F427018

General Info

Members Datasets Scaffolds Average Seq Length
375 170 750 221

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10244078|Ga0105245_102440782
Length 249
Sequence VFSTSARQSLAACAALLGLGILGSACSSQQLWGDLKPVVSVKELMRDMIDPVADNIFDAVRTDITAAGTVETAPKTDEDWEKVRIGAVTLAEGIYLLKIPRPFAPPGDNNNSAGPDFPELSPAQIKAKLEADPVLWNAKIEALRNVGLEVMEIVNKKDVNALFEAGGDLDMACEACHLEYWYPGEKVLLPQLDRRLKDLFPPGTKRPVASHLPTTSSRKPFVRSAQRDRDYSVTPFRDPTTPGFGPALR

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
130 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.2
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 26.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10244078 3300009098 Bacteria 1742
2 Ga0065704_10269899 3300005289 Unclassified 916
3 Ga0065715_10272019 3300005293 Bacteria 1108
4 Ga0065707_10114238 3300005295 Unclassified 2303
5 Ga0070676_10055446 3300005328 Unclassified 2339
6 Ga0070690_100110898 3300005330 Bacteria 1831
7 Ga0070670_100082664 3300005331 Unclassified 2760
8 Ga0068869_100118026 3300005334 Bacteria 2026
9 Ga0068869_100428790 3300005334 Bacteria 1092
10 Ga0070666_10007101 3300005335 Bacteria 6906
11 Ga0070666_10036685 3300005335 Bacteria 3256
12 Ga0070682_100121523 3300005337 Bacteria 1754
13 Ga0070682_100323966 3300005337 Unclassified 1139
14 Ga0068868_100002345 3300005338 Bacteria 13103
15 Ga0068868_100354015 3300005338 Unclassified 1258
16 Ga0070660_100134048 3300005339 Bacteria 1984
17 Ga0070691_10018649 3300005341 Bacteria 3199
18 Ga0070687_100013080 3300005343 Bacteria 3686
19 Ga0070669_100007558 3300005353 Bacteria 7782
20 Ga0070669_100023461 3300005353 Bacteria 4418
21 Ga0070675_100003154 3300005354 Bacteria 12477
22 Ga0070674_100008709 3300005356 Bacteria 6052
23 Ga0070674_100094717 3300005356 Unclassified 2163
24 Ga0070674_100326999 3300005356 Bacteria 1231
25 Ga0070673_100097023 3300005364 Bacteria 2420
26 Ga0070673_100166093 3300005364 Bacteria 1881
27 Ga0070673_100203188 3300005364 Bacteria 1707
28 Ga0070673_100272607 3300005364 Bacteria 1482
29 Ga0070673_100366694 3300005364 Bacteria 1281
30 Ga0070688_100006417 3300005365 Bacteria 6286
31 Ga0070688_100042265 3300005365 Bacteria 2803
32 Ga0070659_100503996 3300005366 Bacteria 1032
33 Ga0070667_100022496 3300005367 Bacteria 5228
34 Ga0070667_100050152 3300005367 Bacteria 3517
35 Ga0070667_100456267 3300005367 Unclassified 1168
36 Ga0070701_10058607 3300005438 Bacteria 2022
37 Ga0070711_100239884 3300005439 Unclassified 1417
38 Ga0070705_100071362 3300005440 Bacteria 2100
39 Ga0070705_100219836 3300005440 Unclassified 1315
40 Ga0070700_100003056 3300005441 Bacteria 8572
41 Ga0070700_100024886 3300005441 Bacteria 3520
42 Ga0070681_10010794 3300005458 Bacteria 9027
43 Ga0070681_10131154 3300005458 Bacteria 2438
44 Ga0068867_100371917 3300005459 Unclassified 1198
45 Ga0068867_100587441 3300005459 Bacteria 969
46 Ga0070685_10063690 3300005466 Bacteria 2166
47 Ga0070685_10240374 3300005466 Unclassified 1195
48 Ga0070685_10287009 3300005466 Bacteria 1104
49 Ga0070706_100784648 3300005467 Bacteria 882
50 Ga0070698_100105379 3300005471 Unclassified 2790
51 Ga0070698_101022847 3300005471 Unclassified 774
52 Ga0070679_100019144 3300005530 Bacteria 6652
53 Ga0070679_100522418 3300005530 Unclassified 1131
54 Ga0070672_100123937 3300005543 Bacteria 2118
55 Ga0070686_100002146 3300005544 Bacteria 10872
56 Ga0070686_100143751 3300005544 Unclassified 1663
57 Ga0070686_100375251 3300005544 Bacteria 1075
58 Ga0070695_100036394 3300005545 Bacteria 3097
59 Ga0070696_100138570 3300005546 Bacteria 1776
60 Ga0070665_100000623 3300005548 Bacteria 48311
61 Ga0070665_100009823 3300005548 Bacteria 9672
62 Ga0070665_100014163 3300005548 Bacteria 8013
63 Ga0070665_100143644 3300005548 Bacteria 2390
64 Ga0070704_100317957 3300005549 Unclassified 1303
65 Ga0070704_100433169 3300005549 Bacteria 1128
66 Ga0070664_100049627 3300005564 Bacteria 3550
67 Ga0070664_100874123 3300005564 Bacteria 842
68 Ga0068857_100064790 3300005577 Bacteria 3249
69 Ga0068857_100101632 3300005577 Bacteria 2580
70 Ga0068857_100152091 3300005577 Bacteria 2097
71 Ga0068857_100190038 3300005577 Bacteria 1870
72 Ga0068854_100007771 3300005578 Bacteria 6858
73 Ga0068856_100786649 3300005614 Unclassified 971
74 Ga0070702_100017317 3300005615 Bacteria 3714
75 Ga0068859_100005980 3300005617 Bacteria 12355
76 Ga0068859_100058800 3300005617 Bacteria 3873
77 Ga0068859_100076921 3300005617 Bacteria 3378
78 Ga0068859_100281497 3300005617 Unclassified 1756
79 Ga0068859_100325386 3300005617 Bacteria 1631
80 Ga0068864_100005776 3300005618 Bacteria 10155
81 Ga0068864_100006786 3300005618 Bacteria 9374
82 Ga0068864_100014785 3300005618 Bacteria 6483
83 Ga0068866_10033789 3300005718 Unclassified 2485
84 Ga0068866_10172234 3300005718 Bacteria 1272
85 Ga0068861_100072119 3300005719 Bacteria 2679
86 Ga0068861_100308633 3300005719 Bacteria 1373
87 Ga0068861_100458807 3300005719 Bacteria 1143
88 Ga0068851_10149151 3300005834 Unclassified 1277
89 Ga0068863_100006435 3300005841 Bacteria 11519
90 Ga0068863_100040181 3300005841 Bacteria 4448
91 Ga0068858_100010007 3300005842 Bacteria 9008
92 Ga0068858_100084520 3300005842 Bacteria 2952
93 Ga0068858_100088638 3300005842 Bacteria 2879
94 Ga0068858_100557910 3300005842 Bacteria 1109
95 Ga0068858_100587101 3300005842 Unclassified 1080
96 Ga0068858_100971284 3300005842 Unclassified 832
97 Ga0068860_100092487 3300005843 Bacteria 2882
98 Ga0068860_100119774 3300005843 Unclassified 2520
99 Ga0068860_100129447 3300005843 Bacteria 2421
100 Ga0068860_100170854 3300005843 Bacteria 2100
101 Ga0068860_100481557 3300005843 Bacteria 1237
102 Ga0068860_100628156 3300005843 Bacteria 1081
103 Ga0068860_101574698 3300005843 Unclassified 679
104 Ga0068862_100003527 3300005844 Bacteria 13422
105 Ga0097621_100004745 3300006237 Bacteria 9503
106 Ga0097621_100046049 3300006237 Bacteria 3527
107 Ga0097621_100046933 3300006237 Bacteria 3497
108 Ga0097621_100447251 3300006237 Unclassified 1164
109 Ga0097621_100463113 3300006237 Bacteria 1144
110 Ga0068871_100005286 3300006358 Bacteria 9039
111 Ga0068871_100008376 3300006358 Bacteria 7435
112 Ga0068871_100189271 3300006358 Bacteria 1772
113 Ga0068871_100324883 3300006358 Unclassified 1356
114 Ga0068871_100391247 3300006358 Unclassified 1236
115 Ga0068871_100536007 3300006358 Bacteria 1059
116 Ga0075433_10125116 3300006852 Unclassified 2283
117 Ga0075434_100042045 3300006871 Bacteria 4530
118 Ga0075434_100246643 3300006871 Bacteria 1805
119 Ga0075434_100536883 3300006871 Bacteria 1189
120 Ga0075429_100244750 3300006880 Bacteria 1570
121 Ga0068865_100032228 3300006881 Bacteria 3499
122 Ga0068865_100076997 3300006881 Unclassified 2382
123 Ga0068865_100173842 3300006881 Unclassified 1653
124 Ga0097620_100005980 3300006931 Bacteria 12355
125 Ga0097620_100058799 3300006931 Bacteria 3873
126 Ga0097620_100076918 3300006931 Bacteria 3378
127 Ga0097620_100281507 3300006931 Unclassified 1756
128 Ga0097620_100325387 3300006931 Bacteria 1631
129 Ga0097620_100472828 3300006931 Bacteria 1349
130 Ga0075435_100012766 3300007076 Bacteria 6223
131 Ga0075435_100019086 3300007076 Bacteria 5227
132 Ga0075435_100051749 3300007076 Unclassified 3309
133 Ga0075435_100646128 3300007076 Unclassified 918
134 Ga0105240_10353534 3300009093 Bacteria 1666
135 Ga0105240_10452672 3300009093 Bacteria 1436
136 Ga0105240_10984236 3300009093 Unclassified 903
137 Ga0111539_10009258 3300009094 Bacteria 12447
138 Ga0111539_10015826 3300009094 Bacteria 9369
139 Ga0105245_10007050 3300009098 Bacteria 9860
140 Ga0105245_10007545 3300009098 Bacteria 9529
141 Ga0105245_10527490 3300009098 Bacteria 1200
142 Ga0105247_10003857 3300009101 Bacteria 9702
143 Ga0105247_10163770 3300009101 Unclassified 1474
144 Ga0105247_10186940 3300009101 Unclassified 1385
145 Ga0114129_10003263 3300009147 Bacteria 22773
146 Ga0114129_10005317 3300009147 Bacteria 18171
147 Ga0114129_10006347 3300009147 Bacteria 16765
148 Ga0114129_10026894 3300009147 Bacteria 8144
149 Ga0114129_10032269 3300009147 Bacteria 7401
150 Ga0114129_10123246 3300009147 Bacteria 3565
151 Ga0114129_10487719 3300009147 Bacteria 1611
152 Ga0114129_10706428 3300009147 Bacteria 1295
153 Ga0105243_10030892 3300009148 Bacteria 4128
154 Ga0105243_10097776 3300009148 Bacteria 2430
155 Ga0105243_10184257 3300009148 Bacteria 1818
156 Ga0105243_10787059 3300009148 Bacteria 936
157 Ga0105241_10075703 3300009174 Unclassified 2623
158 Ga0105241_10151187 3300009174 Bacteria 1899
159 Ga0105242_10008708 3300009176 Bacteria 7785
160 Ga0105242_10054271 3300009176 Bacteria 3275
161 Ga0105242_10240029 3300009176 Bacteria 1629
162 Ga0105242_10281214 3300009176 Unclassified 1511
163 Ga0105242_10784121 3300009176 Bacteria 942
164 Ga0105248_10001232 3300009177 Bacteria 28565
165 Ga0105248_10066394 3300009177 Bacteria 4051
166 Ga0105248_10104046 3300009177 Unclassified 3200
167 Ga0105248_10139014 3300009177 Unclassified 2740
168 Ga0105248_10204074 3300009177 Unclassified 2227
169 Ga0105248_10509222 3300009177 Unclassified 1357
170 Ga0105248_10695594 3300009177 Unclassified 1147
171 Ga0105249_10225428 3300009553 Bacteria 1846
172 Ga0105249_10309744 3300009553 Bacteria 1587
173 Ga0105239_10150387 3300010375 Bacteria 2598
174 Ga0105239_10589291 3300010375 Unclassified 1268
175 Ga0105246_10874542 3300011119 Unclassified 804
176 Ga0157370_10568258 3300013104 Bacteria 1039
177 Ga0157374_10054586 3300013296 Bacteria 3727
178 Ga0157378_10377872 3300013297 Unclassified 1391
179 Ga0163162_10144331 3300013306 Bacteria 2495
180 Ga0163162_10162779 3300013306 Bacteria 2353
181 Ga0163162_10169739 3300013306 Unclassified 2306
182 Ga0157372_11244562 3300013307 Bacteria 859
183 Ga0157375_10033335 3300013308 Bacteria 4892
184 Ga0157375_10246064 3300013308 Bacteria 1948
185 Ga0157375_10334194 3300013308 Bacteria 1680
186 Ga0163163_10014413 3300014325 Bacteria 7266
187 Ga0163163_10016415 3300014325 Bacteria 6881
188 Ga0163163_10018628 3300014325 Bacteria 6503
189 Ga0163163_10126898 3300014325 Bacteria 2589
190 Ga0163163_10178220 3300014325 Bacteria 2172
191 Ga0163163_10301292 3300014325 Unclassified 1655
192 Ga0163163_10688874 3300014325 Unclassified 1086
193 Ga0157380_10284842 3300014326 Bacteria 1514
194 Ga0157380_10644147 3300014326 Bacteria 1056
195 Ga0157380_10671412 3300014326 Unclassified 1037
196 Ga0157379_10007034 3300014968 Bacteria 9724
197 Ga0157379_10014852 3300014968 Bacteria 6830
198 Ga0157379_10141520 3300014968 Unclassified 2169
199 Ga0157379_10283075 3300014968 Bacteria 1509
200 Ga0157379_10429770 3300014968 Unclassified 1217
201 Ga0157376_10074287 3300014969 Bacteria 2898
202 Ga0157376_10103749 3300014969 Unclassified 2490
203 Ga0157376_10207583 3300014969 Bacteria 1806
204 Ga0157376_10281355 3300014969 Unclassified 1567
205 Ga0207697_10058063 3300025315 Bacteria 1607
206 Ga0207642_10020988 3300025899 Unclassified 2562
207 Ga0207642_10171176 3300025899 Bacteria 1175
208 Ga0207710_10207448 3300025900 Bacteria 969
209 Ga0207688_10086718 3300025901 Bacteria 1794
210 Ga0207680_10014512 3300025903 Bacteria 4081
211 Ga0207680_10017377 3300025903 Bacteria 3799
212 Ga0207680_10060181 3300025903 Unclassified 2310
213 Ga0207645_10007045 3300025907 Bacteria 8004
214 Ga0207654_10018074 3300025911 Unclassified 3697
215 Ga0207707_10011906 3300025912 Bacteria 7568
216 Ga0207671_10160353 3300025914 Bacteria 1741
217 Ga0207663_10146814 3300025916 Unclassified 1650
218 Ga0207662_10005377 3300025918 Bacteria 6823
219 Ga0207662_10207288 3300025918 Bacteria 1271
220 Ga0207657_10163966 3300025919 Bacteria 1804
221 Ga0207649_10551313 3300025920 Unclassified 882
222 Ga0207652_10470450 3300025921 Unclassified 1132
223 Ga0207681_10017933 3300025923 Bacteria 4452
224 Ga0207681_10045503 3300025923 Bacteria 2947
225 Ga0207681_10346023 3300025923 Bacteria 1189
226 Ga0207650_10069242 3300025925 Bacteria 2651
227 Ga0207659_10070612 3300025926 Bacteria 2547
228 Ga0207659_10188929 3300025926 Unclassified 1638
229 Ga0207687_10052813 3300025927 Bacteria 2837
230 Ga0207687_10182709 3300025927 Bacteria 1626
231 Ga0207664_10190224 3300025929 Unclassified 1766
232 Ga0207644_10040972 3300025931 Bacteria 3275
233 Ga0207644_10165554 3300025931 Bacteria 1722
234 Ga0207706_10021717 3300025933 Bacteria 5761
235 Ga0207706_10404242 3300025933 Unclassified 1184
236 Ga0207686_10029915 3300025934 Bacteria 3219
237 Ga0207686_10119990 3300025934 Unclassified 1788
238 Ga0207686_10267565 3300025934 Bacteria 1256
239 Ga0207709_10066557 3300025935 Bacteria 2270
240 Ga0207709_10079481 3300025935 Bacteria 2109
241 Ga0207670_10026563 3300025936 Bacteria 3650
242 Ga0207670_10601516 3300025936 Unclassified 903
243 Ga0207669_10136093 3300025937 Unclassified 1697
244 Ga0207669_10511902 3300025937 Unclassified 962
245 Ga0207704_10067539 3300025938 Bacteria 2250
246 Ga0207691_10024575 3300025940 Bacteria 5667
247 Ga0207691_10165680 3300025940 Unclassified 1937
248 Ga0207711_10003390 3300025941 Bacteria 13802
249 Ga0207711_10010362 3300025941 Bacteria 7740
250 Ga0207711_10063964 3300025941 Unclassified 3177
251 Ga0207689_10068820 3300025942 Bacteria 2909
252 Ga0207679_10045696 3300025945 Bacteria 3169
253 Ga0207679_11067571 3300025945 Unclassified 741
254 Ga0207667_10232608 3300025949 Bacteria 1887
255 Ga0207667_10959109 3300025949 Bacteria 844
256 Ga0207651_10086664 3300025960 Unclassified 2277
257 Ga0207651_10166853 3300025960 Bacteria 1732
258 Ga0207668_10236638 3300025972 Bacteria 1475
259 Ga0207640_10152030 3300025981 Bacteria 1702
260 Ga0207640_10225525 3300025981 Unclassified 1438
261 Ga0207658_10036436 3300025986 Bacteria 3527
262 Ga0207658_10129909 3300025986 Unclassified 2022
263 Ga0207677_10095800 3300026023 Bacteria 2170
264 Ga0207677_10108032 3300026023 Bacteria 2065
265 Ga0207703_10008919 3300026035 Bacteria 7900
266 Ga0207703_10028163 3300026035 Bacteria 4426
267 Ga0207703_10117874 3300026035 Unclassified 2275
268 Ga0207703_10258812 3300026035 Bacteria 1572
269 Ga0207703_10414589 3300026035 Unclassified 1252
270 Ga0207703_10523703 3300026035 Bacteria 1115
271 Ga0207708_10012350 3300026075 Bacteria 6363
272 Ga0207641_10005871 3300026088 Bacteria 10418
273 Ga0207648_10024632 3300026089 Bacteria 5368
274 Ga0207648_10088831 3300026089 Bacteria 2699
275 Ga0207676_10003847 3300026095 Bacteria 10605
276 Ga0207676_10031107 3300026095 Bacteria 4012
277 Ga0207674_10054272 3300026116 Unclassified 4080
278 Ga0207674_10127682 3300026116 Bacteria 2507
279 Ga0207675_100014195 3300026118 Bacteria 7428
280 Ga0207675_100173957 3300026118 Bacteria 2059
281 Ga0207675_100186098 3300026118 Bacteria 1990
282 Ga0207675_100258159 3300026118 Bacteria 1688
283 Ga0207428_10028522 3300027907 Bacteria 4636
284 Ga0268266_10007922 3300028379 Bacteria 9505
285 Ga0268266_10032979 3300028379 Bacteria 4402
286 Ga0268265_10037464 3300028380 Bacteria 3560
287 Ga0268265_10120852 3300028380 Bacteria 2157
288 Ga0268265_10161760 3300028380 Bacteria 1902
289 Ga0268264_10091761 3300028381 Bacteria 2620
290 Ga0268264_10149735 3300028381 Bacteria 2091
291 Ga0268264_10335189 3300028381 Unclassified 1435
292 Ga0268264_10506022 3300028381 Unclassified 1179
293 Ga0265318_10046863 3300028577 Unclassified 1631
294 Ga0373930_0003417 3300034816 Bacteria 2515
295 Ga0373950_0020342 3300034818 Bacteria 1166
296 Ga0373958_0002489 3300034819 Bacteria 2592
297 Ga0373938_0000803 3300034957 Bacteria 5100
298 Ga0373929_0000391 3300035085 Bacteria 8247
299 Ga0373949_0000962 3300035090 Bacteria 8943
300 Ga0373951_0006727 3300035091 Bacteria 2625
301 Ga0373952_0000609 3300035092 Bacteria 6340
302 Ga0373932_0000643 3300035112 Bacteria 10620
303 Ga0373939_0011872 3300035114 Bacteria 2209
304 Ga0373941_0000188 3300035115 Bacteria 11707
305 Ga0373960_0000307 3300035121 Bacteria 9309
306 Ga0373942_0000765 3300035207 Bacteria 8840
307 Ga0373961_0001297 3300035241 Bacteria 7593
308 Ga0373962_0001739 3300035242 Bacteria 5181
309 Ga0373962_0070786 3300035242 Bacteria 1042
310 Ga0373962_0120149 3300035242 Unclassified 837
311 Ga0373931_0001662 3300035691 Bacteria 9627
312 Ga0373931_0252003 3300035691 Bacteria 1074
313 Ga0373935_0246179 3300035692 Unclassified 1250
314 Ga0373927_0264225 3300035695 Unclassified 1132
315 Ga0373947_0092820 3300035725 Bacteria 1886
316 Ga0373937_0756581 3300036401 Bacteria 919
317 Ga0436365_0246127 3300039437 Bacteria 1163
318 Ga0451576_0049229 3300045051 Bacteria 4422
319 Ga0495603_0085881 3300046455 Bacteria 1842
320 Ga0495635_0049064 3300046663 Unclassified 2910
321 Ga0495635_0367224 3300046663 Bacteria 959
322 Ga0495647_0015182 3300046681 Bacteria 2695
323 Ga0495658_0229546 3300046683 Bacteria 1164
324 Ga0496102_0110618 3300048905 Bacteria 2561
325 Ga0496104_0266264 3300048907 Bacteria 1626
326 Ga0496104_0491513 3300048907 Unclassified 1138
327 Ga0496105_0667915 3300048908 Unclassified 800
328 Ga0496108_0064059 3300048911 Bacteria 3096
329 Ga0496109_0179407 3300048912 Unclassified 1989
330 Ga0496109_0194319 3300048912 Bacteria 1907
331 Ga0496112_0004194 3300048915 Bacteria 12148
332 Ga0496112_0431918 3300048915 Bacteria 1255
333 Ga0496114_0233546 3300048917 Bacteria 1616
334 Ga0496114_0331678 3300048917 Unclassified 1345
335 Ga0496114_0370710 3300048917 Bacteria 1267
336 Ga0501034_0072838 3300049571 Unclassified 3444
337 nmdc:mga05p37_105328_c1 3300050507 Bacteria 3470
338 nmdc:mga05p37_20972_c1 3300050507 Bacteria 7910
339 nmdc:mga05p37_292168_c1 3300050507 Bacteria 1940
340 nmdc:mga05p37_5960_c2 3300050507 Bacteria 12647
341 nmdc:mga05p37_68058_c1 3300050507 Bacteria 4379
342 nmdc:mga05p37_69804_c1 3300050507 Bacteria 4322
343 nmdc:mga05p37_7937_c1 3300050507 Bacteria 12528
344 nmdc:mga05p37_952956_c1 3300050507 Unclassified 918
345 nmdc:mga08y16_278204_c1 3300050511 Bacteria 1727
346 nmdc:mga08y16_334983_c1 3300050511 Bacteria 1556
347 nmdc:mga08y16_39180_c1 3300050511 Bacteria 4972
348 nmdc:mga0n895_1214765_c1 3300050512 Unclassified 727
349 nmdc:mga0n895_247664_c1 3300050512 Bacteria 1808
350 nmdc:mga0n895_384228_c1 3300050512 Bacteria 1420
351 nmdc:mga0n895_404117_c1 3300050512 Bacteria 1381
352 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
353 nmdc:mga0n895_501979_c1 3300050512 Bacteria 1222
354 nmdc:mga0n895_850732_c1 3300050512 Unclassified 900
355 nmdc:mga0n895_9295_c1 3300050512 Bacteria 8588
356 nmdc:mga0n895_93_c1 3300050512 Bacteria 52210
357 nmdc:mga0rr50_104467_c1 3300050513 Unclassified 2232
358 nmdc:mga0rr50_10_c1 3300050513 Bacteria 218067
359 nmdc:mga0rr50_18067_c1 3300050513 Bacteria 4728
360 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
361 nmdc:mga0rr50_56876_c1 3300050513 Bacteria 2924
362 nmdc:mga0rr50_613425_c1 3300050513 Unclassified 928
363 nmdc:mga0rr50_824539_c1 3300050513 Unclassified 791
364 nmdc:mga08x19_102_c1 3300050514 Bacteria 75432
365 nmdc:mga08x19_148774_c1 3300050514 Bacteria 1585
366 nmdc:mga08x19_246970_c1 3300050514 Unclassified 1231
367 nmdc:mga08x19_2653_c1 3300050514 Bacteria 10819
368 nmdc:mga08x19_432872_c1 3300050514 Unclassified 925
369 nmdc:mga0a205_188902_c1 3300050515 Bacteria 1953
370 nmdc:mga0a205_315584_c1 3300050515 Unclassified 1435
371 nmdc:mga0a205_347839_c1 3300050515 Bacteria 1350
372 nmdc:mga0a205_59929_c1 3300050515 Bacteria 3676
373 nmdc:mga0a205_91649_c1 3300050515 Bacteria 2937
374 Ga0495601_0156484 3300053077 Unclassified 1488
375 Ga0495595_0061072 3300053084 Bacteria 1765
376 Ga0105245_10244078
377 Ga0065704_10269899
378 Ga0065715_10272019
379 Ga0065707_10114238
380 Ga0070676_10055446
381 Ga0070690_100110898
382 Ga0070670_100082664
383 Ga0068869_100118026
384 Ga0068869_100428790
385 Ga0070666_10007101
386 Ga0070666_10036685
387 Ga0070682_100121523
388 Ga0070682_100323966
389 Ga0068868_100002345
390 Ga0068868_100354015
391 Ga0070660_100134048
392 Ga0070691_10018649
393 Ga0070687_100013080
394 Ga0070669_100007558
395 Ga0070669_100023461
396 Ga0070675_100003154
397 Ga0070674_100008709
398 Ga0070674_100094717
399 Ga0070674_100326999
400 Ga0070673_100097023
401 Ga0070673_100166093
402 Ga0070673_100203188
403 Ga0070673_100272607
404 Ga0070673_100366694
405 Ga0070688_100006417
406 Ga0070688_100042265
407 Ga0070659_100503996
408 Ga0070667_100022496
409 Ga0070667_100050152
410 Ga0070667_100456267
411 Ga0070701_10058607
412 Ga0070711_100239884
413 Ga0070705_100071362
414 Ga0070705_100219836
415 Ga0070700_100003056
416 Ga0070700_100024886
417 Ga0070681_10010794
418 Ga0070681_10131154
419 Ga0068867_100371917
420 Ga0068867_100587441
421 Ga0070685_10063690
422 Ga0070685_10240374
423 Ga0070685_10287009
424 Ga0070706_100784648
425 Ga0070698_100105379
426 Ga0070698_101022847
427 Ga0070679_100019144
428 Ga0070679_100522418
429 Ga0070672_100123937
430 Ga0070686_100002146
431 Ga0070686_100143751
432 Ga0070686_100375251
433 Ga0070695_100036394
434 Ga0070696_100138570
435 Ga0070665_100000623
436 Ga0070665_100009823
437 Ga0070665_100014163
438 Ga0070665_100143644
439 Ga0070704_100317957
440 Ga0070704_100433169
441 Ga0070664_100049627
442 Ga0070664_100874123
443 Ga0068857_100064790
444 Ga0068857_100101632
445 Ga0068857_100152091
446 Ga0068857_100190038
447 Ga0068854_100007771
448 Ga0068856_100786649
449 Ga0070702_100017317
450 Ga0068859_100005980
451 Ga0068859_100058800
452 Ga0068859_100076921
453 Ga0068859_100281497
454 Ga0068859_100325386
455 Ga0068864_100005776
456 Ga0068864_100006786
457 Ga0068864_100014785
458 Ga0068866_10033789
459 Ga0068866_10172234
460 Ga0068861_100072119
461 Ga0068861_100308633
462 Ga0068861_100458807
463 Ga0068851_10149151
464 Ga0068863_100006435
465 Ga0068863_100040181
466 Ga0068858_100010007
467 Ga0068858_100084520
468 Ga0068858_100088638
469 Ga0068858_100557910
470 Ga0068858_100587101
471 Ga0068858_100971284
472 Ga0068860_100092487
473 Ga0068860_100119774
474 Ga0068860_100129447
475 Ga0068860_100170854
476 Ga0068860_100481557
477 Ga0068860_100628156
478 Ga0068860_101574698
479 Ga0068862_100003527
480 Ga0097621_100004745
481 Ga0097621_100046049
482 Ga0097621_100046933
483 Ga0097621_100447251
484 Ga0097621_100463113
485 Ga0068871_100005286
486 Ga0068871_100008376
487 Ga0068871_100189271
488 Ga0068871_100324883
489 Ga0068871_100391247
490 Ga0068871_100536007
491 Ga0075433_10125116
492 Ga0075434_100042045
493 Ga0075434_100246643
494 Ga0075434_100536883
495 Ga0075429_100244750
496 Ga0068865_100032228
497 Ga0068865_100076997
498 Ga0068865_100173842
499 Ga0097620_100005980
500 Ga0097620_100058799
501 Ga0097620_100076918
502 Ga0097620_100281507
503 Ga0097620_100325387
504 Ga0097620_100472828
505 Ga0075435_100012766
506 Ga0075435_100019086
507 Ga0075435_100051749
508 Ga0075435_100646128
509 Ga0105240_10353534
510 Ga0105240_10452672
511 Ga0105240_10984236
512 Ga0111539_10009258
513 Ga0111539_10015826
514 Ga0105245_10007050
515 Ga0105245_10007545
516 Ga0105245_10527490
517 Ga0105247_10003857
518 Ga0105247_10163770
519 Ga0105247_10186940
520 Ga0114129_10003263
521 Ga0114129_10005317
522 Ga0114129_10006347
523 Ga0114129_10026894
524 Ga0114129_10032269
525 Ga0114129_10123246
526 Ga0114129_10487719
527 Ga0114129_10706428
528 Ga0105243_10030892
529 Ga0105243_10097776
530 Ga0105243_10184257
531 Ga0105243_10787059
532 Ga0105241_10075703
533 Ga0105241_10151187
534 Ga0105242_10008708
535 Ga0105242_10054271
536 Ga0105242_10240029
537 Ga0105242_10281214
538 Ga0105242_10784121
539 Ga0105248_10001232
540 Ga0105248_10066394
541 Ga0105248_10104046
542 Ga0105248_10139014
543 Ga0105248_10204074
544 Ga0105248_10509222
545 Ga0105248_10695594
546 Ga0105249_10225428
547 Ga0105249_10309744
548 Ga0105239_10150387
549 Ga0105239_10589291
550 Ga0105246_10874542
551 Ga0157370_10568258
552 Ga0157374_10054586
553 Ga0157378_10377872
554 Ga0163162_10144331
555 Ga0163162_10162779
556 Ga0163162_10169739
557 Ga0157372_11244562
558 Ga0157375_10033335
559 Ga0157375_10246064
560 Ga0157375_10334194
561 Ga0163163_10014413
562 Ga0163163_10016415
563 Ga0163163_10018628
564 Ga0163163_10126898
565 Ga0163163_10178220
566 Ga0163163_10301292
567 Ga0163163_10688874
568 Ga0157380_10284842
569 Ga0157380_10644147
570 Ga0157380_10671412
571 Ga0157379_10007034
572 Ga0157379_10014852
573 Ga0157379_10141520
574 Ga0157379_10283075
575 Ga0157379_10429770
576 Ga0157376_10074287
577 Ga0157376_10103749
578 Ga0157376_10207583
579 Ga0157376_10281355
580 Ga0207697_10058063
581 Ga0207642_10020988
582 Ga0207642_10171176
583 Ga0207710_10207448
584 Ga0207688_10086718
585 Ga0207680_10014512
586 Ga0207680_10017377
587 Ga0207680_10060181
588 Ga0207645_10007045
589 Ga0207654_10018074
590 Ga0207707_10011906
591 Ga0207671_10160353
592 Ga0207663_10146814
593 Ga0207662_10005377
594 Ga0207662_10207288
595 Ga0207657_10163966
596 Ga0207649_10551313
597 Ga0207652_10470450
598 Ga0207681_10017933
599 Ga0207681_10045503
600 Ga0207681_10346023
601 Ga0207650_10069242
602 Ga0207659_10070612
603 Ga0207659_10188929
604 Ga0207687_10052813
605 Ga0207687_10182709
606 Ga0207664_10190224
607 Ga0207644_10040972
608 Ga0207644_10165554
609 Ga0207706_10021717
610 Ga0207706_10404242
611 Ga0207686_10029915
612 Ga0207686_10119990
613 Ga0207686_10267565
614 Ga0207709_10066557
615 Ga0207709_10079481
616 Ga0207670_10026563
617 Ga0207670_10601516
618 Ga0207669_10136093
619 Ga0207669_10511902
620 Ga0207704_10067539
621 Ga0207691_10024575
622 Ga0207691_10165680
623 Ga0207711_10003390
624 Ga0207711_10010362
625 Ga0207711_10063964
626 Ga0207689_10068820
627 Ga0207679_10045696
628 Ga0207679_11067571
629 Ga0207667_10232608
630 Ga0207667_10959109
631 Ga0207651_10086664
632 Ga0207651_10166853
633 Ga0207668_10236638
634 Ga0207640_10152030
635 Ga0207640_10225525
636 Ga0207658_10036436
637 Ga0207658_10129909
638 Ga0207677_10095800
639 Ga0207677_10108032
640 Ga0207703_10008919
641 Ga0207703_10028163
642 Ga0207703_10117874
643 Ga0207703_10258812
644 Ga0207703_10414589
645 Ga0207703_10523703
646 Ga0207708_10012350
647 Ga0207641_10005871
648 Ga0207648_10024632
649 Ga0207648_10088831
650 Ga0207676_10003847
651 Ga0207676_10031107
652 Ga0207674_10054272
653 Ga0207674_10127682
654 Ga0207675_100014195
655 Ga0207675_100173957
656 Ga0207675_100186098
657 Ga0207675_100258159
658 Ga0207428_10028522
659 Ga0268266_10007922
660 Ga0268266_10032979
661 Ga0268265_10037464
662 Ga0268265_10120852
663 Ga0268265_10161760
664 Ga0268264_10091761
665 Ga0268264_10149735
666 Ga0268264_10335189
667 Ga0268264_10506022
668 Ga0265318_10046863
669 Ga0373930_0003417
670 Ga0373950_0020342
671 Ga0373958_0002489
672 Ga0373938_0000803
673 Ga0373929_0000391
674 Ga0373949_0000962
675 Ga0373951_0006727
676 Ga0373952_0000609
677 Ga0373932_0000643
678 Ga0373939_0011872
679 Ga0373941_0000188
680 Ga0373960_0000307
681 Ga0373942_0000765
682 Ga0373961_0001297
683 Ga0373962_0001739
684 Ga0373962_0070786
685 Ga0373962_0120149
686 Ga0373931_0001662
687 Ga0373931_0252003
688 Ga0373935_0246179
689 Ga0373927_0264225
690 Ga0373947_0092820
691 Ga0373937_0756581
692 Ga0436365_0246127
693 Ga0451576_0049229
694 Ga0495603_0085881
695 Ga0495635_0049064
696 Ga0495635_0367224
697 Ga0495647_0015182
698 Ga0495658_0229546
699 Ga0496102_0110618
700 Ga0496104_0266264
701 Ga0496104_0491513
702 Ga0496105_0667915
703 Ga0496108_0064059
704 Ga0496109_0179407
705 Ga0496109_0194319
706 Ga0496112_0004194
707 Ga0496112_0431918
708 Ga0496114_0233546
709 Ga0496114_0331678
710 Ga0496114_0370710
711 Ga0501034_0072838
712 nmdc:mga05p37_105328_c1
713 nmdc:mga05p37_20972_c1
714 nmdc:mga05p37_292168_c1
715 nmdc:mga05p37_5960_c2
716 nmdc:mga05p37_68058_c1
717 nmdc:mga05p37_69804_c1
718 nmdc:mga05p37_7937_c1
719 nmdc:mga05p37_952956_c1
720 nmdc:mga08y16_278204_c1
721 nmdc:mga08y16_334983_c1
722 nmdc:mga08y16_39180_c1
723 nmdc:mga0n895_1214765_c1
724 nmdc:mga0n895_247664_c1
725 nmdc:mga0n895_384228_c1
726 nmdc:mga0n895_404117_c1
727 nmdc:mga0n895_4_c1
728 nmdc:mga0n895_501979_c1
729 nmdc:mga0n895_850732_c1
730 nmdc:mga0n895_9295_c1
731 nmdc:mga0n895_93_c1
732 nmdc:mga0rr50_104467_c1
733 nmdc:mga0rr50_10_c1
734 nmdc:mga0rr50_18067_c1
735 nmdc:mga0rr50_4_c1
736 nmdc:mga0rr50_56876_c1
737 nmdc:mga0rr50_613425_c1
738 nmdc:mga0rr50_824539_c1
739 nmdc:mga08x19_102_c1
740 nmdc:mga08x19_148774_c1
741 nmdc:mga08x19_246970_c1
742 nmdc:mga08x19_2653_c1
743 nmdc:mga08x19_432872_c1
744 nmdc:mga0a205_188902_c1
745 nmdc:mga0a205_315584_c1
746 nmdc:mga0a205_347839_c1
747 nmdc:mga0a205_59929_c1
748 nmdc:mga0a205_91649_c1
749 Ga0495601_0156484
750 Ga0495595_0061072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r6m-assembly1.cif.gz_A kusta0087/kusta0088 complex purified from kuenenia stuttgartiensis 0.8341 25 165
4u9e-assembly1.cif.gz_A crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, a104/57g ab3 0.7984 18 165
4u9e-assembly1.cif.gz_A crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, a104/57g ab3 0.7831 18 165
6r6n-assembly1.cif.gz_A recombinantly produced kusta0087/kusta0088 complex, c32m/c101m mutant 0.7791 23 165
2hfu-assembly1.cif.gz_A crystal structure of l. major mevalonate kinase in complex with r-mevalonate 0.7782 107 160
ID Description Score Start End Superfamily
4u9eA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7984 18 165 1.20.120.10
4u9eA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7831 18 165 1.20.120.10
4ib4A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7529 26 165 1.20.120.10
2bc5B00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7484 25 165 1.20.120.10
3u8pA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.7452 26 165 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A6N7JVM0-F1-model_v4 Cytochrome c 0.9467 18 167 GO:0005506
GO:0009055
GO:0016020
GO:0020037
GO:0022900
AF-A0A1F4DZZ7-F1-model_v4 Cytochrome c domain-containing protein 0.9358 18 168 GO:0005506
GO:0009055
GO:0020037
GO:0022900
AF-A0A7Z9W268-F1-model_v4 Cytochrome c 0.9299 18 168 GO:0005506
GO:0009055
GO:0020037
GO:0022900
AF-A0A1F2R312-F1-model_v4 Cytochrome c domain-containing protein 0.9269 20 185 GO:0005506
GO:0009055
GO:0020037
GO:0022900
AF-A0A177NI73-F1-model_v4 Cytochrome C 0.9264 20 169 GO:0005506
GO:0009055
GO:0020037
GO:0022900

Map