F427286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 376 | 268 | 266 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100218738|Ga0068855_1002187383 |
| Length | 153 |
| Sequence | MNVTIYHNPACGTSRNTLAMIRNAGIDPTVIEYLKTPPSREELAKMIADARLSVREAIRQKDTPYAELGLDNPALTDDQLLDAMLKDPILINRPFVITPLGTRLSRPSEVVLEILPETHKGAFTKEDGEKVIDEFGNRIAGGKDAGPAAAPGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 2 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 3 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 4 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 5 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 6 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 7 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 8 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 9 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 10 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 11 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 12 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 13 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 14 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 15 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 16 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 17 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 18 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 19 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 20 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 21 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 22 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 23 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 24 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 25 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 26 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 27 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 28 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 29 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 30 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 31 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 32 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 33 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 34 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 35 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 36 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 37 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 38 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 39 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 40 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 41 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 42 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 43 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 44 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 45 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 46 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 47 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 48 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 49 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 50 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 51 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 52 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 53 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 54 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 55 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 56 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 57 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 58 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 59 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 60 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 61 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 62 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 63 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 64 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 65 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 66 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 67 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 68 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 69 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 70 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 71 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 72 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 73 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 74 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 75 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 76 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 77 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 78 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 79 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 80 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 81 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 82 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 83 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 84 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 85 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 86 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 87 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 88 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 89 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 90 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 91 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 92 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 93 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 94 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 95 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 96 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 97 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 98 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 99 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 100 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 101 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 102 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 103 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 104 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 105 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 106 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 107 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 126 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 171 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 172 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 174 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 175 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 176 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 177 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 178 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 179 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 180 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 181 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 182 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 183 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 240 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 242 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 244 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 246 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 247 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 248 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 249 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 250 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 251 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 252 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 254 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 255 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 256 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 257 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 258 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 259 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 260 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 261 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 262 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 263 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 264 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 265 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 266 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 267 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 268 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.74 |
| Metatranscriptomes | 0 |
| Isolates | 29.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.06 |
| Bulb | 0 |
| Endosphere | 30.05 |
| Nodule | 17.29 |
| Rhizoplane | 3.99 |
| Rhizosphere | 30.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000481 | 3300002737 | Bacteria | 30539 |
| 2 | JGI25158J39367_1000149 | 3300002739 | Bacteria | 16457 |
| 3 | JGI25150J39212_1021308 | 3300002774 | Bacteria | 987 |
| 4 | JGI25159J45721_1000183 | 3300002987 | Bacteria | 28912 |
| 5 | JGI25159J45721_1000251 | 3300002987 | Bacteria | 25319 |
| 6 | JGI25151J46595_10000282 | 3300003187 | Bacteria | 57997 |
| 7 | JGI25151J46595_10015235 | 3300003187 | Bacteria | 3398 |
| 8 | JGI25165J46597_1002127 | 3300003214 | Bacteria | 7154 |
| 9 | JGI25165J46597_1021663 | 3300003214 | Bacteria | 839 |
| 10 | JGI25153J46596_10010822 | 3300003215 | Bacteria | 4090 |
| 11 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 12 | JGI25160J50197_1002049 | 3300003354 | Bacteria | 9606 |
| 13 | JGI25160J50197_1004330 | 3300003354 | Bacteria | 6152 |
| 14 | JGI25160J50197_1095059 | 3300003354 | Bacteria | 536 |
| 15 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 16 | JGI25161J50226_1000295 | 3300003374 | Bacteria | 28072 |
| 17 | JGI25161J50226_1003455 | 3300003374 | Bacteria | 3606 |
| 18 | Ga0055526_1002502 | 3300003771 | Bacteria | 12378 |
| 19 | Ga0055526_1012763 | 3300003771 | Bacteria | 3628 |
| 20 | Ga0055524_1002083 | 3300003775 | Bacteria | 10571 |
| 21 | Ga0055524_1027970 | 3300003775 | Bacteria | 1698 |
| 22 | Ga0055528_1000064 | 3300003790 | Bacteria | 85584 |
| 23 | Ga0055528_1002295 | 3300003790 | Bacteria | 10352 |
| 24 | Ga0055528_1011180 | 3300003790 | Bacteria | 3588 |
| 25 | Ga0055528_1027997 | 3300003790 | Bacteria | 1566 |
| 26 | Ga0055540_1006691 | 3300003792 | Bacteria | 4519 |
| 27 | Ga0058692_1002907 | 3300003856 | Bacteria | 5538 |
| 28 | Ga0055543_1000066 | 3300004625 | Bacteria | 97081 |
| 29 | Ga0055543_1000089 | 3300004625 | Bacteria | 79924 |
| 30 | Ga0055543_1001222 | 3300004625 | Bacteria | 10771 |
| 31 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 32 | Ga0065165_1006873 | 3300005262 | Bacteria | 5785 |
| 33 | Ga0065165_1008827 | 3300005262 | Bacteria | 4635 |
| 34 | Ga0065165_1022864 | 3300005262 | Bacteria | 2132 |
| 35 | Ga0070670_100016136 | 3300005331 | Bacteria | 6411 |
| 36 | Ga0070670_101293348 | 3300005331 | Bacteria | 667 |
| 37 | Ga0070682_100613481 | 3300005337 | Bacteria | 861 |
| 38 | Ga0070671_100033364 | 3300005355 | Bacteria | 4257 |
| 39 | Ga0070667_100105126 | 3300005367 | Bacteria | 2443 |
| 40 | Ga0070665_100265416 | 3300005548 | Bacteria | 1718 |
| 41 | Ga0068855_100218738 | 3300005563 | Bacteria | 2137 |
| 42 | Ga0070664_101375141 | 3300005564 | Bacteria | 667 |
| 43 | Ga0068852_100058602 | 3300005616 | Bacteria | 3337 |
| 44 | Ga0075365_10098754 | 3300006038 | Bacteria | 1998 |
| 45 | Ga0075368_10009721 | 3300006042 | Bacteria | 3464 |
| 46 | Ga0075368_10038030 | 3300006042 | Bacteria | 1883 |
| 47 | Ga0075363_100132121 | 3300006048 | Bacteria | 1401 |
| 48 | Ga0075367_10000754 | 3300006178 | Bacteria | 12622 |
| 49 | Ga0075367_10019863 | 3300006178 | Bacteria | 3732 |
| 50 | Ga0075367_10686353 | 3300006178 | Bacteria | 651 |
| 51 | Ga0075366_10019853 | 3300006195 | Bacteria | 3893 |
| 52 | Ga0075370_10002806 | 3300006353 | Bacteria | 8169 |
| 53 | Ga0075370_10642240 | 3300006353 | Bacteria | 644 |
| 54 | Ga0105244_10031057 | 3300009036 | Bacteria | 2837 |
| 55 | Ga0105240_10001761 | 3300009093 | Bacteria | 36533 |
| 56 | Ga0105248_10044345 | 3300009177 | Bacteria | 4987 |
| 57 | Ga0105248_12966100 | 3300009177 | Bacteria | 541 |
| 58 | Ga0105237_10001133 | 3300009545 | Bacteria | 35775 |
| 59 | Ga0123341_1000282 | 3300009765 | Bacteria | 28101 |
| 60 | Ga0123342_1010026 | 3300009766 | Bacteria | 11023 |
| 61 | Ga0123342_1018102 | 3300009766 | Bacteria | 5700 |
| 62 | Ga0105239_10023161 | 3300010375 | Bacteria | 6844 |
| 63 | Ga0157370_10001556 | 3300013104 | Bacteria | 28420 |
| 64 | Ga0157374_10092156 | 3300013296 | Bacteria | 2891 |
| 65 | Ga0182007_10003450 | 3300015262 | Bacteria | 7448 |
| 66 | Ga0182005_1004085 | 3300015265 | Bacteria | 4781 |
| 67 | Ga0209760_103175 | 3300025207 | Bacteria | 1471 |
| 68 | Ga0209436_100014 | 3300025208 | Bacteria | 127004 |
| 69 | Ga0209436_109209 | 3300025208 | Bacteria | 1903 |
| 70 | Ga0209437_100023 | 3300025233 | Bacteria | 614195 |
| 71 | Ga0207425_1001234 | 3300025245 | Bacteria | 11206 |
| 72 | Ga0207425_1002908 | 3300025245 | Bacteria | 5739 |
| 73 | Ga0209677_102943 | 3300025253 | Bacteria | 5947 |
| 74 | Ga0209129_1000167 | 3300025258 | Bacteria | 97701 |
| 75 | Ga0209129_1002720 | 3300025258 | Bacteria | 8286 |
| 76 | Ga0209129_1006603 | 3300025258 | Bacteria | 3692 |
| 77 | Ga0209129_1013161 | 3300025258 | Bacteria | 1841 |
| 78 | Ga0209233_1000219 | 3300025261 | Bacteria | 104797 |
| 79 | Ga0209233_1000345 | 3300025261 | Bacteria | 45341 |
| 80 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 81 | Ga0209673_1000341 | 3300025273 | Bacteria | 85808 |
| 82 | Ga0209673_1001119 | 3300025273 | Bacteria | 29848 |
| 83 | Ga0209673_1003671 | 3300025273 | Bacteria | 8855 |
| 84 | Ga0209673_1009269 | 3300025273 | Bacteria | 4287 |
| 85 | Ga0209673_1027066 | 3300025273 | Bacteria | 1871 |
| 86 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 87 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 88 | Ga0209675_1060276 | 3300025291 | Bacteria | 753 |
| 89 | Ga0209676_1095692 | 3300025292 | Bacteria | 643 |
| 90 | Ga0209025_1000695 | 3300025294 | Bacteria | 57400 |
| 91 | Ga0209025_1002595 | 3300025294 | Bacteria | 18674 |
| 92 | Ga0209025_1005846 | 3300025294 | Bacteria | 9841 |
| 93 | Ga0209025_1006552 | 3300025294 | Bacteria | 8988 |
| 94 | Ga0209025_1015638 | 3300025294 | Bacteria | 4554 |
| 95 | Ga0209564_1000807 | 3300025295 | Bacteria | 42868 |
| 96 | Ga0209564_1001512 | 3300025295 | Bacteria | 23269 |
| 97 | Ga0209564_1001590 | 3300025295 | Bacteria | 22195 |
| 98 | Ga0209564_1040410 | 3300025295 | Bacteria | 1267 |
| 99 | Ga0209758_1000598 | 3300025297 | Bacteria | 56164 |
| 100 | Ga0209758_1038265 | 3300025297 | Bacteria | 1841 |
| 101 | Ga0209758_1081891 | 3300025297 | Bacteria | 973 |
| 102 | Ga0209758_1083580 | 3300025297 | Bacteria | 957 |
| 103 | Ga0209256_1000308 | 3300025299 | Bacteria | 85808 |
| 104 | Ga0209256_1000769 | 3300025299 | Bacteria | 41649 |
| 105 | Ga0209256_1001491 | 3300025299 | Bacteria | 23822 |
| 106 | Ga0209256_1049305 | 3300025299 | Bacteria | 1026 |
| 107 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 108 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 109 | Ga0207426_1000039 | 3300025302 | Bacteria | 439937 |
| 110 | Ga0207426_1021139 | 3300025302 | Bacteria | 2252 |
| 111 | Ga0209051_1001029 | 3300025303 | Bacteria | 26488 |
| 112 | Ga0209257_1020425 | 3300025304 | Bacteria | 2449 |
| 113 | Ga0207655_1095736 | 3300025728 | Bacteria | 1034 |
| 114 | Ga0207655_1237308 | 3300025728 | Bacteria | 523 |
| 115 | Ga0207647_10402005 | 3300025904 | Bacteria | 772 |
| 116 | Ga0207695_10000842 | 3300025913 | Bacteria | 56321 |
| 117 | Ga0207671_10000903 | 3300025914 | Bacteria | 37499 |
| 118 | Ga0207694_10134245 | 3300025924 | Bacteria | 1986 |
| 119 | Ga0207709_11197397 | 3300025935 | Bacteria | 626 |
| 120 | Ga0207667_10018672 | 3300025949 | Bacteria | 7769 |
| 121 | Ga0207667_10900041 | 3300025949 | Bacteria | 877 |
| 122 | Ga0207668_11218928 | 3300025972 | Bacteria | 676 |
| 123 | Ga0207658_10076220 | 3300025986 | Bacteria | 2554 |
| 124 | Ga0207702_10106234 | 3300026078 | Bacteria | 2487 |
| 125 | Ga0207698_10037118 | 3300026142 | Bacteria | 3585 |
| 126 | Ga0209371_1000280 | 3300027312 | Bacteria | 58641 |
| 127 | Ga0209371_1001094 | 3300027312 | Bacteria | 20193 |
| 128 | Ga0209371_1002832 | 3300027312 | Bacteria | 9207 |
| 129 | Ga0209371_1003589 | 3300027312 | Bacteria | 7416 |
| 130 | Ga0209371_1018359 | 3300027312 | Bacteria | 1780 |
| 131 | Ga0209813_10033934 | 3300027866 | Bacteria | 1520 |
| 132 | Ga0209813_10274925 | 3300027866 | Bacteria | 647 |
| 133 | Ga0268266_10093869 | 3300028379 | Bacteria | 2633 |
| 134 | Ga0268266_10211619 | 3300028379 | Bacteria | 1778 |
| 135 | Ga0268265_10957254 | 3300028380 | Bacteria | 844 |
| 136 | Ga0307515_10022261 | 3300028794 | Bacteria | 11178 |
| 137 | Ga0268256_1000234 | 3300030500 | Bacteria | 58641 |
| 138 | Ga0268256_1001474 | 3300030500 | Bacteria | 14020 |
| 139 | Ga0268256_1002532 | 3300030500 | Bacteria | 9207 |
| 140 | Ga0268256_1015358 | 3300030500 | Bacteria | 2239 |
| 141 | Ga0268256_1015498 | 3300030500 | Bacteria | 2221 |
| 142 | Ga0307405_10000430 | 3300031731 | Bacteria | 15691 |
| 143 | Ga0307412_10160625 | 3300031911 | Bacteria | 1669 |
| 144 | Ga0307416_101513047 | 3300032002 | Bacteria | 777 |
| 145 | Ga0439436_0162432 | 3300041404 | Bacteria | 632 |
| 146 | Ga0439465_0041712 | 3300041413 | Bacteria | 1486 |
| 147 | Ga0451802_0705652 | 3300041460 | Bacteria | 1281 |
| 148 | Ga0451833_0512897 | 3300041491 | Bacteria | 2096 |
| 149 | Ga0451837_0890765 | 3300041494 | Bacteria | 4567 |
| 150 | Ga0451839_1006201 | 3300041496 | Bacteria | 5423 |
| 151 | Ga0451845_0414771 | 3300041501 | Bacteria | 604 |
| 152 | Ga0451845_0736367 | 3300041501 | Bacteria | 2512 |
| 153 | Ga0451847_0140940 | 3300041503 | Bacteria | 2847 |
| 154 | Ga0451849_0948916 | 3300041505 | Bacteria | 2861 |
| 155 | Ga0451851_0205427 | 3300041507 | Bacteria | 4145 |
| 156 | Ga0451851_1211284 | 3300041507 | Bacteria | 1860 |
| 157 | Ga0451843_0599589 | 3300041509 | Bacteria | 1552 |
| 158 | Ga0451855_0267958 | 3300041511 | Bacteria | 3114 |
| 159 | Ga0451853_0264502 | 3300041512 | Bacteria | 1550 |
| 160 | Ga0439431_0085232 | 3300041997 | Bacteria | 856 |
| 161 | Ga0495638_0000323 | 3300046460 | Bacteria | 60784 |
| 162 | Ga0495638_0109797 | 3300046460 | Bacteria | 1640 |
| 163 | Ga0495585_0022058 | 3300046492 | Bacteria | 3655 |
| 164 | Ga0495585_0027310 | 3300046492 | Bacteria | 3257 |
| 165 | Ga0495607_0116384 | 3300046501 | Bacteria | 1410 |
| 166 | Ga0495583_0049520 | 3300046506 | Bacteria | 1924 |
| 167 | Ga0495606_0000485 | 3300046507 | Bacteria | 65008 |
| 168 | Ga0495606_0011182 | 3300046507 | Bacteria | 7347 |
| 169 | Ga0495606_0094546 | 3300046507 | Bacteria | 1832 |
| 170 | Ga0495606_0239484 | 3300046507 | Bacteria | 1012 |
| 171 | Ga0495610_0041427 | 3300046512 | Bacteria | 2312 |
| 172 | Ga0495631_0081500 | 3300046518 | Bacteria | 1396 |
| 173 | Ga0495631_0093432 | 3300046518 | Bacteria | 1295 |
| 174 | Ga0495663_0043405 | 3300046525 | Bacteria | 1373 |
| 175 | Ga0495597_0118766 | 3300046542 | Bacteria | 1103 |
| 176 | Ga0495633_0013899 | 3300046558 | Bacteria | 4221 |
| 177 | Ga0495633_0163344 | 3300046558 | Bacteria | 1027 |
| 178 | Ga0495668_0041009 | 3300046616 | Bacteria | 2581 |
| 179 | Ga0495625_0005963 | 3300046660 | Bacteria | 10954 |
| 180 | Ga0495625_0019590 | 3300046660 | Bacteria | 5243 |
| 181 | Ga0495625_0633914 | 3300046660 | Bacteria | 638 |
| 182 | Ga0495625_0668884 | 3300046660 | Bacteria | 616 |
| 183 | Ga0495661_0039051 | 3300046665 | Bacteria | 2952 |
| 184 | Ga0495670_0045562 | 3300046691 | Bacteria | 2190 |
| 185 | Ga0495649_0217446 | 3300046694 | Bacteria | 989 |
| 186 | Ga0495636_0595718 | 3300047318 | Bacteria | 540 |
| 187 | Ga0495672_0010083 | 3300047320 | Bacteria | 6763 |
| 188 | Ga0495687_001125 | 3300047443 | Bacteria | 25971 |
| 189 | Ga0495679_074302 | 3300047446 | Bacteria | 974 |
| 190 | Ga0495673_0134277 | 3300047469 | Bacteria | 970 |
| 191 | Ga0495686_0072228 | 3300047472 | Bacteria | 2122 |
| 192 | Ga0495686_0198724 | 3300047472 | Bacteria | 1152 |
| 193 | Ga0495686_0404024 | 3300047472 | Bacteria | 733 |
| 194 | Ga0495686_0463655 | 3300047472 | Bacteria | 671 |
| 195 | Ga0496100_0017328 | 3300048903 | Bacteria | 4250 |
| 196 | Ga0496101_0790291 | 3300048904 | Bacteria | 748 |
| 197 | Ga0496102_0342606 | 3300048905 | Bacteria | 1407 |
| 198 | Ga0496103_0001155 | 3300048906 | Bacteria | 18233 |
| 199 | Ga0496105_0466035 | 3300048908 | Bacteria | 996 |
| 200 | Ga0496106_0000038 | 3300048909 | Bacteria | 111983 |
| 201 | Ga0496108_0215487 | 3300048911 | Bacteria | 1667 |
| 202 | Ga0496110_0009481 | 3300048913 | Bacteria | 7881 |
| 203 | Ga0496111_0117993 | 3300048914 | Bacteria | 1958 |
| 204 | Ga0496113_0477825 | 3300048916 | Bacteria | 1001 |
| 205 | Ga0496116_0065742 | 3300048919 | Bacteria | 2324 |
| 206 | Ga0496116_0065867 | 3300048919 | Bacteria | 2321 |
| 207 | Ga0496116_0078313 | 3300048919 | Bacteria | 2062 |
| 208 | Ga0496116_0099052 | 3300048919 | Bacteria | 1747 |
| 209 | Ga0496116_0364011 | 3300048919 | Bacteria | 656 |
| 210 | Ga0496117_0006094 | 3300048920 | Bacteria | 12348 |
| 211 | Ga0496117_0065712 | 3300048920 | Bacteria | 2464 |
| 212 | Ga0496118_0015803 | 3300048921 | Bacteria | 6962 |
| 213 | Ga0496118_0113916 | 3300048921 | Bacteria | 1785 |
| 214 | Ga0496119_0047648 | 3300048922 | Bacteria | 2664 |
| 215 | Ga0496120_0017520 | 3300048923 | Bacteria | 4641 |
| 216 | Ga0496120_0131865 | 3300048923 | Bacteria | 1279 |
| 217 | Ga0496121_0003855 | 3300048924 | Bacteria | 20864 |
| 218 | Ga0496121_0006197 | 3300048924 | Bacteria | 14994 |
| 219 | Ga0496121_0007782 | 3300048924 | Bacteria | 12834 |
| 220 | Ga0496121_0023389 | 3300048924 | Bacteria | 5953 |
| 221 | Ga0496121_0101002 | 3300048924 | Bacteria | 2226 |
| 222 | Ga0496122_0000462 | 3300048925 | Bacteria | 84546 |
| 223 | Ga0496122_0011645 | 3300048925 | Bacteria | 8868 |
| 224 | Ga0496122_0092096 | 3300048925 | Bacteria | 2062 |
| 225 | Ga0496123_0000048 | 3300048926 | Bacteria | 244152 |
| 226 | Ga0496123_0013941 | 3300048926 | Bacteria | 6697 |
| 227 | Ga0496123_0062559 | 3300048926 | Bacteria | 2384 |
| 228 | Ga0496124_0021877 | 3300048927 | Bacteria | 5882 |
| 229 | Ga0496124_0394186 | 3300048927 | Bacteria | 963 |
| 230 | Ga0496124_0732771 | 3300048927 | Bacteria | 622 |
| 231 | Ga0496125_0009162 | 3300048928 | Bacteria | 10230 |
| 232 | Ga0496125_0047511 | 3300048928 | Bacteria | 3588 |
| 233 | Ga0496125_0070486 | 3300048928 | Bacteria | 2736 |
| 234 | Ga0496126_0308867 | 3300048929 | Bacteria | 1302 |
| 235 | Ga0495682_0293428 | 3300049460 | Bacteria | 574 |
| 236 | Ga0501033_0700540 | 3300049570 | Bacteria | 689 |
| 237 | Ga0501034_0297730 | 3300049571 | Bacteria | 1550 |
| 238 | Ga0501036_0140203 | 3300049572 | Bacteria | 2040 |
| 239 | Ga0501038_0086706 | 3300049574 | Bacteria | 2630 |
| 240 | Ga0501039_0034120 | 3300049575 | Bacteria | 3927 |
| 241 | Ga0501068_0330057 | 3300049584 | Bacteria | 979 |
| 242 | Ga0501073_0089250 | 3300049589 | Bacteria | 2143 |
| 243 | Ga0501074_0119843 | 3300049590 | Bacteria | 1882 |
| 244 | Ga0501035_0118163 | 3300049822 | Bacteria | 2320 |
| 245 | nmdc:mga03683_12148_c1 | 3300050489 | Bacteria | 3138 |
| 246 | nmdc:mga03n38_182566_c1 | 3300050490 | Bacteria | 1076 |
| 247 | nmdc:mga0yw44_103865_c1 | 3300050492 | Bacteria | 1813 |
| 248 | nmdc:mga0yw44_11627_c1 | 3300050492 | Bacteria | 4555 |
| 249 | nmdc:mga0k408_42482_c1 | 3300050493 | Bacteria | 2619 |
| 250 | nmdc:mga06z11_130508_c1 | 3300050494 | Bacteria | 1411 |
| 251 | nmdc:mga06z11_694092_c1 | 3300050494 | Bacteria | 620 |
| 252 | nmdc:mga04h51_307110_c1 | 3300050495 | Bacteria | 648 |
| 253 | nmdc:mga07m45_552485_c1 | 3300050496 | Bacteria | 666 |
| 254 | Ga0500610_0229379 | 3300053079 | Bacteria | 872 |
| 255 | Ga0500658_0026682 | 3300053134 | Bacteria | 2227 |
| 256 | Ga0500568_0000280 | 3300053139 | Bacteria | 42298 |
| 257 | Ga0500568_0000424 | 3300053139 | Bacteria | 31935 |
| 258 | Ga0500573_0000575 | 3300053140 | Bacteria | 16057 |
| 259 | Ga0500604_0133656 | 3300053151 | Bacteria | 835 |
| 260 | Ga0500606_085435 | 3300053152 | Bacteria | 1068 |
| 261 | Ga0500616_0001884 | 3300053153 | Bacteria | 18878 |
| 262 | Ga0500622_0000170 | 3300053156 | Bacteria | 70088 |
| 263 | Ga0500622_0349880 | 3300053156 | Bacteria | 614 |
| 264 | Ga0500633_0000432 | 3300053160 | Bacteria | 6576 |
| 265 | Ga0500638_000485 | 3300053162 | Bacteria | 9739 |
| 266 | Ga0500636_0120936 | 3300053177 | Bacteria | 1469 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053079 | Ga0500610_0229379 | Ga0500610_0229379_28_411 | 121 |
| 2 | iso_pu_bacteria | 2509276021 | 2509392438 | 136 |
| 3 | iso_pu_bacteria | 2513237088 | 2513599441 | 136 |
| 4 | iso_pu_bacteria | 2513237138 | 2513865395 | 136 |
| 5 | iso_pu_bacteria | 2513237144 | 2513914505 | 136 |
| 6 | iso_pu_bacteria | 2513237146 | 2513928246 | 136 |
| 7 | iso_pu_bacteria | 2515075009 | 2515112524 | 136 |
| 8 | iso_pu_bacteria | 2519899620 | 2520378589 | 136 |
| 9 | iso_pu_bacteria | 2582581299 | 2585228617 | 136 |
| 10 | iso_pu_bacteria | 2582581308 | 2585281291 | 136 |
| 11 | iso_pu_bacteria | 2582581308 | 2585282729 | 136 |
| 12 | iso_pu_bacteria | 2582581315 | 2585325164 | 136 |
| 13 | iso_pu_bacteria | 2582581316 | 2585336419 | 136 |
| 14 | iso_pu_bacteria | 2585427527 | 2585535513 | 136 |
| 15 | iso_pu_bacteria | 2585427530 | 2585556127 | 136 |
| 16 | iso_pu_bacteria | 2599185156 | 2599331671 | 136 |
| 17 | iso_pu_bacteria | 2599185156 | 2599335633 | 136 |
| 18 | iso_pu_bacteria | 2599185170 | 2599416861 | 136 |
| 19 | iso_pu_bacteria | 2599185210 | 2599602701 | 136 |
| 20 | iso_pu_bacteria | 2599185236 | 2599723361 | 136 |
| 21 | iso_pu_bacteria | 2615840626 | 2616310403 | 136 |
| 22 | iso_pu_bacteria | 2643221599 | 2644005706 | 136 |
| 23 | iso_pu_bacteria | 2643221618 | 2644109410 | 136 |
| 24 | iso_pu_bacteria | 2643221626 | 2644145095 | 136 |
| 25 | iso_pu_bacteria | 2643221655 | 2644307675 | 136 |
| 26 | iso_pu_bacteria | 2643221659 | 2644332451 | 136 |
| 27 | iso_pu_bacteria | 2643221698 | 2644544198 | 136 |
| 28 | iso_pu_bacteria | 2643221712 | 2644613764 | 136 |
| 29 | iso_pu_bacteria | 2643221723 | 2644672968 | 136 |
| 30 | iso_pu_bacteria | 2718218365 | 2721158999 | 136 |
| 31 | iso_pu_bacteria | 2721755556 | 2723027786 | 136 |
| 32 | iso_pu_bacteria | 2721755684 | 2723561415 | 136 |
| 33 | iso_pu_bacteria | 2728369352 | 2730108722 | 136 |
| 34 | iso_pu_bacteria | 2728369397 | 2730298631 | 136 |
| 35 | iso_pu_bacteria | 2791355256 | 2793294877 | 136 |
| 36 | iso_pu_bacteria | 2791355262 | 2793335857 | 136 |
| 37 | iso_pu_bacteria | 2791355265 | 2793352870 | 136 |
| 38 | iso_pu_bacteria | 2818991453 | 2819641525 | 136 |
| 39 | iso_pu_bacteria | 2838022645 | 2838022800 | 136 |
| 40 | iso_pu_bacteria | 2838035591 | 2838041809 | 136 |
| 41 | iso_pu_bacteria | 2838042994 | 2838044443 | 136 |
| 42 | iso_pu_bacteria | 2841864319 | 2841864340 | 136 |
| 43 | iso_pu_bacteria | 2842198810 | 2842201373 | 136 |
| 44 | iso_pu_bacteria | 2842205361 | 2842205838 | 136 |
| 45 | iso_pu_bacteria | 2842278818 | 2842279295 | 136 |
| 46 | iso_pu_bacteria | 2842341865 | 2842345312 | 136 |
| 47 | iso_pu_bacteria | 2842395702 | 2842398875 | 136 |
| 48 | iso_pu_bacteria | 2844163670 | 2844170285 | 136 |
| 49 | iso_pu_bacteria | 2923556063 | 2923556208 | 136 |
| 50 | iso_pu_bacteria | 2933016740 | 2933019854 | 136 |
| 51 | iso_pu_bacteria | 2936367885 | 2936372487 | 136 |
| 52 | iso_pu_bacteria | 2936375103 | 2936376522 | 136 |
| 53 | iso_pu_bacteria | 2979100975 | 2979103090 | 136 |
| 54 | iso_pu_bacteria | 2984509177 | 2984513870 | 136 |
| 55 | iso_pu_bacteria | 2984518228 | 2984523417 | 136 |
| 56 | iso_pu_bacteria | 2984537506 | 2984542562 | 136 |
| 57 | iso_pu_bacteria | 2984601300 | 2984606508 | 136 |
| 58 | iso_pu_bacteria | 2989771324 | 2989772250 | 136 |
| 59 | iso_pu_bacteria | 3005409236 | 3005411968 | 136 |
| 60 | iso_pu_bacteria | 8005289223 | 8005293278 | 136 |
| 61 | iso_pu_bacteria | 8005376324 | 8005379436 | 136 |
| 62 | iso_pu_bacteria | 8005460587 | 8005463197 | 136 |
| 63 | iso_pu_bacteria | 8005688590 | 8005694772 | 136 |
| 64 | iso_pu_bacteria | 8024486573 | 8024486766 | 136 |
| 65 | 3300005331 | Ga0070670_100016136 | Ga0070670_1000161366 | 138 |
| 66 | 3300005331 | Ga0070670_101293348 | Ga0070670_1012933481 | 138 |
| 67 | 3300005564 | Ga0070664_101375141 | Ga0070664_1013751411 | 138 |
| 68 | 3300031911 | Ga0307412_10160625 | Ga0307412_101606251 | 138 |
| 69 | iso_pu_bacteria | 2510065019 | 2510133544 | 138 |
| 70 | iso_pu_bacteria | 2510461076 | 2510894925 | 138 |
| 71 | iso_pu_bacteria | 2510917030 | 2511195871 | 138 |
| 72 | iso_pu_bacteria | 2513237093 | 2513629855 | 138 |
| 73 | iso_pu_bacteria | 2513237103 | 2513708489 | 138 |
| 74 | iso_pu_bacteria | 2513237162 | 2514022049 | 138 |
| 75 | iso_pu_bacteria | 2515154113 | 2515632864 | 138 |
| 76 | iso_pu_bacteria | 2515154114 | 2515640009 | 138 |
| 77 | iso_pu_bacteria | 2515154116 | 2515655795 | 138 |
| 78 | iso_pu_bacteria | 2516653077 | 2517036250 | 138 |
| 79 | iso_pu_bacteria | 2517093000 | 2517095387 | 138 |
| 80 | iso_pu_bacteria | 2517287029 | 2517406987 | 138 |
| 81 | iso_pu_bacteria | 2582581298 | 2585226613 | 138 |
| 82 | iso_pu_bacteria | 2585427528 | 2585537734 | 138 |
| 83 | iso_pu_bacteria | 2585427529 | 2585549687 | 138 |
| 84 | iso_pu_bacteria | 2585427593 | 2585835684 | 138 |
| 85 | iso_pu_bacteria | 2643221599 | 2644005749 | 138 |
| 86 | iso_pu_bacteria | 2724679232 | 2725950486 | 138 |
| 87 | iso_pu_bacteria | 2738541333 | 2739032391 | 138 |
| 88 | iso_pu_bacteria | 2765235942 | 2766066911 | 138 |
| 89 | iso_pu_bacteria | 2791355263 | 2793341718 | 138 |
| 90 | iso_pu_bacteria | 2802429633 | 2806043366 | 138 |
| 91 | iso_pu_bacteria | 2802429634 | 2806050700 | 138 |
| 92 | iso_pu_bacteria | 2802429635 | 2806057517 | 138 |
| 93 | iso_pu_bacteria | 2802429636 | 2806064899 | 138 |
| 94 | iso_pu_bacteria | 2802429637 | 2806072165 | 138 |
| 95 | iso_pu_bacteria | 2842110456 | 2842114181 | 138 |
| 96 | iso_pu_bacteria | 2842217011 | 2842217481 | 138 |
| 97 | iso_pu_bacteria | 2852387548 | 2852390002 | 138 |
| 98 | iso_pu_bacteria | 2857516855 | 2857519928 | 138 |
| 99 | iso_pu_bacteria | 2919100787 | 2919106116 | 138 |
| 100 | iso_pu_bacteria | 2933586486 | 2933590277 | 138 |
| 101 | iso_pu_bacteria | 2936381700 | 2936387298 | 138 |
| 102 | iso_pu_bacteria | 3005409236 | 3005415009 | 138 |
| 103 | iso_pu_bacteria | 3005416602 | 3005423018 | 138 |
| 104 | iso_pu_bacteria | 3005445848 | 3005447806 | 138 |
| 105 | iso_pu_bacteria | 639633055 | 639648765 | 138 |
| 106 | iso_pu_bacteria | 8005314921 | 8005315345 | 138 |
| 107 | iso_pu_bacteria | 8005556819 | 8005557481 | 138 |
| 108 | iso_pu_bacteria | 8005563573 | 8005568658 | 138 |
| 109 | iso_pu_bacteria | 8005570704 | 8005574447 | 138 |
| 110 | iso_pu_bacteria | 8005682033 | 8005685323 | 138 |
| 111 | iso_pu_bacteria | 8018163183 | 8018166568 | 138 |
| 112 | iso_pu_bacteria | 8024486573 | 8024488358 | 138 |
| 113 | iso_pu_bacteria | 8056875544 | 8056879120 | 138 |
| 114 | iso_pu_bacteria | 8057575449 | 8057580471 | 138 |
| 115 | iso_pu_bacteria | 8057874678 | 8057874820 | 138 |
| 116 | 3300046507 | Ga0495606_0011182 | Ga0495606_0011182_4711_5136 | 139 |
| 117 | 3300002737 | JGI25162J39368_1000481 | JGI25162J39368_100048115 | 140 |
| 118 | 3300002739 | JGI25158J39367_1000149 | JGI25158J39367_100014910 | 140 |
| 119 | 3300002774 | JGI25150J39212_1021308 | JGI25150J39212_10213082 | 140 |
| 120 | 3300002987 | JGI25159J45721_1000183 | JGI25159J45721_100018313 | 140 |
| 121 | 3300002987 | JGI25159J45721_1000251 | JGI25159J45721_100025127 | 140 |
| 122 | 3300003187 | JGI25151J46595_10000282 | JGI25151J46595_1000028243 | 140 |
| 123 | 3300003187 | JGI25151J46595_10015235 | JGI25151J46595_100152355 | 140 |
| 124 | 3300003214 | JGI25165J46597_1002127 | JGI25165J46597_10021272 | 140 |
| 125 | 3300003214 | JGI25165J46597_1021663 | JGI25165J46597_10216632 | 140 |
| 126 | 3300003215 | JGI25153J46596_10010822 | JGI25153J46596_100108224 | 140 |
| 127 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001289 | 140 |
| 128 | 3300003354 | JGI25160J50197_1002049 | JGI25160J50197_10020496 | 140 |
| 129 | 3300003354 | JGI25160J50197_1004330 | JGI25160J50197_10043304 | 140 |
| 130 | 3300003354 | JGI25160J50197_1095059 | JGI25160J50197_10950591 | 140 |
| 131 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001473 | 140 |
| 132 | 3300003374 | JGI25161J50226_1000295 | JGI25161J50226_100029510 | 140 |
| 133 | 3300003374 | JGI25161J50226_1003455 | JGI25161J50226_10034553 | 140 |
| 134 | 3300003771 | Ga0055526_1002502 | Ga0055526_100250221 | 140 |
| 135 | 3300003771 | Ga0055526_1012763 | Ga0055526_10127635 | 140 |
| 136 | 3300003775 | Ga0055524_1002083 | Ga0055524_10020834 | 140 |
| 137 | 3300003775 | Ga0055524_1027970 | Ga0055524_10279702 | 140 |
| 138 | 3300003790 | Ga0055528_1000064 | Ga0055528_100006438 | 140 |
| 139 | 3300003790 | Ga0055528_1002295 | Ga0055528_10022953 | 140 |
| 140 | 3300003790 | Ga0055528_1011180 | Ga0055528_10111803 | 140 |
| 141 | 3300003790 | Ga0055528_1027997 | Ga0055528_10279972 | 140 |
| 142 | 3300003792 | Ga0055540_1006691 | Ga0055540_10066916 | 140 |
| 143 | 3300003856 | Ga0058692_1002907 | Ga0058692_10029073 | 140 |
| 144 | 3300004625 | Ga0055543_1000066 | Ga0055543_100006697 | 140 |
| 145 | 3300004625 | Ga0055543_1000089 | Ga0055543_100008948 | 140 |
| 146 | 3300004625 | Ga0055543_1001222 | Ga0055543_10012225 | 140 |
| 147 | 3300005262 | Ga0065165_1000008 | Ga0065165_1000008168 | 140 |
| 148 | 3300005262 | Ga0065165_1006873 | Ga0065165_10068735 | 140 |
| 149 | 3300005262 | Ga0065165_1008827 | Ga0065165_10088277 | 140 |
| 150 | 3300005262 | Ga0065165_1022864 | Ga0065165_10228642 | 140 |
| 151 | 3300005337 | Ga0070682_100613481 | Ga0070682_1006134812 | 140 |
| 152 | 3300005355 | Ga0070671_100033364 | Ga0070671_1000333646 | 140 |
| 153 | 3300005367 | Ga0070667_100105126 | Ga0070667_1001051265 | 140 |
| 154 | 3300005548 | Ga0070665_100265416 | Ga0070665_1002654162 | 140 |
| 155 | 3300005563 | Ga0068855_100218738 | Ga0068855_1002187383 | 140 |
| 156 | 3300005616 | Ga0068852_100058602 | Ga0068852_1000586023 | 140 |
| 157 | 3300006038 | Ga0075365_10098754 | Ga0075365_100987542 | 140 |
| 158 | 3300006042 | Ga0075368_10009721 | Ga0075368_100097212 | 140 |
| 159 | 3300006042 | Ga0075368_10038030 | Ga0075368_100380303 | 140 |
| 160 | 3300006048 | Ga0075363_100132121 | Ga0075363_1001321212 | 140 |
| 161 | 3300006178 | Ga0075367_10000754 | Ga0075367_100007546 | 140 |
| 162 | 3300006178 | Ga0075367_10019863 | Ga0075367_100198635 | 140 |
| 163 | 3300006178 | Ga0075367_10686353 | Ga0075367_106863532 | 140 |
| 164 | 3300006195 | Ga0075366_10019853 | Ga0075366_100198535 | 140 |
| 165 | 3300006353 | Ga0075370_10002806 | Ga0075370_100028069 | 140 |
| 166 | 3300006353 | Ga0075370_10642240 | Ga0075370_106422402 | 140 |
| 167 | 3300009036 | Ga0105244_10031057 | Ga0105244_100310573 | 140 |
| 168 | 3300009093 | Ga0105240_10001761 | Ga0105240_1000176128 | 140 |
| 169 | 3300009177 | Ga0105248_10044345 | Ga0105248_100443456 | 140 |
| 170 | 3300009177 | Ga0105248_12966100 | Ga0105248_129661001 | 140 |
| 171 | 3300009545 | Ga0105237_10001133 | Ga0105237_1000113327 | 140 |
| 172 | 3300009765 | Ga0123341_1000282 | Ga0123341_100028234 | 140 |
| 173 | 3300009766 | Ga0123342_1010026 | Ga0123342_10100269 | 140 |
| 174 | 3300009766 | Ga0123342_1018102 | Ga0123342_10181026 | 140 |
| 175 | 3300010375 | Ga0105239_10023161 | Ga0105239_100231617 | 140 |
| 176 | 3300013104 | Ga0157370_10001556 | Ga0157370_1000155622 | 140 |
| 177 | 3300013296 | Ga0157374_10092156 | Ga0157374_100921562 | 140 |
| 178 | 3300015262 | Ga0182007_10003450 | Ga0182007_100034507 | 140 |
| 179 | 3300015265 | Ga0182005_1004085 | Ga0182005_10040854 | 140 |
| 180 | 3300025207 | Ga0209760_103175 | Ga0209760_1031752 | 140 |
| 181 | 3300025208 | Ga0209436_100014 | Ga0209436_10001474 | 140 |
| 182 | 3300025208 | Ga0209436_109209 | Ga0209436_1092092 | 140 |
| 183 | 3300025233 | Ga0209437_100023 | Ga0209437_10002336 | 140 |
| 184 | 3300025245 | Ga0207425_1001234 | Ga0207425_100123411 | 140 |
| 185 | 3300025245 | Ga0207425_1002908 | Ga0207425_10029088 | 140 |
| 186 | 3300025253 | Ga0209677_102943 | Ga0209677_1029437 | 140 |
| 187 | 3300025258 | Ga0209129_1000167 | Ga0209129_100016749 | 140 |
| 188 | 3300025258 | Ga0209129_1002720 | Ga0209129_10027208 | 140 |
| 189 | 3300025258 | Ga0209129_1006603 | Ga0209129_10066032 | 140 |
| 190 | 3300025258 | Ga0209129_1013161 | Ga0209129_10131612 | 140 |
| 191 | 3300025261 | Ga0209233_1000219 | Ga0209233_100021936 | 140 |
| 192 | 3300025261 | Ga0209233_1000345 | Ga0209233_100034537 | 140 |
| 193 | 3300025273 | Ga0209673_1000013 | Ga0209673_1000013236 | 140 |
| 194 | 3300025273 | Ga0209673_1000341 | Ga0209673_100034141 | 140 |
| 195 | 3300025273 | Ga0209673_1001119 | Ga0209673_100111917 | 140 |
| 196 | 3300025273 | Ga0209673_1003671 | Ga0209673_10036717 | 140 |
| 197 | 3300025273 | Ga0209673_1009269 | Ga0209673_10092696 | 140 |
| 198 | 3300025273 | Ga0209673_1027066 | Ga0209673_10270662 | 140 |
| 199 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003486 | 140 |
| 200 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004566 | 140 |
| 201 | 3300025291 | Ga0209675_1060276 | Ga0209675_10602761 | 140 |
| 202 | 3300025292 | Ga0209676_1095692 | Ga0209676_10956922 | 140 |
| 203 | 3300025294 | Ga0209025_1000695 | Ga0209025_100069558 | 140 |
| 204 | 3300025294 | Ga0209025_1002595 | Ga0209025_100259522 | 140 |
| 205 | 3300025294 | Ga0209025_1005846 | Ga0209025_10058462 | 140 |
| 206 | 3300025294 | Ga0209025_1006552 | Ga0209025_10065528 | 140 |
| 207 | 3300025294 | Ga0209025_1015638 | Ga0209025_10156383 | 140 |
| 208 | 3300025295 | Ga0209564_1000807 | Ga0209564_100080729 | 140 |
| 209 | 3300025295 | Ga0209564_1001512 | Ga0209564_100151211 | 140 |
| 210 | 3300025295 | Ga0209564_1001590 | Ga0209564_100159023 | 140 |
| 211 | 3300025295 | Ga0209564_1040410 | Ga0209564_10404102 | 140 |
| 212 | 3300025297 | Ga0209758_1000598 | Ga0209758_10005988 | 140 |
| 213 | 3300025297 | Ga0209758_1038265 | Ga0209758_10382652 | 140 |
| 214 | 3300025297 | Ga0209758_1081891 | Ga0209758_10818912 | 140 |
| 215 | 3300025297 | Ga0209758_1083580 | Ga0209758_10835802 | 140 |
| 216 | 3300025299 | Ga0209256_1000308 | Ga0209256_100030841 | 140 |
| 217 | 3300025299 | Ga0209256_1000769 | Ga0209256_100076945 | 140 |
| 218 | 3300025299 | Ga0209256_1001491 | Ga0209256_100149114 | 140 |
| 219 | 3300025299 | Ga0209256_1049305 | Ga0209256_10493052 | 140 |
| 220 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003160 | 140 |
| 221 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011290 | 140 |
| 222 | 3300025302 | Ga0207426_1000039 | Ga0207426_1000039315 | 140 |
| 223 | 3300025302 | Ga0207426_1021139 | Ga0207426_10211392 | 140 |
| 224 | 3300025303 | Ga0209051_1001029 | Ga0209051_100102919 | 140 |
| 225 | 3300025304 | Ga0209257_1020425 | Ga0209257_10204252 | 140 |
| 226 | 3300025728 | Ga0207655_1095736 | Ga0207655_10957362 | 140 |
| 227 | 3300025728 | Ga0207655_1237308 | Ga0207655_12373081 | 140 |
| 228 | 3300025904 | Ga0207647_10402005 | Ga0207647_104020052 | 140 |
| 229 | 3300025913 | Ga0207695_10000842 | Ga0207695_1000084229 | 140 |
| 230 | 3300025914 | Ga0207671_10000903 | Ga0207671_1000090329 | 140 |
| 231 | 3300025924 | Ga0207694_10134245 | Ga0207694_101342453 | 140 |
| 232 | 3300025935 | Ga0207709_11197397 | Ga0207709_111973972 | 140 |
| 233 | 3300025949 | Ga0207667_10018672 | Ga0207667_100186723 | 140 |
| 234 | 3300025949 | Ga0207667_10900041 | Ga0207667_109000412 | 140 |
| 235 | 3300025972 | Ga0207668_11218928 | Ga0207668_112189281 | 140 |
| 236 | 3300025986 | Ga0207658_10076220 | Ga0207658_100762201 | 140 |
| 237 | 3300026078 | Ga0207702_10106234 | Ga0207702_101062343 | 140 |
| 238 | 3300026142 | Ga0207698_10037118 | Ga0207698_100371183 | 140 |
| 239 | 3300027312 | Ga0209371_1000280 | Ga0209371_100028019 | 140 |
| 240 | 3300027312 | Ga0209371_1001094 | Ga0209371_100109411 | 140 |
| 241 | 3300027312 | Ga0209371_1002832 | Ga0209371_10028328 | 140 |
| 242 | 3300027312 | Ga0209371_1003589 | Ga0209371_10035893 | 140 |
| 243 | 3300027312 | Ga0209371_1018359 | Ga0209371_10183593 | 140 |
| 244 | 3300027866 | Ga0209813_10033934 | Ga0209813_100339341 | 140 |
| 245 | 3300027866 | Ga0209813_10274925 | Ga0209813_102749252 | 140 |
| 246 | 3300028379 | Ga0268266_10093869 | Ga0268266_100938693 | 140 |
| 247 | 3300028379 | Ga0268266_10211619 | Ga0268266_102116192 | 140 |
| 248 | 3300028380 | Ga0268265_10957254 | Ga0268265_109572542 | 140 |
| 249 | 3300028794 | Ga0307515_10022261 | Ga0307515_100222616 | 140 |
| 250 | 3300030500 | Ga0268256_1000234 | Ga0268256_100023437 | 140 |
| 251 | 3300030500 | Ga0268256_1001474 | Ga0268256_100147411 | 140 |
| 252 | 3300030500 | Ga0268256_1002532 | Ga0268256_10025324 | 140 |
| 253 | 3300030500 | Ga0268256_1015358 | Ga0268256_10153583 | 140 |
| 254 | 3300030500 | Ga0268256_1015498 | Ga0268256_10154985 | 140 |
| 255 | 3300031731 | Ga0307405_10000430 | Ga0307405_1000043014 | 140 |
| 256 | 3300032002 | Ga0307416_101513047 | Ga0307416_1015130472 | 140 |
| 257 | 3300041404 | Ga0439436_0162432 | Ga0439436_0162432_136_558 | 140 |
| 258 | 3300041413 | Ga0439465_0041712 | Ga0439465_0041712_610_1032 | 140 |
| 259 | 3300041460 | Ga0451802_0705652 | Ga0451802_0705652_425_853 | 140 |
| 260 | 3300041491 | Ga0451833_0512897 | Ga0451833_0512897_1479_1907 | 140 |
| 261 | 3300041494 | Ga0451837_0890765 | Ga0451837_0890765_2032_2460 | 140 |
| 262 | 3300041496 | Ga0451839_1006201 | Ga0451839_1006201_864_1292 | 140 |
| 263 | 3300041501 | Ga0451845_0414771 | Ga0451845_0414771_24_452 | 140 |
| 264 | 3300041501 | Ga0451845_0736367 | Ga0451845_0736367_1932_2360 | 140 |
| 265 | 3300041503 | Ga0451847_0140940 | Ga0451847_0140940_1087_1515 | 140 |
| 266 | 3300041505 | Ga0451849_0948916 | Ga0451849_0948916_1932_2360 | 140 |
| 267 | 3300041507 | Ga0451851_0205427 | Ga0451851_0205427_2584_3012 | 140 |
| 268 | 3300041507 | Ga0451851_1211284 | Ga0451851_1211284_1064_1486 | 140 |
| 269 | 3300041509 | Ga0451843_0599589 | Ga0451843_0599589_848_1276 | 140 |
| 270 | 3300041511 | Ga0451855_0267958 | Ga0451855_0267958_1717_2145 | 140 |
| 271 | 3300041512 | Ga0451853_0264502 | Ga0451853_0264502_417_845 | 140 |
| 272 | 3300041997 | Ga0439431_0085232 | Ga0439431_0085232_241_663 | 140 |
| 273 | 3300046460 | Ga0495638_0000323 | Ga0495638_0000323_41825_42247 | 140 |
| 274 | 3300046460 | Ga0495638_0109797 | Ga0495638_0109797_173_601 | 140 |
| 275 | 3300046492 | Ga0495585_0022058 | Ga0495585_0022058_1159_1587 | 140 |
| 276 | 3300046492 | Ga0495585_0027310 | Ga0495585_0027310_466_888 | 140 |
| 277 | 3300046501 | Ga0495607_0116384 | Ga0495607_0116384_544_972 | 140 |
| 278 | 3300046506 | Ga0495583_0049520 | Ga0495583_0049520_245_673 | 140 |
| 279 | 3300046507 | Ga0495606_0000485 | Ga0495606_0000485_38672_39100 | 140 |
| 280 | 3300046507 | Ga0495606_0094546 | Ga0495606_0094546_616_1044 | 140 |
| 281 | 3300046507 | Ga0495606_0239484 | Ga0495606_0239484_20_442 | 140 |
| 282 | 3300046512 | Ga0495610_0041427 | Ga0495610_0041427_1865_2287 | 140 |
| 283 | 3300046518 | Ga0495631_0081500 | Ga0495631_0081500_29_457 | 140 |
| 284 | 3300046518 | Ga0495631_0093432 | Ga0495631_0093432_780_1202 | 140 |
| 285 | 3300046525 | Ga0495663_0043405 | Ga0495663_0043405_534_956 | 140 |
| 286 | 3300046542 | Ga0495597_0118766 | Ga0495597_0118766_307_729 | 140 |
| 287 | 3300046558 | Ga0495633_0013899 | Ga0495633_0013899_3714_4142 | 140 |
| 288 | 3300046558 | Ga0495633_0163344 | Ga0495633_0163344_384_806 | 140 |
| 289 | 3300046616 | Ga0495668_0041009 | Ga0495668_0041009_571_993 | 140 |
| 290 | 3300046660 | Ga0495625_0005963 | Ga0495625_0005963_10327_10755 | 140 |
| 291 | 3300046660 | Ga0495625_0019590 | Ga0495625_0019590_3826_4248 | 140 |
| 292 | 3300046660 | Ga0495625_0633914 | Ga0495625_0633914_197_619 | 140 |
| 293 | 3300046660 | Ga0495625_0668884 | Ga0495625_0668884_143_565 | 140 |
| 294 | 3300046665 | Ga0495661_0039051 | Ga0495661_0039051_643_1071 | 140 |
| 295 | 3300046691 | Ga0495670_0045562 | Ga0495670_0045562_173_601 | 140 |
| 296 | 3300046694 | Ga0495649_0217446 | Ga0495649_0217446_85_507 | 140 |
| 297 | 3300047318 | Ga0495636_0595718 | Ga0495636_0595718_76_498 | 140 |
| 298 | 3300047320 | Ga0495672_0010083 | Ga0495672_0010083_6040_6462 | 140 |
| 299 | 3300047443 | Ga0495687_001125 | Ga0495687_001125_20097_20519 | 140 |
| 300 | 3300047446 | Ga0495679_074302 | Ga0495679_074302_459_887 | 140 |
| 301 | 3300047469 | Ga0495673_0134277 | Ga0495673_0134277_18_440 | 140 |
| 302 | 3300047472 | Ga0495686_0072228 | Ga0495686_0072228_117_539 | 140 |
| 303 | 3300047472 | Ga0495686_0198724 | Ga0495686_0198724_687_1115 | 140 |
| 304 | 3300047472 | Ga0495686_0404024 | Ga0495686_0404024_26_448 | 140 |
| 305 | 3300047472 | Ga0495686_0463655 | Ga0495686_0463655_37_459 | 140 |
| 306 | 3300048903 | Ga0496100_0017328 | Ga0496100_0017328_1235_1657 | 140 |
| 307 | 3300048904 | Ga0496101_0790291 | Ga0496101_0790291_208_630 | 140 |
| 308 | 3300048905 | Ga0496102_0342606 | Ga0496102_0342606_38_460 | 140 |
| 309 | 3300048906 | Ga0496103_0001155 | Ga0496103_0001155_255_677 | 140 |
| 310 | 3300048908 | Ga0496105_0466035 | Ga0496105_0466035_259_681 | 140 |
| 311 | 3300048909 | Ga0496106_0000038 | Ga0496106_0000038_111017_111445 | 140 |
| 312 | 3300048911 | Ga0496108_0215487 | Ga0496108_0215487_1049_1477 | 140 |
| 313 | 3300048913 | Ga0496110_0009481 | Ga0496110_0009481_5959_6387 | 140 |
| 314 | 3300048914 | Ga0496111_0117993 | Ga0496111_0117993_896_1324 | 140 |
| 315 | 3300048916 | Ga0496113_0477825 | Ga0496113_0477825_176_598 | 140 |
| 316 | 3300048919 | Ga0496116_0065742 | Ga0496116_0065742_1753_2175 | 140 |
| 317 | 3300048919 | Ga0496116_0065867 | Ga0496116_0065867_884_1312 | 140 |
| 318 | 3300048919 | Ga0496116_0078313 | Ga0496116_0078313_499_927 | 140 |
| 319 | 3300048919 | Ga0496116_0099052 | Ga0496116_0099052_1068_1490 | 140 |
| 320 | 3300048919 | Ga0496116_0364011 | Ga0496116_0364011_192_620 | 140 |
| 321 | 3300048920 | Ga0496117_0006094 | Ga0496117_0006094_8050_8472 | 140 |
| 322 | 3300048920 | Ga0496117_0065712 | Ga0496117_0065712_1442_1870 | 140 |
| 323 | 3300048921 | Ga0496118_0015803 | Ga0496118_0015803_2953_3375 | 140 |
| 324 | 3300048921 | Ga0496118_0113916 | Ga0496118_0113916_908_1336 | 140 |
| 325 | 3300048922 | Ga0496119_0047648 | Ga0496119_0047648_1570_1992 | 140 |
| 326 | 3300048923 | Ga0496120_0017520 | Ga0496120_0017520_1625_2047 | 140 |
| 327 | 3300048923 | Ga0496120_0131865 | Ga0496120_0131865_805_1227 | 140 |
| 328 | 3300048924 | Ga0496121_0003855 | Ga0496121_0003855_14643_15071 | 140 |
| 329 | 3300048924 | Ga0496121_0006197 | Ga0496121_0006197_3588_4010 | 140 |
| 330 | 3300048924 | Ga0496121_0007782 | Ga0496121_0007782_7340_7768 | 140 |
| 331 | 3300048924 | Ga0496121_0023389 | Ga0496121_0023389_3963_4385 | 140 |
| 332 | 3300048924 | Ga0496121_0101002 | Ga0496121_0101002_1665_2087 | 140 |
| 333 | 3300048925 | Ga0496122_0000462 | Ga0496122_0000462_64859_65284 | 140 |
| 334 | 3300048925 | Ga0496122_0011645 | Ga0496122_0011645_4760_5182 | 140 |
| 335 | 3300048925 | Ga0496122_0092096 | Ga0496122_0092096_224_652 | 140 |
| 336 | 3300048926 | Ga0496123_0000048 | Ga0496123_0000048_19263_19688 | 140 |
| 337 | 3300048926 | Ga0496123_0013941 | Ga0496123_0013941_1411_1833 | 140 |
| 338 | 3300048926 | Ga0496123_0062559 | Ga0496123_0062559_586_1014 | 140 |
| 339 | 3300048927 | Ga0496124_0021877 | Ga0496124_0021877_4047_4469 | 140 |
| 340 | 3300048927 | Ga0496124_0394186 | Ga0496124_0394186_261_686 | 140 |
| 341 | 3300048927 | Ga0496124_0732771 | Ga0496124_0732771_157_579 | 140 |
| 342 | 3300048928 | Ga0496125_0009162 | Ga0496125_0009162_4694_5116 | 140 |
| 343 | 3300048928 | Ga0496125_0047511 | Ga0496125_0047511_2007_2429 | 140 |
| 344 | 3300048928 | Ga0496125_0070486 | Ga0496125_0070486_229_657 | 140 |
| 345 | 3300048929 | Ga0496126_0308867 | Ga0496126_0308867_836_1258 | 140 |
| 346 | 3300049460 | Ga0495682_0293428 | Ga0495682_0293428_26_454 | 140 |
| 347 | 3300049570 | Ga0501033_0700540 | Ga0501033_0700540_34_456 | 140 |
| 348 | 3300049571 | Ga0501034_0297730 | Ga0501034_0297730_134_556 | 140 |
| 349 | 3300049572 | Ga0501036_0140203 | Ga0501036_0140203_353_775 | 140 |
| 350 | 3300049574 | Ga0501038_0086706 | Ga0501038_0086706_1256_1678 | 140 |
| 351 | 3300049575 | Ga0501039_0034120 | Ga0501039_0034120_1697_2119 | 140 |
| 352 | 3300049584 | Ga0501068_0330057 | Ga0501068_0330057_167_589 | 140 |
| 353 | 3300049589 | Ga0501073_0089250 | Ga0501073_0089250_841_1263 | 140 |
| 354 | 3300049590 | Ga0501074_0119843 | Ga0501074_0119843_283_705 | 140 |
| 355 | 3300049822 | Ga0501035_0118163 | Ga0501035_0118163_1184_1606 | 140 |
| 356 | 3300050489 | nmdc:mga03683_12148_c1 | nmdc:mga03683_12148_c1_1169_1597 | 140 |
| 357 | 3300050490 | nmdc:mga03n38_182566_c1 | nmdc:mga03n38_182566_c1_119_547 | 140 |
| 358 | 3300050492 | nmdc:mga0yw44_103865_c1 | nmdc:mga0yw44_103865_c1_1048_1470 | 140 |
| 359 | 3300050492 | nmdc:mga0yw44_11627_c1 | nmdc:mga0yw44_11627_c1_4048_4476 | 140 |
| 360 | 3300050493 | nmdc:mga0k408_42482_c1 | nmdc:mga0k408_42482_c1_288_716 | 140 |
| 361 | 3300050494 | nmdc:mga06z11_130508_c1 | nmdc:mga06z11_130508_c1_551_979 | 140 |
| 362 | 3300050494 | nmdc:mga06z11_694092_c1 | nmdc:mga06z11_694092_c1_100_528 | 140 |
| 363 | 3300050495 | nmdc:mga04h51_307110_c1 | nmdc:mga04h51_307110_c1_189_617 | 140 |
| 364 | 3300050496 | nmdc:mga07m45_552485_c1 | nmdc:mga07m45_552485_c1_93_521 | 140 |
| 365 | 3300053134 | Ga0500658_0026682 | Ga0500658_0026682_1657_2085 | 140 |
| 366 | 3300053139 | Ga0500568_0000280 | Ga0500568_0000280_445_873 | 140 |
| 367 | 3300053139 | Ga0500568_0000424 | Ga0500568_0000424_1110_1532 | 140 |
| 368 | 3300053140 | Ga0500573_0000575 | Ga0500573_0000575_725_1147 | 140 |
| 369 | 3300053151 | Ga0500604_0133656 | Ga0500604_0133656_238_666 | 140 |
| 370 | 3300053152 | Ga0500606_085435 | Ga0500606_085435_230_658 | 140 |
| 371 | 3300053153 | Ga0500616_0001884 | Ga0500616_0001884_4684_5106 | 140 |
| 372 | 3300053156 | Ga0500622_0000170 | Ga0500622_0000170_62945_63373 | 140 |
| 373 | 3300053156 | Ga0500622_0349880 | Ga0500622_0349880_119_547 | 140 |
| 374 | 3300053160 | Ga0500633_0000432 | Ga0500633_0000432_5840_6268 | 140 |
| 375 | 3300053162 | Ga0500638_000485 | Ga0500638_000485_5524_5949 | 140 |
| 376 | 3300053177 | Ga0500636_0120936 | Ga0500636_0120936_232_657 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i9d-assembly1.cif.gz_A | arsenate reductase from e. coli | 0.9686 | 3 | 139 |
| 1j9b-assembly1.cif.gz_A | arsenate reductase+0.4m arsenite from e. coli | 0.9683 | 3 | 139 |
| 1s3d-assembly1.cif.gz_A | arsenate reductase r60a mutant from e. coli | 0.9677 | 3 | 139 |
| 1sd8-assembly1.cif.gz_A | arsenate reductase r60k mutant from e. coli | 0.9674 | 3 | 139 |
| 1sk0-assembly1.cif.gz_A | arsenate reductase r60a mutant +0.4m arsenite from e. coli | 0.9674 | 3 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9683 | 3 | 139 | 3.40.30.10 |
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9546 | 3 | 139 | 3.40.30.10 |
| 3rdwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9531 | 2 | 114 | 3.40.30.10 |
| 3rdwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9371 | 2 | 114 | 3.40.30.10 |
| af_Q4D776_60_147_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8755 | 2 | 32 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B3Z4G7-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 1.002 | 15 | 112 |
GO:0008794
GO:0046685 |
| AF-A0A2Z2GTY5-F1-model_v4 | Arsenate reductase | 1.001 | 26 | 116 |
GO:0046685
|
| AF-A0A4P7BI12-F1-model_v4 | deleted | 0.995 | 1 | 115 |
|
| AF-A0A2W4YC61-F1-model_v4 | deleted | 0.9948 | 2 | 92 |
|
| AF-A0A6M5JE52-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 0.9941 | 2 | 114 |
GO:0008794
GO:0046685 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar