F427285

General Info

Members Datasets Scaffolds Average Seq Length
376 180 752 107

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100235991|Ga0070693_1002359912
Length 119
Sequence MTNARIILTTAGSQEEAGKIAHALVERRLAACVNIVPQIESVYRWQGKVETTQEWLLLIKTQSKLFERVRDALKELHSYDLPECVMLEVSAGSQEYLNWIDKNTDSPQRAQRNAEKDQG

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.59
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 33.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100235991 3300005547 Bacteria 1205
2 Ga0058863_10000420 3300004799 Unclassified 2231
3 Ga0058863_11940548 3300004799 Unclassified 1144
4 Ga0058861_11995354 3300004800 Unclassified 702
5 Ga0058862_10154291 3300004803 Eukaryota 2947
6 Ga0070670_101556680 3300005331 Unclassified 607
7 Ga0070680_100005217 3300005336 Bacteria 9830
8 Ga0070680_100011390 3300005336 Bacteria 6877
9 Ga0070680_100043762 3300005336 Bacteria 3637
10 Ga0070682_100363648 3300005337 Unclassified 1083
11 Ga0068868_100210717 3300005338 Bacteria 1624
12 Ga0068868_100837353 3300005338 Unclassified 832
13 Ga0070661_100138153 3300005344 Bacteria 1835
14 Ga0070675_101694682 3300005354 Unclassified 583
15 Ga0070671_100536196 3300005355 Unclassified 1009
16 Ga0070659_100376246 3300005366 Bacteria 1195
17 Ga0070709_10157788 3300005434 Unclassified 1574
18 Ga0070709_10205904 3300005434 Bacteria 1396
19 Ga0070709_11057888 3300005434 Unclassified 647
20 Ga0070714_100238601 3300005435 Bacteria 1677
21 Ga0070714_100286461 3300005435 Bacteria 1532
22 Ga0070714_100623275 3300005435 Bacteria 1037
23 Ga0070714_101002804 3300005435 Bacteria 812
24 Ga0070713_100025231 3300005436 Bacteria 4644
25 Ga0070713_100064973 3300005436 Bacteria 3064
26 Ga0070713_100163653 3300005436 Bacteria 1988
27 Ga0070713_100196972 3300005436 Unclassified 1818
28 Ga0070713_101033649 3300005436 Bacteria 793
29 Ga0070713_101141251 3300005436 Bacteria 754
30 Ga0070713_101325659 3300005436 Bacteria 698
31 Ga0070710_10174927 3300005437 Bacteria 1340
32 Ga0070711_100009877 3300005439 Bacteria 5886
33 Ga0070711_100014530 3300005439 Unclassified 4961
34 Ga0070711_100304210 3300005439 Unclassified 1269
35 Ga0070711_100511415 3300005439 Bacteria 991
36 Ga0070711_100588413 3300005439 Bacteria 927
37 Ga0070708_100003191 3300005445 Bacteria 12781
38 Ga0070708_100220405 3300005445 Unclassified 1779
39 Ga0070681_10056675 3300005458 Unclassified 3899
40 Ga0070681_10122330 3300005458 Unclassified 2536
41 Ga0070681_10164360 3300005458 Bacteria 2143
42 Ga0070681_10691403 3300005458 Unclassified 936
43 Ga0070681_10800770 3300005458 Unclassified 859
44 Ga0070681_10808712 3300005458 Unclassified 855
45 Ga0070706_100012946 3300005467 Bacteria 7722
46 Ga0070706_100080296 3300005467 Bacteria 3020
47 Ga0070706_101006666 3300005467 Unclassified 768
48 Ga0070707_100017410 3300005468 Bacteria 6755
49 Ga0070707_100052240 3300005468 Unclassified 3918
50 Ga0070707_100165559 3300005468 Bacteria 2154
51 Ga0070707_100253228 3300005468 Archaea 1714
52 Ga0070707_101311897 3300005468 Unclassified 690
53 Ga0070698_100004748 3300005471 Bacteria 14928
54 Ga0070699_100001209 3300005518 Bacteria 23875
55 Ga0070699_100008890 3300005518 Bacteria 8700
56 Ga0070679_100001910 3300005530 Bacteria 18701
57 Ga0070679_100169599 3300005530 Bacteria 2155
58 Ga0070679_100609933 3300005530 Unclassified 1034
59 Ga0070684_100012822 3300005535 Bacteria 6732
60 Ga0070684_100015859 3300005535 Bacteria 6149
61 Ga0070684_100659921 3300005535 Unclassified 974
62 Ga0070697_100007335 3300005536 Bacteria 8579
63 Ga0070697_100008080 3300005536 Bacteria 8205
64 Ga0070697_100282480 3300005536 Bacteria 1424
65 Ga0070697_100781273 3300005536 Bacteria 844
66 Ga0068853_100286123 3300005539 Bacteria 1520
67 Ga0068853_100506242 3300005539 Bacteria 1140
68 Ga0068853_100631436 3300005539 Unclassified 1018
69 Ga0068853_102084276 3300005539 Unclassified 550
70 Ga0070686_100007839 3300005544 Bacteria 5969
71 Ga0070693_100119544 3300005547 Unclassified 1632
72 Ga0070704_100877778 3300005549 Unclassified 805
73 Ga0068855_100022960 3300005563 Bacteria 7475
74 Ga0068855_100262733 3300005563 Unclassified 1922
75 Ga0068855_100696541 3300005563 Unclassified 1087
76 Ga0068855_101794068 3300005563 Unclassified 623
77 Ga0068854_100007336 3300005578 Bacteria 7046
78 Ga0068854_100327094 3300005578 Bacteria 1248
79 Ga0068854_100639861 3300005578 Unclassified 912
80 Ga0068856_100036564 3300005614 Bacteria 4814
81 Ga0068856_100452861 3300005614 Unclassified 1304
82 Ga0068856_100692342 3300005614 Unclassified 1040
83 Ga0068856_100753924 3300005614 Bacteria 993
84 Ga0068852_100574607 3300005616 Unclassified 1129
85 Ga0068864_100488691 3300005618 Unclassified 1183
86 Ga0068851_10101690 3300005834 Bacteria 1526
87 Ga0068863_100105128 3300005841 Bacteria 2686
88 Ga0081540_1120264 3300005983 Unclassified 1091
89 Ga0070717_10001291 3300006028 Bacteria 17129
90 Ga0070717_10010624 3300006028 Bacteria 6959
91 Ga0070717_10025527 3300006028 Bacteria 4701
92 Ga0070717_10176851 3300006028 Bacteria 1858
93 Ga0070717_10250488 3300006028 Unclassified 1565
94 Ga0070717_10589398 3300006028 Bacteria 1008
95 Ga0070717_10638380 3300006028 Bacteria 966
96 Ga0070717_10713902 3300006028 Bacteria 911
97 Ga0070717_11037027 3300006028 Unclassified 747
98 Ga0070716_100035944 3300006173 Bacteria 2728
99 Ga0070716_100476586 3300006173 Bacteria 915
100 Ga0070716_100553458 3300006173 Unclassified 858
101 Ga0070712_100066108 3300006175 Bacteria 2569
102 Ga0070712_100081529 3300006175 Bacteria 2344
103 Ga0070712_100684950 3300006175 Unclassified 873
104 Ga0070712_101037684 3300006175 Unclassified 710
105 Ga0070712_101306418 3300006175 Unclassified 632
106 Ga0075428_100842138 3300006844 Unclassified 974
107 Ga0075431_100049671 3300006847 Bacteria 4325
108 Ga0075433_10000614 3300006852 Bacteria 23800
109 Ga0075433_10009689 3300006852 Bacteria 7713
110 Ga0075434_100001375 3300006871 Bacteria 20407
111 Ga0075434_100001404 3300006871 Bacteria 20234
112 Ga0075434_101644700 3300006871 Unclassified 650
113 Ga0075436_100036180 3300006914 Bacteria 3407
114 Ga0075436_100038465 3300006914 Bacteria 3302
115 Ga0075436_100262745 3300006914 Bacteria 1231
116 Ga0075435_100001091 3300007076 Bacteria 17272
117 Ga0075435_100145555 3300007076 Unclassified 1990
118 Ga0075435_100354299 3300007076 Bacteria 1258
119 Ga0075435_101461928 3300007076 Unclassified 599
120 Ga0105240_10073037 3300009093 Bacteria 4237
121 Ga0105240_10518415 3300009093 Bacteria 1323
122 Ga0105240_11192482 3300009093 Bacteria 806
123 Ga0105245_10004757 3300009098 Bacteria 11984
124 Ga0105245_10085680 3300009098 Bacteria 2888
125 Ga0105247_11230344 3300009101 Unclassified 598
126 Ga0114129_11810941 3300009147 Bacteria 742
127 Ga0105241_11208865 3300009174 Unclassified 716
128 Ga0105241_12574376 3300009174 Unclassified 510
129 Ga0105242_12427085 3300009176 Bacteria 572
130 Ga0105248_10425323 3300009177 Bacteria 1496
131 Ga0105237_10034116 3300009545 Bacteria 5155
132 Ga0105237_10328235 3300009545 Bacteria 1534
133 Ga0105237_10836719 3300009545 Bacteria 927
134 Ga0105237_12741522 3300009545 Bacteria 504
135 Ga0105238_10071278 3300009551 Unclassified 3472
136 Ga0105238_10079760 3300009551 Bacteria 3263
137 Ga0099796_10208222 3300010159 Unclassified 796
138 Ga0099796_10308353 3300010159 Bacteria 672
139 Ga0105239_10086136 3300010375 Bacteria 3462
140 Ga0105239_10376205 3300010375 Bacteria 1605
141 Ga0105239_10693376 3300010375 Bacteria 1164
142 Ga0105239_11080717 3300010375 Unclassified 923
143 Ga0157373_10022337 3300013100 Bacteria 4589
144 Ga0157373_11007676 3300013100 Unclassified 622
145 Ga0157370_10040522 3300013104 Unclassified 4497
146 Ga0157370_10336673 3300013104 Bacteria 1391
147 Ga0157369_10036262 3300013105 Bacteria 5404
148 Ga0157369_10040336 3300013105 Bacteria 5096
149 Ga0157369_10088887 3300013105 Bacteria 3298
150 Ga0157369_10119608 3300013105 Unclassified 2795
151 Ga0157369_10460216 3300013105 Bacteria 1317
152 Ga0157369_10687186 3300013105 Bacteria 1054
153 Ga0157369_11396734 3300013105 Bacteria 713
154 Ga0157374_12246150 3300013296 Unclassified 573
155 Ga0157378_10333190 3300013297 Bacteria 1478
156 Ga0157378_10720938 3300013297 Unclassified 1018
157 Ga0163162_10287933 3300013306 Unclassified 1775
158 Ga0163162_12400790 3300013306 Unclassified 606
159 Ga0157372_10856594 3300013307 Unclassified 1055
160 Ga0157372_11389714 3300013307 Unclassified 809
161 Ga0157372_11440480 3300013307 Bacteria 794
162 Ga0182008_10019079 3300014497 Bacteria 3544
163 Ga0157376_12339234 3300014969 Unclassified 574
164 Ga0182007_10048286 3300015262 Bacteria 1406
165 Ga0182005_1050660 3300015265 Bacteria 1129
166 Ga0224572_1027194 3300024225 Bacteria 1096
167 Ga0228598_1069585 3300024227 Unclassified 703
168 Ga0207656_10125832 3300025321 Bacteria 1197
169 Ga0207692_10165478 3300025898 Bacteria 1278
170 Ga0207692_10214642 3300025898 Unclassified 1138
171 Ga0207680_11250128 3300025903 Unclassified 529
172 Ga0207647_10474212 3300025904 Bacteria 700
173 Ga0207699_10131601 3300025906 Bacteria 1632
174 Ga0207684_10000623 3300025910 Bacteria 42146
175 Ga0207684_10183336 3300025910 Bacteria 1805
176 Ga0207684_10849383 3300025910 Unclassified 770
177 Ga0207654_10431487 3300025911 Unclassified 921
178 Ga0207707_10006772 3300025912 Bacteria 10001
179 Ga0207707_10095333 3300025912 Unclassified 2600
180 Ga0207707_10131144 3300025912 Bacteria 2192
181 Ga0207707_10314707 3300025912 Unclassified 1352
182 Ga0207707_10640953 3300025912 Unclassified 896
183 Ga0207695_10213768 3300025913 Bacteria 1838
184 Ga0207671_10544717 3300025914 Bacteria 925
185 Ga0207693_10023714 3300025915 Bacteria 4869
186 Ga0207693_10131032 3300025915 Bacteria 1971
187 Ga0207663_10006559 3300025916 Bacteria 5970
188 Ga0207663_10011097 3300025916 Unclassified 4825
189 Ga0207663_10462737 3300025916 Bacteria 980
190 Ga0207663_10893202 3300025916 Bacteria 710
191 Ga0207663_10945073 3300025916 Bacteria 690
192 Ga0207660_10000609 3300025917 Bacteria 24156
193 Ga0207660_10021987 3300025917 Unclassified 4294
194 Ga0207660_10179543 3300025917 Bacteria 1643
195 Ga0207660_10335208 3300025917 Unclassified 1210
196 Ga0207657_10018356 3300025919 Bacteria 6680
197 Ga0207649_10568699 3300025920 Unclassified 869
198 Ga0207652_10014465 3300025921 Bacteria 6394
199 Ga0207652_11116608 3300025921 Unclassified 689
200 Ga0207646_10000332 3300025922 Bacteria 64190
201 Ga0207646_10128086 3300025922 Archaea 2283
202 Ga0207646_10307386 3300025922 Bacteria 1432
203 Ga0207646_11211916 3300025922 Bacteria 661
204 Ga0207694_10055260 3300025924 Unclassified 3082
205 Ga0207694_11195497 3300025924 Bacteria 643
206 Ga0207650_10150033 3300025925 Bacteria 1839
207 Ga0207687_10113145 3300025927 Unclassified 2018
208 Ga0207687_10177841 3300025927 Bacteria 1646
209 Ga0207700_10002038 3300025928 Bacteria 11554
210 Ga0207700_10033504 3300025928 Bacteria 3676
211 Ga0207700_10067485 3300025928 Unclassified 2738
212 Ga0207700_10235214 3300025928 Bacteria 1559
213 Ga0207700_10469896 3300025928 Unclassified 1110
214 Ga0207700_10479636 3300025928 Bacteria 1099
215 Ga0207700_10870292 3300025928 Unclassified 806
216 Ga0207700_11037929 3300025928 Bacteria 733
217 Ga0207700_11848473 3300025928 Unclassified 530
218 Ga0207664_10000143 3300025929 Bacteria 58667
219 Ga0207664_10100782 3300025929 Bacteria 2385
220 Ga0207664_10237357 3300025929 Bacteria 1587
221 Ga0207664_11201057 3300025929 Unclassified 676
222 Ga0207664_11287648 3300025929 Unclassified 650
223 Ga0207664_11824445 3300025929 Bacteria 531
224 Ga0207665_10019015 3300025939 Unclassified 4513
225 Ga0207665_10052704 3300025939 Bacteria 2741
226 Ga0207665_10378654 3300025939 Bacteria 1074
227 Ga0207665_10460172 3300025939 Unclassified 978
228 Ga0207661_10022977 3300025944 Unclassified 4707
229 Ga0207679_10430976 3300025945 Bacteria 1166
230 Ga0207667_10035759 3300025949 Bacteria 5327
231 Ga0207667_10205024 3300025949 Unclassified 2022
232 Ga0207667_11289280 3300025949 Unclassified 707
233 Ga0207667_11387248 3300025949 Unclassified 676
234 Ga0207640_10084046 3300025981 Bacteria 2184
235 Ga0207640_10546844 3300025981 Bacteria 972
236 Ga0207677_10748209 3300026023 Unclassified 871
237 Ga0207639_10006526 3300026041 Bacteria 7934
238 Ga0207639_10281118 3300026041 Bacteria 1463
239 Ga0207639_10673505 3300026041 Unclassified 958
240 Ga0207639_11882219 3300026041 Unclassified 559
241 Ga0207702_10101457 3300026078 Bacteria 2541
242 Ga0207702_10927450 3300026078 Unclassified 863
243 Ga0207702_11101538 3300026078 Unclassified 788
244 Ga0207676_10192048 3300026095 Bacteria 1798
245 Ga0207674_10078387 3300026116 Bacteria 3309
246 Ga0207698_10124314 3300026142 Bacteria 2190
247 Ga0207698_10396768 3300026142 Bacteria 1317
248 Ga0207698_11905433 3300026142 Bacteria 609
249 Ga0265338_10274090 3300028800 Bacteria 1235
250 Ga0265770_1018238 3300030878 Unclassified 1092
251 Ga0265765_1030127 3300030879 Unclassified 689
252 Ga0265760_10002400 3300031090 Bacteria 5474
253 Ga0265760_10048321 3300031090 Archaea 1278
254 Ga0265760_10243294 3300031090 Unclassified 621
255 Ga0265325_10002833 3300031241 Bacteria 11567
256 Ga0265340_10249486 3300031247 Unclassified 791
257 Ga0265339_10028050 3300031249 Bacteria 3205
258 Ga0265339_10033882 3300031249 Bacteria 2873
259 Ga0265316_10056679 3300031344 Bacteria 3059
260 Ga0265314_10209692 3300031711 Bacteria 1145
261 Ga0373926_0003280 3300035083 Bacteria 5197
262 Ga0373926_0003613 3300035083 Bacteria 5021
263 Ga0373923_0078170 3300035111 Bacteria 1431
264 Ga0373923_0219911 3300035111 Bacteria 882
265 Ga0373936_0001225 3300035113 Bacteria 9237
266 Ga0373936_0117084 3300035113 Bacteria 1135
267 Ga0373945_0199317 3300035116 Unclassified 830
268 Ga0373953_0010808 3300035117 Unclassified 3187
269 Ga0373956_0003178 3300035119 Bacteria 6643
270 Ga0373956_0049222 3300035119 Bacteria 1890
271 Ga0373957_0155334 3300035120 Bacteria 941
272 Ga0373957_0354731 3300035120 Bacteria 627
273 Ga0373943_0000116 3300035170 Bacteria 29820
274 Ga0373946_0000708 3300035171 Bacteria 11307
275 Ga0373946_0017910 3300035171 Bacteria 2713
276 Ga0373955_0003529 3300035172 Bacteria 6881
277 Ga0373955_0234446 3300035172 Bacteria 1098
278 Ga0373924_0000392 3300035410 Bacteria 13480
279 Ga0373924_0043109 3300035410 Bacteria 1852
280 Ga0373924_0043477 3300035410 Bacteria 1845
281 Ga0373924_0123196 3300035410 Bacteria 1125
282 Ga0373924_0268045 3300035410 Bacteria 757
283 Ga0373935_0007467 3300035692 Bacteria 6543
284 Ga0373935_0008164 3300035692 Bacteria 6275
285 Ga0373935_0539426 3300035692 Bacteria 850
286 Ga0373927_0000118 3300035695 Bacteria 59794
287 Ga0373927_0020801 3300035695 Bacteria 4300
288 Ga0373933_0038468 3300035724 Bacteria 2810
289 Ga0373933_0250337 3300035724 Bacteria 1141
290 Ga0373947_0002792 3300035725 Bacteria 10439
291 Ga0373937_0000046 3300036401 Bacteria 107501
292 Ga0373937_0004949 3300036401 Bacteria 11326
293 Ga0373937_0115239 3300036401 Unclassified 2502
294 Ga0373937_0138493 3300036401 Bacteria 2276
295 Ga0373937_0997937 3300036401 Bacteria 786
296 Ga0373937_1935545 3300036401 Bacteria 536
297 Ga0373925_0002638 3300037068 Bacteria 14224
298 Ga0373925_0011565 3300037068 Bacteria 6383
299 Ga0373925_0084464 3300037068 Bacteria 2419
300 Ga0395898_0025718 3300037466 Bacteria 5928
301 Ga0395901_0109871 3300038443 Unclassified 2895
302 Ga0436365_1044021 3300039437 Bacteria 901
303 Ga0436362_1213923 3300039453 Bacteria 861
304 Ga0453683_0054523 3300044673 Bacteria 2502
305 Ga0466963_0000709 3300044694 Bacteria 16268
306 Ga0466958_1048723 3300045836 Unclassified 532
307 Ga0466967_0002786 3300045976 Bacteria 11077
308 Ga0466967_0198119 3300045976 Bacteria 1901
309 Ga0495629_0222512 3300046459 Bacteria 1302
310 Ga0495651_0158247 3300046462 Bacteria 1626
311 Ga0495653_0134634 3300046463 Unclassified 1745
312 Ga0495580_0096712 3300046472 Bacteria 2053
313 Ga0495580_0310047 3300046472 Bacteria 1074
314 Ga0495580_0449155 3300046472 Bacteria 865
315 Ga0495580_0880267 3300046472 Unclassified 577
316 Ga0495639_0477858 3300046475 Bacteria 635
317 Ga0495664_0208792 3300046477 Bacteria 1183
318 Ga0495608_0134911 3300046511 Bacteria 1578
319 Ga0495608_0410898 3300046511 Unclassified 827
320 Ga0495628_0722317 3300046516 Bacteria 702
321 Ga0495630_0055567 3300046517 Unclassified 2967
322 Ga0495630_0143732 3300046517 Bacteria 1814
323 Ga0495630_0150924 3300046517 Bacteria 1768
324 Ga0495652_0627497 3300046529 Unclassified 730
325 Ga0495665_0022932 3300046531 Bacteria 3352
326 Ga0495665_0110814 3300046531 Bacteria 1440
327 Ga0495587_0075726 3300046536 Bacteria 1954
328 Ga0495667_0123799 3300046559 Unclassified 1669
329 Ga0495667_0163903 3300046559 Bacteria 1429
330 Ga0495635_0053671 3300046663 Bacteria 2777
331 Ga0495635_0070872 3300046663 Unclassified 2389
332 Ga0495635_0236210 3300046663 Unclassified 1234
333 Ga0495623_0046227 3300046679 Bacteria 2764
334 Ga0495658_0594942 3300046683 Unclassified 709
335 Ga0495581_0025569 3300047315 Bacteria 3424
336 Ga0495674_0006067 3300047319 Bacteria 11596
337 Ga0495676_0414171 3300047321 Bacteria 893
338 Ga0495675_0111210 3300047444 Bacteria 1710
339 Ga0495675_0175123 3300047444 Bacteria 1316
340 Ga0495593_0097063 3300047673 Unclassified 1514
341 Ga0495593_0333463 3300047673 Bacteria 758
342 Ga0495602_0169325 3300048088 Bacteria 1697
343 Ga0496100_0637625 3300048903 Unclassified 829
344 Ga0496102_0268289 3300048905 Bacteria 1609
345 Ga0496102_0372870 3300048905 Unclassified 1343
346 Ga0496103_0082464 3300048906 Bacteria 2024
347 Ga0496104_0252419 3300048907 Bacteria 1676
348 Ga0496104_0309936 3300048907 Bacteria 1491
349 Ga0496104_1616985 3300048907 Unclassified 551
350 Ga0496105_0002844 3300048908 Bacteria 12668
351 Ga0496106_1070829 3300048909 Unclassified 632
352 Ga0496107_0729979 3300048910 Unclassified 728
353 Ga0496108_0771478 3300048911 Unclassified 831
354 Ga0496110_0019752 3300048913 Bacteria 5677
355 Ga0496110_0577666 3300048913 Bacteria 1021
356 Ga0496111_0059144 3300048914 Bacteria 2776
357 Ga0496112_0015476 3300048915 Bacteria 7120
358 Ga0496112_0266301 3300048915 Bacteria 1662
359 Ga0496112_0884323 3300048915 Unclassified 816
360 Ga0496112_1249157 3300048915 Unclassified 659
361 Ga0496113_0000923 3300048916 Bacteria 15562
362 Ga0496113_0342907 3300048916 Unclassified 1198
363 Ga0496115_0380676 3300048918 Bacteria 1148
364 nmdc:mga06r32_49221_c1 3300050510 Bacteria 4030
365 nmdc:mga0n895_113722_c1 3300050512 Bacteria 2724
366 nmdc:mga0n895_757_c1 3300050512 Bacteria 22874
367 nmdc:mga0rr50_165234_c1 3300050513 Bacteria 1799
368 nmdc:mga0rr50_33304_c1 3300050513 Bacteria 3680
369 nmdc:mga0rr50_466317_c1 3300050513 Unclassified 1072
370 nmdc:mga08x19_150897_c1 3300050514 Bacteria 1574
371 nmdc:mga08x19_43397_c1 3300050514 Bacteria 2869
372 nmdc:mga08x19_444852_c1 3300050514 Unclassified 912
373 nmdc:mga0a205_937_c1 3300050515 Bacteria 24079
374 Ga0495601_0278472 3300053077 Bacteria 1091
375 Ga0587069_022070 3300059642 Bacteria 964
376 Ga0587079_040078 3300059647 Bacteria 942
377 Ga0070693_100235991
378 Ga0058863_10000420
379 Ga0058863_11940548
380 Ga0058861_11995354
381 Ga0058862_10154291
382 Ga0070670_101556680
383 Ga0070680_100005217
384 Ga0070680_100011390
385 Ga0070680_100043762
386 Ga0070682_100363648
387 Ga0068868_100210717
388 Ga0068868_100837353
389 Ga0070661_100138153
390 Ga0070675_101694682
391 Ga0070671_100536196
392 Ga0070659_100376246
393 Ga0070709_10157788
394 Ga0070709_10205904
395 Ga0070709_11057888
396 Ga0070714_100238601
397 Ga0070714_100286461
398 Ga0070714_100623275
399 Ga0070714_101002804
400 Ga0070713_100025231
401 Ga0070713_100064973
402 Ga0070713_100163653
403 Ga0070713_100196972
404 Ga0070713_101033649
405 Ga0070713_101141251
406 Ga0070713_101325659
407 Ga0070710_10174927
408 Ga0070711_100009877
409 Ga0070711_100014530
410 Ga0070711_100304210
411 Ga0070711_100511415
412 Ga0070711_100588413
413 Ga0070708_100003191
414 Ga0070708_100220405
415 Ga0070681_10056675
416 Ga0070681_10122330
417 Ga0070681_10164360
418 Ga0070681_10691403
419 Ga0070681_10800770
420 Ga0070681_10808712
421 Ga0070706_100012946
422 Ga0070706_100080296
423 Ga0070706_101006666
424 Ga0070707_100017410
425 Ga0070707_100052240
426 Ga0070707_100165559
427 Ga0070707_100253228
428 Ga0070707_101311897
429 Ga0070698_100004748
430 Ga0070699_100001209
431 Ga0070699_100008890
432 Ga0070679_100001910
433 Ga0070679_100169599
434 Ga0070679_100609933
435 Ga0070684_100012822
436 Ga0070684_100015859
437 Ga0070684_100659921
438 Ga0070697_100007335
439 Ga0070697_100008080
440 Ga0070697_100282480
441 Ga0070697_100781273
442 Ga0068853_100286123
443 Ga0068853_100506242
444 Ga0068853_100631436
445 Ga0068853_102084276
446 Ga0070686_100007839
447 Ga0070693_100119544
448 Ga0070704_100877778
449 Ga0068855_100022960
450 Ga0068855_100262733
451 Ga0068855_100696541
452 Ga0068855_101794068
453 Ga0068854_100007336
454 Ga0068854_100327094
455 Ga0068854_100639861
456 Ga0068856_100036564
457 Ga0068856_100452861
458 Ga0068856_100692342
459 Ga0068856_100753924
460 Ga0068852_100574607
461 Ga0068864_100488691
462 Ga0068851_10101690
463 Ga0068863_100105128
464 Ga0081540_1120264
465 Ga0070717_10001291
466 Ga0070717_10010624
467 Ga0070717_10025527
468 Ga0070717_10176851
469 Ga0070717_10250488
470 Ga0070717_10589398
471 Ga0070717_10638380
472 Ga0070717_10713902
473 Ga0070717_11037027
474 Ga0070716_100035944
475 Ga0070716_100476586
476 Ga0070716_100553458
477 Ga0070712_100066108
478 Ga0070712_100081529
479 Ga0070712_100684950
480 Ga0070712_101037684
481 Ga0070712_101306418
482 Ga0075428_100842138
483 Ga0075431_100049671
484 Ga0075433_10000614
485 Ga0075433_10009689
486 Ga0075434_100001375
487 Ga0075434_100001404
488 Ga0075434_101644700
489 Ga0075436_100036180
490 Ga0075436_100038465
491 Ga0075436_100262745
492 Ga0075435_100001091
493 Ga0075435_100145555
494 Ga0075435_100354299
495 Ga0075435_101461928
496 Ga0105240_10073037
497 Ga0105240_10518415
498 Ga0105240_11192482
499 Ga0105245_10004757
500 Ga0105245_10085680
501 Ga0105247_11230344
502 Ga0114129_11810941
503 Ga0105241_11208865
504 Ga0105241_12574376
505 Ga0105242_12427085
506 Ga0105248_10425323
507 Ga0105237_10034116
508 Ga0105237_10328235
509 Ga0105237_10836719
510 Ga0105237_12741522
511 Ga0105238_10071278
512 Ga0105238_10079760
513 Ga0099796_10208222
514 Ga0099796_10308353
515 Ga0105239_10086136
516 Ga0105239_10376205
517 Ga0105239_10693376
518 Ga0105239_11080717
519 Ga0157373_10022337
520 Ga0157373_11007676
521 Ga0157370_10040522
522 Ga0157370_10336673
523 Ga0157369_10036262
524 Ga0157369_10040336
525 Ga0157369_10088887
526 Ga0157369_10119608
527 Ga0157369_10460216
528 Ga0157369_10687186
529 Ga0157369_11396734
530 Ga0157374_12246150
531 Ga0157378_10333190
532 Ga0157378_10720938
533 Ga0163162_10287933
534 Ga0163162_12400790
535 Ga0157372_10856594
536 Ga0157372_11389714
537 Ga0157372_11440480
538 Ga0182008_10019079
539 Ga0157376_12339234
540 Ga0182007_10048286
541 Ga0182005_1050660
542 Ga0224572_1027194
543 Ga0228598_1069585
544 Ga0207656_10125832
545 Ga0207692_10165478
546 Ga0207692_10214642
547 Ga0207680_11250128
548 Ga0207647_10474212
549 Ga0207699_10131601
550 Ga0207684_10000623
551 Ga0207684_10183336
552 Ga0207684_10849383
553 Ga0207654_10431487
554 Ga0207707_10006772
555 Ga0207707_10095333
556 Ga0207707_10131144
557 Ga0207707_10314707
558 Ga0207707_10640953
559 Ga0207695_10213768
560 Ga0207671_10544717
561 Ga0207693_10023714
562 Ga0207693_10131032
563 Ga0207663_10006559
564 Ga0207663_10011097
565 Ga0207663_10462737
566 Ga0207663_10893202
567 Ga0207663_10945073
568 Ga0207660_10000609
569 Ga0207660_10021987
570 Ga0207660_10179543
571 Ga0207660_10335208
572 Ga0207657_10018356
573 Ga0207649_10568699
574 Ga0207652_10014465
575 Ga0207652_11116608
576 Ga0207646_10000332
577 Ga0207646_10128086
578 Ga0207646_10307386
579 Ga0207646_11211916
580 Ga0207694_10055260
581 Ga0207694_11195497
582 Ga0207650_10150033
583 Ga0207687_10113145
584 Ga0207687_10177841
585 Ga0207700_10002038
586 Ga0207700_10033504
587 Ga0207700_10067485
588 Ga0207700_10235214
589 Ga0207700_10469896
590 Ga0207700_10479636
591 Ga0207700_10870292
592 Ga0207700_11037929
593 Ga0207700_11848473
594 Ga0207664_10000143
595 Ga0207664_10100782
596 Ga0207664_10237357
597 Ga0207664_11201057
598 Ga0207664_11287648
599 Ga0207664_11824445
600 Ga0207665_10019015
601 Ga0207665_10052704
602 Ga0207665_10378654
603 Ga0207665_10460172
604 Ga0207661_10022977
605 Ga0207679_10430976
606 Ga0207667_10035759
607 Ga0207667_10205024
608 Ga0207667_11289280
609 Ga0207667_11387248
610 Ga0207640_10084046
611 Ga0207640_10546844
612 Ga0207677_10748209
613 Ga0207639_10006526
614 Ga0207639_10281118
615 Ga0207639_10673505
616 Ga0207639_11882219
617 Ga0207702_10101457
618 Ga0207702_10927450
619 Ga0207702_11101538
620 Ga0207676_10192048
621 Ga0207674_10078387
622 Ga0207698_10124314
623 Ga0207698_10396768
624 Ga0207698_11905433
625 Ga0265338_10274090
626 Ga0265770_1018238
627 Ga0265765_1030127
628 Ga0265760_10002400
629 Ga0265760_10048321
630 Ga0265760_10243294
631 Ga0265325_10002833
632 Ga0265340_10249486
633 Ga0265339_10028050
634 Ga0265339_10033882
635 Ga0265316_10056679
636 Ga0265314_10209692
637 Ga0373926_0003280
638 Ga0373926_0003613
639 Ga0373923_0078170
640 Ga0373923_0219911
641 Ga0373936_0001225
642 Ga0373936_0117084
643 Ga0373945_0199317
644 Ga0373953_0010808
645 Ga0373956_0003178
646 Ga0373956_0049222
647 Ga0373957_0155334
648 Ga0373957_0354731
649 Ga0373943_0000116
650 Ga0373946_0000708
651 Ga0373946_0017910
652 Ga0373955_0003529
653 Ga0373955_0234446
654 Ga0373924_0000392
655 Ga0373924_0043109
656 Ga0373924_0043477
657 Ga0373924_0123196
658 Ga0373924_0268045
659 Ga0373935_0007467
660 Ga0373935_0008164
661 Ga0373935_0539426
662 Ga0373927_0000118
663 Ga0373927_0020801
664 Ga0373933_0038468
665 Ga0373933_0250337
666 Ga0373947_0002792
667 Ga0373937_0000046
668 Ga0373937_0004949
669 Ga0373937_0115239
670 Ga0373937_0138493
671 Ga0373937_0997937
672 Ga0373937_1935545
673 Ga0373925_0002638
674 Ga0373925_0011565
675 Ga0373925_0084464
676 Ga0395898_0025718
677 Ga0395901_0109871
678 Ga0436365_1044021
679 Ga0436362_1213923
680 Ga0453683_0054523
681 Ga0466963_0000709
682 Ga0466958_1048723
683 Ga0466967_0002786
684 Ga0466967_0198119
685 Ga0495629_0222512
686 Ga0495651_0158247
687 Ga0495653_0134634
688 Ga0495580_0096712
689 Ga0495580_0310047
690 Ga0495580_0449155
691 Ga0495580_0880267
692 Ga0495639_0477858
693 Ga0495664_0208792
694 Ga0495608_0134911
695 Ga0495608_0410898
696 Ga0495628_0722317
697 Ga0495630_0055567
698 Ga0495630_0143732
699 Ga0495630_0150924
700 Ga0495652_0627497
701 Ga0495665_0022932
702 Ga0495665_0110814
703 Ga0495587_0075726
704 Ga0495667_0123799
705 Ga0495667_0163903
706 Ga0495635_0053671
707 Ga0495635_0070872
708 Ga0495635_0236210
709 Ga0495623_0046227
710 Ga0495658_0594942
711 Ga0495581_0025569
712 Ga0495674_0006067
713 Ga0495676_0414171
714 Ga0495675_0111210
715 Ga0495675_0175123
716 Ga0495593_0097063
717 Ga0495593_0333463
718 Ga0495602_0169325
719 Ga0496100_0637625
720 Ga0496102_0268289
721 Ga0496102_0372870
722 Ga0496103_0082464
723 Ga0496104_0252419
724 Ga0496104_0309936
725 Ga0496104_1616985
726 Ga0496105_0002844
727 Ga0496106_1070829
728 Ga0496107_0729979
729 Ga0496108_0771478
730 Ga0496110_0019752
731 Ga0496110_0577666
732 Ga0496111_0059144
733 Ga0496112_0015476
734 Ga0496112_0266301
735 Ga0496112_0884323
736 Ga0496112_1249157
737 Ga0496113_0000923
738 Ga0496113_0342907
739 Ga0496115_0380676
740 nmdc:mga06r32_49221_c1
741 nmdc:mga0n895_113722_c1
742 nmdc:mga0n895_757_c1
743 nmdc:mga0rr50_165234_c1
744 nmdc:mga0rr50_33304_c1
745 nmdc:mga0rr50_466317_c1
746 nmdc:mga08x19_150897_c1
747 nmdc:mga08x19_43397_c1
748 nmdc:mga08x19_444852_c1
749 nmdc:mga0a205_937_c1
750 Ga0495601_0278472
751 Ga0587069_022070
752 Ga0587079_040078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03091

CutA1

CutA1 divalent ion tolerance protein

5

103

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zk7-assembly1.cif.gz_Q crystal structure of rescued two-component self-assembling tetrahedral cage t33-31 0.9945 4 105
4zk7-assembly1.cif.gz_M crystal structure of rescued two-component self-assembling tetrahedral cage t33-31 0.994 4 105
1nza-assembly1.cif.gz_A divalent cation tolerance protein (cut a1) from thermus thermophilus hb8 0.9916 4 105
2nuh-assembly1.cif.gz_A crystal structure of cuta from the phytopathgen bacterium xylella fastidiosa 0.9916 3 105
1p1l-assembly1.cif.gz_A structure of the periplasmic divalent cation tolerance protein cuta from archaeoglobus fulgidus 0.9906 4 105
ID Description Score Start End Superfamily
af_Q8I4T9_34_158_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9942 3 103 3.30.70.120
af_C6TLS9_50_172_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9922 4 105 3.30.70.120
2nuhA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9916 3 105 3.30.70.120
1nzaA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9916 4 105 3.30.70.120
1p1lA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9906 4 105 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A2V8S6Z3-F1-model_v4 Divalent-cation tolerance protein CutA 1.003 3 103 GO:0005507
GO:0010038
AF-A0A147IWN7-F1-model_v4 Cation tolerance protein CutA 1.001 7 105 GO:0005507
GO:0010038
AF-A0A533Y9A1-F1-model_v4 Divalent-cation tolerance protein CutA 1 3 104 GO:0005507
GO:0010038
AF-A0A450XCA5-F1-model_v4 Divalent cation tolerance protein 1 3 105 GO:0005507
GO:0010038
AF-A0A7V5ZIS9-F1-model_v4 Divalent-cation tolerance protein CutA 1 4 104 GO:0005507
GO:0010038

Map