791355265 2793352870 136
38 iso_pu_bacteria 2818991453 2819641525 136
39 iso_pu_bacteria 2838022645 2838022800 136
40 iso_pu_bacteria 2838035591 2838041809 136
41 iso_pu_bacteria 2838042994 2838044443 136
42 iso_pu_bacteria 2841864319 2841864340 136
43 iso_pu_bacteria 2842198810 2842201373 136
44 iso_pu_bacteria 2842205361 2842205838 136
45 iso_pu_bacteria 2842278818 2842279295 136
46 iso_pu_bacteria 2842341865 2842345312 136
47 iso_pu_bacteria 2842395702 2842398875 136
48 iso_pu_bacteria 2844163670 2844170285 136
49 iso_pu_bacteria 2923556063 2923556208 136
50 iso_pu_bacteria 2933016740 2933019854 136
51 iso_pu_bacteria 2936367885 2936372487 136
52 iso_pu_bacteria 2936375103 2936376522 136
53 iso_pu_bacteria 2979100975 2979103090 136
54 iso_pu_bacteria 2984509177 2984513870 136
55 iso_pu_bacteria 2984518228 2984523417 136
56 iso_pu_bacteria 2984537506 2984542562 136
57 iso_pu_bacteria 2984601300 2984606508 136
58 iso_pu_bacteria 2989771324 2989772250 136
59 iso_pu_bacteria 3005409236 3005411968 136
60 iso_pu_bacteria 8005289223 8005293278 136
61 iso_pu_bacteria 8005376324 8005379436 136
62 iso_pu_bacteria 8005460587 8005463197 136
63 iso_pu_bacteria 8005688590 8005694772 136
64 iso_pu_bacteria 8024486573 8024486766 136
65 3300005331 Ga0070670_100016136 Ga0070670_1000161366 138
66 3300005331 Ga0070670_101293348 Ga0070670_1012933481 138
67 3300005564 Ga0070664_101375141 Ga0070664_1013751411 138
68 3300031911 Ga0307412_10160625 Ga0307412_101606251 138
69 iso_pu_bacteria 2510065019 2510133544 138
70 iso_pu_bacteria 2510461076 2510894925 138
71 iso_pu_bacteria 2510917030 2511195871 138
72 iso_pu_bacteria 2513237093 2513629855 138
73 iso_pu_bacteria 2513237103 2513708489 138
74 iso_pu_bacteria 2513237162 2514022049 138
75 iso_pu_bacteria 2515154113 2515632864 138
76 iso_pu_bacteria 2515154114 2515640009 138
77 iso_pu_bacteria 2515154116 2515655795 138
78 iso_pu_bacteria 2516653077 2517036250 138
79 iso_pu_bacteria 2517093000 2517095387 138
80 iso_pu_bacteria 2517287029 2517406987 138
81 iso_pu_bacteria 2582581298 2585226613 138
82 iso_pu_bacteria 2585427528 2585537734 138
83 iso_pu_bacteria 2585427529 2585549687 138
84 iso_pu_bacteria 2585427593 2585835684 138
85 iso_pu_bacteria 2643221599 2644005749 138
86 iso_pu_bacteria 2724679232 2725950486 138
87 iso_pu_bacteria 2738541333 2739032391 138
88 iso_pu_bacteria 2765235942 2766066911 138
89 iso_pu_bacteria 2791355263 2793341718 138
90 iso_pu_bacteria 2802429633 2806043366 138
91 iso_pu_bacteria 2802429634 2806050700 138
92 iso_pu_bacteria 2802429635 2806057517 138
93 iso_pu_bacteria 2802429636 2806064899 138
94 iso_pu_bacteria 2802429637 2806072165 138
95 iso_pu_bacteria 2842110456 2842114181 138
96 iso_pu_bacteria 2842217011 2842217481 138
97 iso_pu_bacteria 2852387548 2852390002 138
98 iso_pu_bacteria 2857516855 2857519928 138
99 iso_pu_bacteria 2919100787 2919106116 138
100 iso_pu_bacteria 2933586486 2933590277 138
101 iso_pu_bacteria 2936381700 2936387298 138
102 iso_pu_bacteria 3005409236 3005415009 138
103 iso_pu_bacteria 3005416602 3005423018 138
104 iso_pu_bacteria 3005445848 3005447806 138
105 iso_pu_bacteria 639633055 639648765 138
106 iso_pu_bacteria 8005314921 8005315345 138
107 iso_pu_bacteria 8005556819 8005557481 138
108 iso_pu_bacteria 8005563573 8005568658 138
109 iso_pu_bacteria 8005570704 8005574447 138
110 iso_pu_bacteria 8005682033 8005685323 138
111 iso_pu_bacteria 8018163183 8018166568 138
112 iso_pu_bacteria 8024486573 8024488358 138
113 iso_pu_bacteria 8056875544 8056879120 138
114 iso_pu_bacteria 8057575449 8057580471 138
115 iso_pu_bacteria 8057874678 8057874820 138
116 3300046507 Ga0495606_0011182 Ga0495606_0011182_4711_5136 139
117 3300002737 JGI25162J39368_1000481 JGI25162J39368_100048115 140
118 3300002739 JGI25158J39367_1000149 JGI25158J39367_100014910 140
119 3300002774 JGI25150J39212_1021308 JGI25150J39212_10213082 140
120 3300002987 JGI25159J45721_1000183 JGI25159J45721_100018313 140
121 3300002987 JGI25159J45721_1000251 JGI25159J45721_100025127 140
122 3300003187 JGI25151J46595_10000282 JGI25151J46595_1000028243 140
123 3300003187 JGI25151J46595_10015235 JGI25151J46595_100152355 140
124 3300003214 JGI25165J46597_1002127 JGI25165J46597_10021272 140
125 3300003214 JGI25165J46597_1021663 JGI25165J46597_10216632 140
126 3300003215 JGI25153J46596_10010822 JGI25153J46596_100108224 140
127 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001289 140
128 3300003354 JGI25160J50197_1002049 JGI25160J50197_10020496 140
129 3300003354 JGI25160J50197_1004330 JGI25160J50197_10043304 140
130 3300003354 JGI25160J50197_1095059 JGI25160J50197_10950591 140
131 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001473 140
132 3300003374 JGI25161J50226_1000295 JGI25161J50226_100029510 140
133 3300003374 JGI25161J50226_1003455 JGI25161J50226_10034553 140
134 3300003771 Ga0055526_1002502 Ga0055526_100250221 140
135 3300003771 Ga0055526_1012763 Ga0055526_10127635 140
136 3300003775 Ga0055524_1002083 Ga0055524_10020834 140
137 3300003775 Ga0055524_1027970 Ga0055524_10279702 140
138 3300003790 Ga0055528_1000064 Ga0055528_100006438 140
139 3300003790 Ga0055528_1002295 Ga0055528_10022953 140
140 3300003790 Ga0055528_1011180 Ga0055528_10111803 140
141 3300003790 Ga0055528_1027997 Ga0055528_10279972 140
142 3300003792 Ga0055540_1006691 Ga0055540_10066916 140
143 3300003856 Ga0058692_1002907 Ga0058692_10029073 140
144 3300004625 Ga0055543_1000066 Ga0055543_100006697 140
145 3300004625 Ga0055543_1000089 Ga0055543_100008948 140
146 3300004625 Ga0055543_1001222 Ga0055543_10012225 140
147 3300005262 Ga0065165_1000008 Ga0065165_1000008168 140
148 3300005262 Ga0065165_1006873 Ga0065165_10068735 140
149 3300005262 Ga0065165_1008827 Ga0065165_10088277 140
150 3300005262 Ga0065165_1022864 Ga0065165_10228642 140
151 3300005337 Ga0070682_100613481 Ga0070682_1006134812 140
152 3300005355 Ga0070671_100033364 Ga0070671_1000333646 140
153 3300005367 Ga0070667_100105126 Ga0070667_1001051265 140
154 3300005548 Ga0070665_100265416 Ga0070665_1002654162 140
155 3300005563 Ga0068855_100218738 Ga0068855_1002187383 140
156 3300005616 Ga0068852_100058602 Ga0068852_1000586023 140
157 3300006038 Ga0075365_10098754 Ga0075365_100987542 140
158 3300006042 Ga0075368_10009721 Ga0075368_100097212 140
159 3300006042 Ga0075368_10038030 Ga0075368_100380303 140
160 3300006048 Ga0075363_100132121 Ga0075363_1001321212 140
161 3300006178 Ga0075367_10000754 Ga0075367_100007546 140
162 3300006178 Ga0075367_10019863 Ga0075367_100198635 140
163 3300006178 Ga0075367_10686353 Ga0075367_106863532 140
164 3300006195 Ga0075366_10019853 Ga0075366_100198535 140
165 3300006353 Ga0075370_10002806 Ga0075370_100028069 140
166 3300006353 Ga0075370_10642240 Ga0075370_106422402 140
167 3300009036 Ga0105244_10031057 Ga0105244_100310573 140
168 3300009093 Ga0105240_10001761 Ga0105240_1000176128 140
169 3300009177 Ga0105248_10044345 Ga0105248_100443456 140
170 3300009177 Ga0105248_12966100 Ga0105248_129661001 140
171 3300009545 Ga0105237_10001133 Ga0105237_1000113327 140
172 3300009765 Ga0123341_1000282 Ga0123341_100028234 140
173 3300009766 Ga0123342_1010026 Ga0123342_10100269 140
174 3300009766 Ga0123342_1018102 Ga0123342_10181026 140
175 3300010375 Ga0105239_10023161 Ga0105239_100231617 140
176 3300013104 Ga0157370_10001556 Ga0157370_1000155622 140
177 3300013296 Ga0157374_10092156 Ga0157374_100921562 140
178 3300015262 Ga0182007_10003450 Ga0182007_100034507 140
179 3300015265 Ga0182005_1004085 Ga0182005_10040854 140
180 3300025207 Ga0209760_103175 Ga0209760_1031752 140
181 3300025208 Ga0209436_100014 Ga0209436_10001474 140
182 3300025208 Ga0209436_109209 Ga0209436_1092092 140
183 3300025233 Ga0209437_100023 Ga0209437_10002336 140
184 3300025245 Ga0207425_1001234 Ga0207425_100123411 140
185 3300025245 Ga0207425_1002908 Ga0207425_10029088 140
186 3300025253 Ga0209677_102943 Ga0209677_1029437 140
187 3300025258 Ga0209129_1000167 Ga0209129_100016749 140
188 3300025258 Ga0209129_1002720 Ga0209129_10027208 140
189 3300025258 Ga0209129_1006603 Ga0209129_10066032 140
190 3300025258 Ga0209129_1013161 Ga0209129_10131612 140
191 3300025261 Ga0209233_1000219 Ga0209233_100021936 140
192 3300025261 Ga0209233_1000345 Ga0209233_100034537 140
193 3300025273 Ga0209673_1000013 Ga0209673_1000013236 140
194 3300025273 Ga0209673_1000341 Ga0209673_100034141 140
195 3300025273 Ga0209673_1001119 Ga0209673_100111917 140
196 3300025273 Ga0209673_1003671 Ga0209673_10036717 140
197 3300025273 Ga0209673_1009269 Ga0209673_10092696 140
198 3300025273 Ga0209673_1027066 Ga0209673_10270662 140
199 3300025284 Ga0209130_1000003 Ga0209130_1000003486 140
200 3300025284 Ga0209130_1000004 Ga0209130_1000004566 140
201 3300025291 Ga0209675_1060276 Ga0209675_10602761 140
202 3300025292 Ga0209676_1095692 Ga0209676_10956922 140
203 3300025294 Ga0209025_1000695 Ga0209025_100069558 140
204 3300025294 Ga0209025_1002595 Ga0209025_100259522 140
205 3300025294 Ga0209025_1005846 Ga0209025_10058462 140
206 3300025294 Ga0209025_1006552 Ga0209025_10065528 140
207 3300025294 Ga0209025_1015638 Ga0209025_10156383 140
208 3300025295 Ga0209564_1000807 Ga0209564_100080729 140
209 3300025295 Ga0209564_1001512 Ga0209564_100151211 140
210 3300025295 Ga0209564_1001590 Ga0209564_100159023 140
211 3300025295 Ga0209564_1040410 Ga0209564_10404102 140
212 3300025297 Ga0209758_1000598 Ga0209758_10005988 140
213 3300025297 Ga0209758_1038265 Ga0209758_10382652 140
214 3300025297 Ga0209758_1081891 Ga0209758_10818912 140
215 3300025297 Ga0209758_1083580 Ga0209758_10835802 140
216 3300025299 Ga0209256_1000308 Ga0209256_100030841 140
217 3300025299 Ga0209256_1000769 Ga0209256_100076945 140
218 3300025299 Ga0209256_1001491 Ga0209256_100149114 140
219 3300025299 Ga0209256_1049305 Ga0209256_10493052 140
220 3300025302 Ga0207426_1000003 Ga0207426_1000003160 140
221 3300025302 Ga0207426_1000011 Ga0207426_1000011290 140
222 3300025302 Ga0207426_1000039 Ga0207426_1000039315 140
223 3300025302 Ga0207426_1021139 Ga0207426_10211392 140
224 3300025303 Ga0209051_1001029 Ga0209051_100102919 140
225 3300025304 Ga0209257_1020425 Ga0209257_10204252 140
226 3300025728 Ga0207655_1095736 Ga0207655_10957362 140
227 3300025728 Ga0207655_1237308 Ga0207655_12373081 140
228 3300025904 Ga0207647_10402005 Ga0207647_104020052 140
229 3300025913 Ga0207695_10000842 Ga0207695_1000084229 140
230 3300025914 Ga0207671_10000903 Ga0207671_1000090329 140
231 3300025924 Ga0207694_10134245 Ga0207694_101342453 140
232 3300025935 Ga0207709_11197397 Ga0207709_111973972 140
233 3300025949 Ga0207667_10018672 Ga0207667_100186723 140
234 3300025949 Ga0207667_10900041 Ga0207667_109000412 140
235 3300025972 Ga0207668_11218928 Ga0207668_112189281 140
236 3300025986 Ga0207658_10076220 Ga0207658_100762201 140
237 3300026078 Ga0207702_10106234 Ga0207702_101062343 140
238 3300026142 Ga0207698_10037118 Ga0207698_100371183 140
239 3300027312 Ga0209371_1000280 Ga0209371_100028019 140
240 3300027312 Ga0209371_1001094 Ga0209371_100109411 140
241 3300027312 Ga0209371_1002832 Ga0209371_10028328 140
242 3300027312 Ga0209371_1003589 Ga0209371_10035893 140
243 3300027312 Ga0209371_1018359 Ga0209371_10183593 140
244 3300027866 Ga0209813_10033934 Ga0209813_100339341 140
245 3300027866 Ga0209813_10274925 Ga0209813_102749252 140
246 3300028379 Ga0268266_10093869 Ga0268266_100938693 140
247 3300028379 Ga0268266_10211619 Ga0268266_102116192 140
248 3300028380 Ga0268265_10957254 Ga0268265_109572542 140
249 3300028794 Ga0307515_10022261 Ga0307515_100222616 140
250 3300030500 Ga0268256_1000234 Ga0268256_100023437 140
251 3300030500 Ga0268256_1001474 Ga0268256_100147411 140
252 3300030500 Ga0268256_1002532 Ga0268256_10025324 140
253 3300030500 Ga0268256_1015358 Ga0268256_10153583 140
254 3300030500 Ga0268256_1015498 Ga0268256_10154985 140
255 3300031731 Ga0307405_10000430 Ga0307405_1000043014 140
256 3300032002 Ga0307416_101513047 Ga0307416_1015130472 140
257 3300041404 Ga0439436_0162432 Ga0439436_0162432_136_558 140
258 3300041413 Ga0439465_0041712 Ga0439465_0041712_610_1032 140
259 3300041460 Ga0451802_0705652 Ga0451802_0705652_425_853 140
260 3300041491 Ga0451833_0512897 Ga0451833_0512897_1479_1907 140
261 3300041494 Ga0451837_0890765 Ga0451837_0890765_2032_2460 140
262 3300041496 Ga0451839_1006201 Ga0451839_1006201_864_1292 140
263 3300041501 Ga0451845_0414771 Ga0451845_0414771_24_452 140
264 3300041501 Ga0451845_0736367 Ga0451845_0736367_1932_2360 140
265 3300041503 Ga0451847_0140940 Ga0451847_0140940_1087_1515 140
266 3300041505 Ga0451849_0948916 Ga0451849_0948916_1932_2360 140
267 3300041507 Ga0451851_0205427 Ga0451851_0205427_2584_3012 140
268 3300041507 Ga0451851_1211284 Ga0451851_1211284_1064_1486 140
269 3300041509 Ga0451843_0599589 Ga0451843_0599589_848_1276 140
270 3300041511 Ga0451855_0267958 Ga0451855_0267958_1717_2145 140
271 3300041512 Ga0451853_0264502 Ga0451853_0264502_417_845 140
272 3300041997 Ga0439431_0085232 Ga0439431_0085232_241_663 140
273 3300046460 Ga0495638_0000323 Ga0495638_0000323_41825_42247 140
274 3300046460 Ga0495638_0109797 Ga0495638_0109797_173_601 140
275 3300046492 Ga0495585_0022058 Ga0495585_0022058_1159_1587 140
276 3300046492 Ga0495585_0027310 Ga0495585_0027310_466_888 140
277 3300046501 Ga0495607_0116384 Ga0495607_0116384_544_972 140
278 3300046506 Ga0495583_0049520 Ga0495583_0049520_245_673 140
279 3300046507 Ga0495606_0000485 Ga0495606_0000485_38672_39100 140
280 3300046507 Ga0495606_0094546 Ga0495606_0094546_616_1044 140
281 3300046507 Ga0495606_0239484 Ga0495606_0239484_20_442 140
282 3300046512 Ga0495610_0041427 Ga0495610_0041427_1865_2287 140
283 3300046518 Ga0495631_0081500 Ga0495631_0081500_29_457 140
284 3300046518 Ga0495631_0093432 Ga0495631_0093432_780_1202 140
285 3300046525 Ga0495663_0043405 Ga0495663_0043405_534_956 140
286 3300046542 Ga0495597_0118766 Ga0495597_0118766_307_729 140
287 3300046558 Ga0495633_0013899 Ga0495633_0013899_3714_4142 140
288 3300046558 Ga0495633_0163344 Ga0495633_0163344_384_806 140
289 3300046616 Ga0495668_0041009 Ga0495668_0041009_571_993 140
290 3300046660 Ga0495625_0005963 Ga0495625_0005963_10327_10755 140
291 3300046660 Ga0495625_0019590 Ga0495625_0019590_3826_4248 140
292 3300046660 Ga0495625_0633914 Ga0495625_0633914_197_619 140
293 3300046660 Ga0495625_0668884 Ga0495625_0668884_143_565 140
294 3300046665 Ga0495661_0039051 Ga0495661_0039051_643_1071 140
295 3300046691 Ga0495670_0045562 Ga0495670_0045562_173_601 140
296 3300046694 Ga0495649_0217446 Ga0495649_0217446_85_507 140
297 3300047318 Ga0495636_0595718 Ga0495636_0595718_76_498 140
298 3300047320 Ga0495672_0010083 Ga0495672_0010083_6040_6462 140
299 3300047443 Ga0495687_001125 Ga0495687_001125_20097_20519 140
300 3300047446 Ga0495679_074302 Ga0495679_074302_459_887 140
301 3300047469 Ga0495673_0134277 Ga0495673_0134277_18_440 140
302 3300047472 Ga0495686_0072228 Ga0495686_0072228_117_539 140
303 3300047472 Ga0495686_0198724 Ga0495686_0198724_687_1115 140
304 3300047472 Ga0495686_0404024 Ga0495686_0404024_26_448 140
305 3300047472 Ga0495686_0463655 Ga0495686_0463655_37_459 140
306 3300048903 Ga0496100_0017328 Ga0496100_0017328_1235_1657 140
307 3300048904 Ga0496101_0790291 Ga0496101_0790291_208_630 140
308 3300048905 Ga0496102_0342606 Ga0496102_0342606_38_460 140
309 3300048906 Ga0496103_0001155 Ga0496103_0001155_255_677 140
310 3300048908 Ga0496105_0466035 Ga0496105_0466035_259_681 140
311 3300048909 Ga0496106_0000038 Ga0496106_0000038_111017_111445 140
312 3300048911 Ga0496108_0215487 Ga0496108_0215487_1049_1477 140
313 3300048913 Ga0496110_0009481 Ga0496110_0009481_5959_6387 140
314 3300048914 Ga0496111_0117993 Ga0496111_0117993_896_1324 140
315 3300048916 Ga0496113_0477825 Ga0496113_0477825_176_598 140
316 3300048919 Ga0496116_0065742 Ga0496116_0065742_1753_2175 140
317 3300048919 Ga0496116_0065867 Ga0496116_0065867_884_1312 140
318 3300048919 Ga0496116_0078313 Ga0496116_0078313_499_927 140
319 3300048919 Ga0496116_0099052 Ga0496116_0099052_1068_1490 140
320 3300048919 Ga0496116_0364011 Ga0496116_0364011_192_620 140
321 3300048920 Ga0496117_0006094 Ga0496117_0006094_8050_8472 140
322 3300048920 Ga0496117_0065712 Ga0496117_0065712_1442_1870 140
323 3300048921 Ga0496118_0015803 Ga0496118_0015803_2953_3375 140
324 3300048921 Ga0496118_0113916 Ga0496118_0113916_908_1336 140
325 3300048922 Ga0496119_0047648 Ga0496119_0047648_1570_1992 140
326 3300048923 Ga0496120_0017520 Ga0496120_0017520_1625_2047 140
327 3300048923 Ga0496120_0131865 Ga0496120_0131865_805_1227 140
328 3300048924 Ga0496121_0003855 Ga0496121_0003855_14643_15071 140
329 3300048924 Ga0496121_0006197 Ga0496121_0006197_3588_4010 140
330 3300048924 Ga0496121_0007782 Ga0496121_0007782_7340_7768 140
331 3300048924 Ga0496121_0023389 Ga0496121_0023389_3963_4385 140
332 3300048924 Ga0496121_0101002 Ga0496121_0101002_1665_2087 140
333 3300048925 Ga0496122_0000462 Ga0496122_0000462_64859_65284 140
334 3300048925 Ga0496122_0011645 Ga0496122_0011645_4760_5182 140
335 3300048925 Ga0496122_0092096 Ga0496122_0092096_224_652 140
336 3300048926 Ga0496123_0000048 Ga0496123_0000048_19263_19688 140
337 3300048926 Ga0496123_0013941 Ga0496123_0013941_1411_1833 140
338 3300048926 Ga0496123_0062559 Ga0496123_0062559_586_1014 140
339 3300048927 Ga0496124_0021877 Ga0496124_0021877_4047_4469 140
340 3300048927 Ga0496124_0394186 Ga0496124_0394186_261_686 140
341 3300048927 Ga0496124_0732771 Ga0496124_0732771_157_579 140
342 3300048928 Ga0496125_0009162 Ga0496125_0009162_4694_5116 140
343 3300048928 Ga0496125_0047511 Ga0496125_0047511_2007_2429 140
344 3300048928 Ga0496125_0070486 Ga0496125_0070486_229_657 140
345 3300048929 Ga0496126_0308867 Ga0496126_0308867_836_1258 140
346 3300049460 Ga0495682_0293428 Ga0495682_0293428_26_454 140
347 3300049570 Ga0501033_0700540 Ga0501033_0700540_34_456 140
348 3300049571 Ga0501034_0297730 Ga0501034_0297730_134_556 140
349 3300049572 Ga0501036_0140203 Ga0501036_0140203_353_775 140
350 3300049574 Ga0501038_0086706 Ga0501038_0086706_1256_1678 140
351 3300049575 Ga0501039_0034120 Ga0501039_0034120_1697_2119 140
352 3300049584 Ga0501068_0330057 Ga0501068_0330057_167_589 140
353 3300049589 Ga0501073_0089250 Ga0501073_0089250_841_1263 140
354 3300049590 Ga0501074_0119843 Ga0501074_0119843_283_705 140
355 3300049822 Ga0501035_0118163 Ga0501035_0118163_1184_1606 140
356 3300050489 nmdc:mga03683_12148_c1 nmdc:mga03683_12148_c1_1169_1597 140
357 3300050490 nmdc:mga03n38_182566_c1 nmdc:mga03n38_182566_c1_119_547 140
358 3300050492 nmdc:mga0yw44_103865_c1 nmdc:mga0yw44_103865_c1_1048_1470 140
359 3300050492 nmdc:mga0yw44_11627_c1 nmdc:mga0yw44_11627_c1_4048_4476 140
360 3300050493 nmdc:mga0k408_42482_c1 nmdc:mga0k408_42482_c1_288_716 140
361 3300050494 nmdc:mga06z11_130508_c1 nmdc:mga06z11_130508_c1_551_979 140
362 3300050494 nmdc:mga06z11_694092_c1 nmdc:mga06z11_694092_c1_100_528 140
363 3300050495 nmdc:mga04h51_307110_c1 nmdc:mga04h51_307110_c1_189_617 140
364 3300050496 nmdc:mga07m45_552485_c1 nmdc:mga07m45_552485_c1_93_521 140
365 3300053134 Ga0500658_0026682 Ga0500658_0026682_1657_2085 140
366 3300053139 Ga0500568_0000280 Ga0500568_0000280_445_873 140
367 3300053139 Ga0500568_0000424 Ga0500568_0000424_1110_1532 140
368 3300053140 Ga0500573_0000575 Ga0500573_0000575_725_1147 140
369 3300053151 Ga0500604_0133656 Ga0500604_0133656_238_666 140
370 3300053152 Ga0500606_085435 Ga0500606_085435_230_658 140
371 3300053153 Ga0500616_0001884 Ga0500616_0001884_4684_5106 140
372 3300053156 Ga0500622_0000170 Ga0500622_0000170_62945_63373 140
373 3300053156 Ga0500622_0349880 Ga0500622_0349880_119_547 140
374 3300053160 Ga0500633_0000432 Ga0500633_0000432_5840_6268 140
375 3300053162 Ga0500638_000485 Ga0500638_000485_5524_5949 140
376 3300053177 Ga0500636_0120936 Ga0500636_0120936_232_657 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

6

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9686 3 139
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9683 3 139
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9677 3 139
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9674 3 139
1sk0-assembly1.cif.gz_A arsenate reductase r60a mutant +0.4m arsenite from e. coli 0.9674 3 139
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9683 3 139 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9546 3 139 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9531 2 114 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9371 2 114 3.40.30.10
af_Q4D776_60_147_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8755 2 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1B3Z4G7-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.002 15 112 GO:0008794
GO:0046685
AF-A0A2Z2GTY5-F1-model_v4 Arsenate reductase 1.001 26 116 GO:0046685
AF-A0A4P7BI12-F1-model_v4 deleted 0.995 1 115
AF-A0A2W4YC61-F1-model_v4 deleted 0.9948 2 92
AF-A0A6M5JE52-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9941 2 114 GO:0008794
GO:0046685

Feature Viewer

pLDDT pTM Quality
90.97 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map