F426994

General Info

Members Datasets Scaffolds Average Seq Length
375 212 750 142

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10100789|Ga0070717_101007891
Length 162
Sequence VDHPAIGRALRARRTAAGKTVASVAVDAGLSVPYIANLENGRGNPTITALTRLAEALGMQLVVTLAPGEESQRAAAPGSPQMPASLVRLGRTPRFRRAVKAIATTLDLEAEEFALQLVAALAMLAHAMGKDLAEADWWRLLDALLLIAAHPAVPQGPEPDPG

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
76 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
197 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
200 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
201 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
202 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
203 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
204 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
208 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
209 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
210 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
211 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
212 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 2.67
Rhizosphere 87.73
Stem 0
Stem Tuber 0
Unclassified 8.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10100789 3300006028 Bacteria 2452
2 JGI24740J21852_10018228 3300001979 Bacteria 2496
3 JGI24739J22299_10009974 3300001989 Bacteria 3532
4 JGI24737J22298_10008597 3300001990 Bacteria 3413
5 JGI24735J21928_10015850 3300002067 Bacteria 2346
6 rootH1_10093123 3300003316 Bacteria 3852
7 rootH2_10104964 3300003320 Bacteria 2485
8 rootL2_10196748 3300003322 Bacteria 3282
9 Ga0070683_100096172 3300005329 Bacteria 2785
10 Ga0070670_100124467 3300005331 Bacteria 2225
11 Ga0068869_100065027 3300005334 Bacteria 2684
12 Ga0070680_100051468 3300005336 Bacteria 3360
13 Ga0070682_100040226 3300005337 Bacteria 2876
14 Ga0070682_100209306 3300005337 Bacteria 1381
15 Ga0070691_10031888 3300005341 Bacteria 2473
16 Ga0070692_10207624 3300005345 Bacteria 1151
17 Ga0070668_100093425 3300005347 Bacteria 2374
18 Ga0070659_100188259 3300005366 Bacteria 1696
19 Ga0070667_100074885 3300005367 Bacteria 2889
20 Ga0070714_100007588 3300005435 Bacteria 8448
21 Ga0070714_100012077 3300005435 Bacteria 6876
22 Ga0070714_100085300 3300005435 Bacteria 2758
23 Ga0070714_100191294 3300005435 Bacteria 1867
24 Ga0070714_100435623 3300005435 Bacteria 1243
25 Ga0070714_100603582 3300005435 Bacteria 1054
26 Ga0070714_100773445 3300005435 Bacteria 929
27 Ga0070714_100911749 3300005435 Bacteria 853
28 Ga0070714_101560388 3300005435 Bacteria 645
29 Ga0070714_102068088 3300005435 Bacteria 555
30 Ga0070713_100010334 3300005436 Bacteria 6742
31 Ga0070713_100059478 3300005436 Bacteria 3191
32 Ga0070713_100097045 3300005436 Bacteria 2546
33 Ga0070713_100421196 3300005436 Bacteria 1250
34 Ga0070713_100791980 3300005436 Bacteria 908
35 Ga0070710_10051606 3300005437 Bacteria 2310
36 Ga0070710_10097184 3300005437 Bacteria 1747
37 Ga0070710_10328066 3300005437 Bacteria 1007
38 Ga0070711_100061240 3300005439 Bacteria 2619
39 Ga0070711_100153661 3300005439 Unclassified 1738
40 Ga0070711_100180150 3300005439 Bacteria 1617
41 Ga0070711_101306174 3300005439 Bacteria 629
42 Ga0070694_101593809 3300005444 Bacteria 554
43 Ga0070708_100107247 3300005445 Bacteria 2564
44 Ga0070663_100104108 3300005455 Bacteria 2122
45 Ga0070663_100240025 3300005455 Bacteria 1430
46 Ga0070663_100335214 3300005455 Bacteria 1220
47 Ga0070678_100591852 3300005456 Bacteria 989
48 Ga0070681_10000767 3300005458 Bacteria 26678
49 Ga0070706_100173663 3300005467 Bacteria 2012
50 Ga0070706_100728037 3300005467 Bacteria 919
51 Ga0070707_100048003 3300005468 Bacteria 4089
52 Ga0070707_100054592 3300005468 Bacteria 3830
53 Ga0070698_100201112 3300005471 Bacteria 1928
54 Ga0070699_100015885 3300005518 Bacteria 6464
55 Ga0070699_100181453 3300005518 Bacteria 1868
56 Ga0070699_101797633 3300005518 Unclassified 561
57 Ga0070679_100068817 3300005530 Bacteria 3531
58 Ga0070697_100273983 3300005536 Bacteria 1447
59 Ga0070665_100928323 3300005548 Bacteria 883
60 Ga0068857_100256862 3300005577 Bacteria 1603
61 Ga0068857_100396757 3300005577 Bacteria 1283
62 Ga0068856_101203602 3300005614 Unclassified 774
63 Ga0068852_100228398 3300005616 Bacteria 1773
64 Ga0068863_101577770 3300005841 Bacteria 665
65 Ga0081540_1036182 3300005983 Bacteria 2636
66 Ga0070717_10098043 3300006028 Bacteria 2484
67 Ga0070717_10409001 3300006028 Bacteria 1220
68 Ga0070717_10628123 3300006028 Bacteria 975
69 Ga0070712_100006441 3300006175 Bacteria 7279
70 Ga0075434_101007783 3300006871 Unclassified 847
71 Ga0075436_100375289 3300006914 Unclassified 1028
72 Ga0105240_10291675 3300009093 Bacteria 1870
73 Ga0105243_10538857 3300009148 Bacteria 1113
74 Ga0105239_10838505 3300010375 Bacteria 1054
75 Ga0157369_10122322 3300013105 Bacteria 2760
76 Ga0157369_10269770 3300013105 Bacteria 1773
77 Ga0157372_10088730 3300013307 Bacteria 3511
78 Ga0157375_10115941 3300013308 Bacteria 2782
79 Ga0163163_10162126 3300014325 Bacteria 2281
80 Ga0224572_1001300 3300024225 Bacteria 3613
81 Ga0224572_1031104 3300024225 Bacteria 1018
82 Ga0207692_10105504 3300025898 Bacteria 1554
83 Ga0207692_10125628 3300025898 Bacteria 1442
84 Ga0207692_10186923 3300025898 Bacteria 1210
85 Ga0207692_10688898 3300025898 Bacteria 663
86 Ga0207699_10379204 3300025906 Bacteria 1003
87 Ga0207705_10215646 3300025909 Bacteria 1456
88 Ga0207684_10674265 3300025910 Unclassified 880
89 Ga0207707_10026970 3300025912 Bacteria 5021
90 Ga0207695_10999209 3300025913 Bacteria 716
91 Ga0207693_10027864 3300025915 Bacteria 4465
92 Ga0207693_10055550 3300025915 Bacteria 3106
93 Ga0207693_10251772 3300025915 Bacteria 1386
94 Ga0207663_10008732 3300025916 Bacteria 5321
95 Ga0207663_10151807 3300025916 Archaea 1626
96 Ga0207652_10035843 3300025921 Bacteria 4191
97 Ga0207646_10019816 3300025922 Bacteria 6244
98 Ga0207646_10051965 3300025922 Unclassified 3666
99 Ga0207646_10079877 3300025922 Bacteria 2924
100 Ga0207646_10333481 3300025922 Bacteria 1370
101 Ga0207700_10016031 3300025928 Bacteria 4967
102 Ga0207700_10027565 3300025928 Bacteria 3981
103 Ga0207700_10045382 3300025928 Bacteria 3242
104 Ga0207700_10727323 3300025928 Bacteria 887
105 Ga0207700_11382398 3300025928 Bacteria 626
106 Ga0207664_10009083 3300025929 Bacteria 6961
107 Ga0207664_10020739 3300025929 Bacteria 4878
108 Ga0207664_10077911 3300025929 Bacteria 2687
109 Ga0207664_10093183 3300025929 Bacteria 2473
110 Ga0207664_10099507 3300025929 Bacteria 2400
111 Ga0207664_10501107 3300025929 Bacteria 1087
112 Ga0207664_10531700 3300025929 Bacteria 1054
113 Ga0207644_11573011 3300025931 Bacteria 552
114 Ga0207690_10160370 3300025932 Bacteria 1676
115 Ga0207665_10014664 3300025939 Bacteria 5158
116 Ga0207665_10476693 3300025939 Bacteria 961
117 Ga0207668_10030071 3300025972 Bacteria 3567
118 Ga0207658_10080015 3300025986 Bacteria 2502
119 Ga0207678_10405366 3300026067 Bacteria 1181
120 Ga0207678_10408628 3300026067 Bacteria 1176
121 Ga0207702_10588051 3300026078 Bacteria 1091
122 Ga0207674_10114469 3300026116 Bacteria 2669
123 Ga0207674_10115490 3300026116 Bacteria 2656
124 Ga0207698_10142859 3300026142 Bacteria 2065
125 Ga0307517_10013982 3300028786 Bacteria 10833
126 Ga0307515_10019817 3300028794 Bacteria 12066
127 Ga0307512_10095693 3300030522 Bacteria 2041
128 Ga0307512_10180560 3300030522 Bacteria 1187
129 Ga0314311_1137772 3300030733 Bacteria 1285
130 Ga0316180_1027986 3300030736 Bacteria 1291
131 Ga0307513_10066082 3300031456 Bacteria 3802
132 Ga0307513_10253436 3300031456 Bacteria 1555
133 Ga0307509_10007870 3300031507 Bacteria 13770
134 Ga0307509_10266978 3300031507 Bacteria 1482
135 Ga0307509_10311924 3300031507 Bacteria 1315
136 Ga0307508_10005598 3300031616 Bacteria 11911
137 Ga0307508_10031683 3300031616 Bacteria 4778
138 Ga0307508_10497445 3300031616 Unclassified 814
139 Ga0307516_10000267 3300031730 Bacteria 67005
140 Ga0307516_10019049 3300031730 Bacteria 7120
141 Ga0307516_10019458 3300031730 Bacteria 7034
142 Ga0307405_10000536 3300031731 Bacteria 14374
143 Ga0307405_10518458 3300031731 Bacteria 959
144 Ga0307406_10013834 3300031901 Bacteria 4631
145 Ga0307407_10629788 3300031903 Bacteria 801
146 Ga0307412_10042173 3300031911 Bacteria 2963
147 Ga0307409_100003234 3300031995 Bacteria 8779
148 Ga0307416_100641829 3300032002 Bacteria 1146
149 Ga0307411_10073695 3300032005 Bacteria 2324
150 Ga0307415_100000264 3300032126 Bacteria 22656
151 Ga0307507_10061512 3300033179 Bacteria 3495
152 Ga0373926_0003524 3300035083 Bacteria 5065
153 Ga0373926_0066483 3300035083 Bacteria 1320
154 Ga0373934_0004330 3300035086 Bacteria 5241
155 Ga0373934_0400703 3300035086 Unclassified 573
156 Ga0373944_0003462 3300035089 Bacteria 4076
157 Ga0373951_0000122 3300035091 Bacteria 29207
158 Ga0373923_0005090 3300035111 Bacteria 4436
159 Ga0373923_0059534 3300035111 Unclassified 1619
160 Ga0373936_0001277 3300035113 Bacteria 9107
161 Ga0373936_0033582 3300035113 Bacteria 2034
162 Ga0373936_0259806 3300035113 Unclassified 777
163 Ga0373941_0504318 3300035115 Unclassified 515
164 Ga0373945_0000341 3300035116 Bacteria 13327
165 Ga0373945_0399719 3300035116 Bacteria 602
166 Ga0373953_0131015 3300035117 Unclassified 1069
167 Ga0373954_0016106 3300035118 Bacteria 3345
168 Ga0373954_0283016 3300035118 Unclassified 817
169 Ga0373956_0036854 3300035119 Unclassified 2160
170 Ga0373957_0050480 3300035120 Unclassified 1590
171 Ga0373957_0323275 3300035120 Unclassified 656
172 Ga0373943_0002469 3300035170 Bacteria 8405
173 Ga0373943_0058179 3300035170 Bacteria 1923
174 Ga0373946_0003291 3300035171 Bacteria 5739
175 Ga0373955_0234685 3300035172 Bacteria 1098
176 Ga0373942_0000433 3300035207 Bacteria 11687
177 Ga0373924_0044506 3300035410 Bacteria 1824
178 Ga0373924_0100389 3300035410 Unclassified 1244
179 Ga0373924_0284252 3300035410 Bacteria 734
180 Ga0373935_0237064 3300035692 Unclassified 1272
181 Ga0373935_0427324 3300035692 Bacteria 954
182 Ga0373933_0156791 3300035724 Bacteria 1444
183 Ga0373933_0206613 3300035724 Unclassified 1257
184 Ga0373933_0693015 3300035724 Bacteria 670
185 Ga0373947_0002266 3300035725 Bacteria 11624
186 Ga0373947_0072589 3300035725 Bacteria 2114
187 Ga0373947_0327286 3300035725 Bacteria 1026
188 Ga0373937_0078299 3300036401 Bacteria 3055
189 Ga0373937_0096568 3300036401 Bacteria 2741
190 Ga0373937_0130779 3300036401 Bacteria 2344
191 Ga0373937_0187023 3300036401 Unclassified 1945
192 Ga0373937_0796622 3300036401 Bacteria 893
193 Ga0373925_0001155 3300037068 Bacteria 23436
194 Ga0373925_0004173 3300037068 Bacteria 10966
195 Ga0373925_0012897 3300037068 Bacteria 6053
196 Ga0373925_0069143 3300037068 Bacteria 2667
197 Ga0373925_0096772 3300037068 Bacteria 2263
198 Ga0373925_1019496 3300037068 Unclassified 681
199 Ga0436364_0355204 3300037853 Unclassified 840
200 Ga0436364_0702858 3300037853 Bacteria 897
201 Ga0451787_280102 3300041441 Bacteria 1176
202 Ga0451791_1320907 3300041451 Bacteria 1433
203 Ga0451793_0872896 3300041452 Bacteria 809
204 Ga0451797_0023761 3300041453 Bacteria 903
205 Ga0466972_0079257 3300044658 Unclassified 1564
206 Ga0466957_0129601 3300044842 Bacteria 1615
207 Ga0495627_097862 3300046453 Bacteria 840
208 Ga0495592_0012119 3300046454 Bacteria 6541
209 Ga0495592_0173846 3300046454 Bacteria 1473
210 Ga0495592_0199915 3300046454 Unclassified 1349
211 Ga0495638_0058040 3300046460 Bacteria 2399
212 Ga0495641_0046232 3300046461 Bacteria 2002
213 Ga0495641_0046548 3300046461 Bacteria 1994
214 Ga0495651_0220866 3300046462 Unclassified 1311
215 Ga0495651_0386000 3300046462 Bacteria 917
216 Ga0495653_0012297 3300046463 Bacteria 6982
217 Ga0495653_0036374 3300046463 Bacteria 3878
218 Ga0495653_0042787 3300046463 Bacteria 3524
219 Ga0495662_0225456 3300046476 Bacteria 924
220 Ga0495664_0002489 3300046477 Bacteria 9908
221 Ga0495664_0009784 3300046477 Bacteria 5375
222 Ga0495664_0136810 3300046477 Bacteria 1484
223 Ga0495664_0197051 3300046477 Bacteria 1221
224 Ga0495585_0032416 3300046492 Bacteria 2960
225 Ga0495608_0036006 3300046511 Bacteria 3333
226 Ga0495608_0039250 3300046511 Bacteria 3174
227 Ga0495608_0200342 3300046511 Bacteria 1258
228 Ga0495608_0243164 3300046511 Bacteria 1124
229 Ga0495618_0020465 3300046514 Bacteria 4072
230 Ga0495618_0132602 3300046514 Bacteria 1594
231 Ga0495628_0018786 3300046516 Bacteria 5722
232 Ga0495628_0038556 3300046516 Bacteria 3824
233 Ga0495628_0320736 3300046516 Bacteria 1143
234 Ga0495628_0518875 3300046516 Bacteria 858
235 Ga0495628_0541829 3300046516 Bacteria 836
236 Ga0495630_0034389 3300046517 Bacteria 3784
237 Ga0495630_0174275 3300046517 Bacteria 1639
238 Ga0495630_0751297 3300046517 Bacteria 745
239 Ga0495630_0978464 3300046517 Bacteria 643
240 Ga0495630_1109528 3300046517 Bacteria 600
241 Ga0495630_1201658 3300046517 Bacteria 573
242 Ga0495632_0048329 3300046519 Bacteria 2107
243 Ga0495632_0064224 3300046519 Bacteria 1776
244 Ga0495643_0004383 3300046522 Bacteria 9887
245 Ga0495666_0056175 3300046526 Bacteria 1886
246 Ga0495652_0007038 3300046529 Bacteria 10394
247 Ga0495652_0043000 3300046529 Bacteria 3894
248 Ga0495652_0225022 3300046529 Bacteria 1407
249 Ga0495665_0023255 3300046531 Bacteria 3328
250 Ga0495665_0199106 3300046531 Bacteria 1038
251 Ga0495640_0036076 3300046533 Bacteria 3495
252 Ga0495640_0078269 3300046533 Bacteria 2203
253 Ga0495640_0082955 3300046533 Bacteria 2127
254 Ga0495640_0379603 3300046533 Bacteria 870
255 Ga0495586_0741176 3300046535 Bacteria 567
256 Ga0495587_0013665 3300046536 Bacteria 5100
257 Ga0495587_0089769 3300046536 Bacteria 1776
258 Ga0495587_0090428 3300046536 Bacteria 1768
259 Ga0495645_0010698 3300046543 Bacteria 6441
260 Ga0495645_0158014 3300046543 Unclassified 1569
261 Ga0495645_0285630 3300046543 Bacteria 1083
262 Ga0495633_0039185 3300046558 Bacteria 2262
263 Ga0495667_0014799 3300046559 Bacteria 5272
264 Ga0495667_0022940 3300046559 Bacteria 4205
265 Ga0495667_0043919 3300046559 Bacteria 2960
266 Ga0495667_0205480 3300046559 Bacteria 1259
267 Ga0495668_0438699 3300046616 Unclassified 718
268 Ga0495634_0139048 3300046642 Bacteria 1543
269 Ga0495635_0001028 3300046663 Bacteria 18450
270 Ga0495635_0026576 3300046663 Bacteria 4026
271 Ga0495635_0029305 3300046663 Bacteria 3826
272 Ga0495635_0236744 3300046663 Bacteria 1232
273 Ga0495657_0034065 3300046675 Bacteria 3540
274 Ga0495657_0071503 3300046675 Bacteria 2264
275 Ga0495657_0154252 3300046675 Bacteria 1424
276 Ga0495657_0306390 3300046675 Bacteria 946
277 Ga0495599_0007741 3300046678 Bacteria 6520
278 Ga0495599_0011236 3300046678 Bacteria 5499
279 Ga0495599_0022881 3300046678 Bacteria 3903
280 Ga0495599_0329759 3300046678 Bacteria 917
281 Ga0495623_0024930 3300046679 Bacteria 3853
282 Ga0495646_0029391 3300046680 Bacteria 3435
283 Ga0495646_0040769 3300046680 Bacteria 2857
284 Ga0495646_0210877 3300046680 Bacteria 1054
285 Ga0495658_0686871 3300046683 Unclassified 656
286 Ga0495624_0008234 3300046690 Bacteria 7290
287 Ga0495624_0120524 3300046690 Bacteria 1611
288 Ga0495624_0447068 3300046690 Bacteria 774
289 Ga0495649_0073849 3300046694 Bacteria 1827
290 Ga0495600_0033341 3300046809 Bacteria 3343
291 Ga0495600_0071248 3300046809 Bacteria 2271
292 Ga0495581_0009294 3300047315 Bacteria 5689
293 Ga0495581_0415823 3300047315 Bacteria 784
294 Ga0495604_0049102 3300047317 Bacteria 3280
295 Ga0495604_0054001 3300047317 Bacteria 3102
296 Ga0495604_0404367 3300047317 Bacteria 899
297 Ga0495674_0002122 3300047319 Bacteria 19484
298 Ga0495674_0040453 3300047319 Bacteria 4169
299 Ga0495674_0049517 3300047319 Bacteria 3712
300 Ga0495674_0053027 3300047319 Bacteria 3567
301 Ga0495674_0141820 3300047319 Bacteria 2019
302 Ga0495674_0407749 3300047319 Bacteria 1096
303 Ga0495676_0006485 3300047321 Bacteria 10786
304 Ga0495676_0416396 3300047321 Bacteria 890
305 Ga0495680_0020074 3300047322 Bacteria 5630
306 Ga0495680_0039290 3300047322 Bacteria 3776
307 Ga0495680_0049764 3300047322 Bacteria 3280
308 Ga0495680_0068105 3300047322 Bacteria 2720
309 Ga0495675_0060691 3300047444 Bacteria 2396
310 Ga0495675_0163528 3300047444 Bacteria 1370
311 Ga0495679_208101 3300047446 Bacteria 513
312 Ga0495685_015029 3300047447 Bacteria 2636
313 Ga0495684_0009473 3300047471 Bacteria 7515
314 Ga0495684_0037345 3300047471 Bacteria 3725
315 Ga0495684_0050188 3300047471 Bacteria 3186
316 Ga0495684_0076430 3300047471 Bacteria 2543
317 Ga0495686_0042777 3300047472 Bacteria 2877
318 Ga0495593_0159571 3300047673 Bacteria 1139
319 Ga0495593_0513427 3300047673 Unclassified 601
320 Ga0495602_0047123 3300048088 Bacteria 3887
321 Ga0495602_0095268 3300048088 Bacteria 2458
322 Ga0495602_0118978 3300048088 Bacteria 2129
323 Ga0495602_0222667 3300048088 Bacteria 1423
324 Ga0496102_1394892 3300048905 Bacteria 620
325 Ga0496108_0232629 3300048911 Bacteria 1603
326 Ga0496109_0408295 3300048912 Bacteria 1283
327 Ga0496111_0846981 3300048914 Bacteria 660
328 Ga0496112_0310194 3300048915 Bacteria 1523
329 Ga0496113_0543892 3300048916 Bacteria 932
330 Ga0496126_0112448 3300048929 Bacteria 2371
331 Ga0496126_0524720 3300048929 Bacteria 943
332 Ga0501031_0113791 3300049568 Bacteria 1767
333 Ga0501036_0074347 3300049572 Bacteria 2874
334 Ga0501038_0076648 3300049574 Bacteria 2824
335 Ga0501042_0103756 3300049578 Bacteria 2045
336 Ga0501048_0052892 3300049582 Bacteria 2890
337 Ga0501068_0426826 3300049584 Bacteria 856
338 Ga0501071_0074281 3300049587 Bacteria 2481
339 Ga0501072_0081636 3300049588 Bacteria 2563
340 Ga0501074_0042049 3300049590 Bacteria 3308
341 Ga0501075_0369981 3300049591 Bacteria 1092
342 Ga0501076_0011864 3300049592 Bacteria 6506
343 Ga0501079_0098169 3300049741 Bacteria 2271
344 Ga0501045_0117218 3300049824 Bacteria 1976
345 nmdc:mga0n895_814471_c1 3300050512 Unclassified 923
346 nmdc:mga0rr50_474177_c1 3300050513 Bacteria 1062
347 nmdc:mga08x19_901687_c1 3300050514 Bacteria 628
348 Ga0495601_0004796 3300053077 Bacteria 7842
349 Ga0495601_0142046 3300053077 Unclassified 1566
350 Ga0495612_0095871 3300053078 Bacteria 1260
351 Ga0495612_0175193 3300053078 Bacteria 941
352 Ga0495655_0006113 3300053083 Bacteria 2170
353 Ga0495595_0032986 3300053084 Bacteria 2334
354 Ga0495619_0274107 3300053085 Bacteria 1169
355 Ga0500644_0467821 3300053088 Bacteria 553
356 Ga0500646_0002738 3300053090 Bacteria 4546
357 Ga0500628_006437 3300053129 Bacteria 1986
358 Ga0500652_006643 3300053131 Bacteria 3737
359 Ga0500658_0318788 3300053134 Bacteria 714
360 Ga0500577_0300454 3300053142 Bacteria 701
361 Ga0500579_223337 3300053143 Unclassified 653
362 Ga0500600_0027527 3300053149 Bacteria 3368
363 Ga0500600_0100246 3300053149 Bacteria 1529
364 Ga0500633_0008975 3300053160 Bacteria 2606
365 Ga0500656_031536 3300053732 Bacteria 707
366 Ga0500587_007004 3300053739 Bacteria 1478
367 Ga0501084_0006180 3300054114 Bacteria 9846
368 Ga0501082_0102710 3300060353 Bacteria 2473
369 2676479481 2675903059 Bacteria 8644972
370 2753076359 2751185734 Bacteria 8863695
371 2768642094 2767802112 Bacteria 6465194
372 2816422653 2816332119 Bacteria 8120218
373 8001787974 8001781756 Bacteria 9586736
374 8001788501 8001781756 Bacteria 9586736
375 8047710563 8047710418 Bacteria 11023148
376 Ga0070717_10100789
377 JGI24740J21852_10018228
378 JGI24739J22299_10009974
379 JGI24737J22298_10008597
380 JGI24735J21928_10015850
381 rootH1_10093123
382 rootH2_10104964
383 rootL2_10196748
384 Ga0070683_100096172
385 Ga0070670_100124467
386 Ga0068869_100065027
387 Ga0070680_100051468
388 Ga0070682_100040226
389 Ga0070682_100209306
390 Ga0070691_10031888
391 Ga0070692_10207624
392 Ga0070668_100093425
393 Ga0070659_100188259
394 Ga0070667_100074885
395 Ga0070714_100007588
396 Ga0070714_100012077
397 Ga0070714_100085300
398 Ga0070714_100191294
399 Ga0070714_100435623
400 Ga0070714_100603582
401 Ga0070714_100773445
402 Ga0070714_100911749
403 Ga0070714_101560388
404 Ga0070714_102068088
405 Ga0070713_100010334
406 Ga0070713_100059478
407 Ga0070713_100097045
408 Ga0070713_100421196
409 Ga0070713_100791980
410 Ga0070710_10051606
411 Ga0070710_10097184
412 Ga0070710_10328066
413 Ga0070711_100061240
414 Ga0070711_100153661
415 Ga0070711_100180150
416 Ga0070711_101306174
417 Ga0070694_101593809
418 Ga0070708_100107247
419 Ga0070663_100104108
420 Ga0070663_100240025
421 Ga0070663_100335214
422 Ga0070678_100591852
423 Ga0070681_10000767
424 Ga0070706_100173663
425 Ga0070706_100728037
426 Ga0070707_100048003
427 Ga0070707_100054592
428 Ga0070698_100201112
429 Ga0070699_100015885
430 Ga0070699_100181453
431 Ga0070699_101797633
432 Ga0070679_100068817
433 Ga0070697_100273983
434 Ga0070665_100928323
435 Ga0068857_100256862
436 Ga0068857_100396757
437 Ga0068856_101203602
438 Ga0068852_100228398
439 Ga0068863_101577770
440 Ga0081540_1036182
441 Ga0070717_10098043
442 Ga0070717_10409001
443 Ga0070717_10628123
444 Ga0070712_100006441
445 Ga0075434_101007783
446 Ga0075436_100375289
447 Ga0105240_10291675
448 Ga0105243_10538857
449 Ga0105239_10838505
450 Ga0157369_10122322
451 Ga0157369_10269770
452 Ga0157372_10088730
453 Ga0157375_10115941
454 Ga0163163_10162126
455 Ga0224572_1001300
456 Ga0224572_1031104
457 Ga0207692_10105504
458 Ga0207692_10125628
459 Ga0207692_10186923
460 Ga0207692_10688898
461 Ga0207699_10379204
462 Ga0207705_10215646
463 Ga0207684_10674265
464 Ga0207707_10026970
465 Ga0207695_10999209
466 Ga0207693_10027864
467 Ga0207693_10055550
468 Ga0207693_10251772
469 Ga0207663_10008732
470 Ga0207663_10151807
471 Ga0207652_10035843
472 Ga0207646_10019816
473 Ga0207646_10051965
474 Ga0207646_10079877
475 Ga0207646_10333481
476 Ga0207700_10016031
477 Ga0207700_10027565
478 Ga0207700_10045382
479 Ga0207700_10727323
480 Ga0207700_11382398
481 Ga0207664_10009083
482 Ga0207664_10020739
483 Ga0207664_10077911
484 Ga0207664_10093183
485 Ga0207664_10099507
486 Ga0207664_10501107
487 Ga0207664_10531700
488 Ga0207644_11573011
489 Ga0207690_10160370
490 Ga0207665_10014664
491 Ga0207665_10476693
492 Ga0207668_10030071
493 Ga0207658_10080015
494 Ga0207678_10405366
495 Ga0207678_10408628
496 Ga0207702_10588051
497 Ga0207674_10114469
498 Ga0207674_10115490
499 Ga0207698_10142859
500 Ga0307517_10013982
501 Ga0307515_10019817
502 Ga0307512_10095693
503 Ga0307512_10180560
504 Ga0314311_1137772
505 Ga0316180_1027986
506 Ga0307513_10066082
507 Ga0307513_10253436
508 Ga0307509_10007870
509 Ga0307509_10266978
510 Ga0307509_10311924
511 Ga0307508_10005598
512 Ga0307508_10031683
513 Ga0307508_10497445
514 Ga0307516_10000267
515 Ga0307516_10019049
516 Ga0307516_10019458
517 Ga0307405_10000536
518 Ga0307405_10518458
519 Ga0307406_10013834
520 Ga0307407_10629788
521 Ga0307412_10042173
522 Ga0307409_100003234
523 Ga0307416_100641829
524 Ga0307411_10073695
525 Ga0307415_100000264
526 Ga0307507_10061512
527 Ga0373926_0003524
528 Ga0373926_0066483
529 Ga0373934_0004330
530 Ga0373934_0400703
531 Ga0373944_0003462
532 Ga0373951_0000122
533 Ga0373923_0005090
534 Ga0373923_0059534
535 Ga0373936_0001277
536 Ga0373936_0033582
537 Ga0373936_0259806
538 Ga0373941_0504318
539 Ga0373945_0000341
540 Ga0373945_0399719
541 Ga0373953_0131015
542 Ga0373954_0016106
543 Ga0373954_0283016
544 Ga0373956_0036854
545 Ga0373957_0050480
546 Ga0373957_0323275
547 Ga0373943_0002469
548 Ga0373943_0058179
549 Ga0373946_0003291
550 Ga0373955_0234685
551 Ga0373942_0000433
552 Ga0373924_0044506
553 Ga0373924_0100389
554 Ga0373924_0284252
555 Ga0373935_0237064
556 Ga0373935_0427324
557 Ga0373933_0156791
558 Ga0373933_0206613
559 Ga0373933_0693015
560 Ga0373947_0002266
561 Ga0373947_0072589
562 Ga0373947_0327286
563 Ga0373937_0078299
564 Ga0373937_0096568
565 Ga0373937_0130779
566 Ga0373937_0187023
567 Ga0373937_0796622
568 Ga0373925_0001155
569 Ga0373925_0004173
570 Ga0373925_0012897
571 Ga0373925_0069143
572 Ga0373925_0096772
573 Ga0373925_1019496
574 Ga0436364_0355204
575 Ga0436364_0702858
576 Ga0451787_280102
577 Ga0451791_1320907
578 Ga0451793_0872896
579 Ga0451797_0023761
580 Ga0466972_0079257
581 Ga0466957_0129601
582 Ga0495627_097862
583 Ga0495592_0012119
584 Ga0495592_0173846
585 Ga0495592_0199915
586 Ga0495638_0058040
587 Ga0495641_0046232
588 Ga0495641_0046548
589 Ga0495651_0220866
590 Ga0495651_0386000
591 Ga0495653_0012297
592 Ga0495653_0036374
593 Ga0495653_0042787
594 Ga0495662_0225456
595 Ga0495664_0002489
596 Ga0495664_0009784
597 Ga0495664_0136810
598 Ga0495664_0197051
599 Ga0495585_0032416
600 Ga0495608_0036006
601 Ga0495608_0039250
602 Ga0495608_0200342
603 Ga0495608_0243164
604 Ga0495618_0020465
605 Ga0495618_0132602
606 Ga0495628_0018786
607 Ga0495628_0038556
608 Ga0495628_0320736
609 Ga0495628_0518875
610 Ga0495628_0541829
611 Ga0495630_0034389
612 Ga0495630_0174275
613 Ga0495630_0751297
614 Ga0495630_0978464
615 Ga0495630_1109528
616 Ga0495630_1201658
617 Ga0495632_0048329
618 Ga0495632_0064224
619 Ga0495643_0004383
620 Ga0495666_0056175
621 Ga0495652_0007038
622 Ga0495652_0043000
623 Ga0495652_0225022
624 Ga0495665_0023255
625 Ga0495665_0199106
626 Ga0495640_0036076
627 Ga0495640_0078269
628 Ga0495640_0082955
629 Ga0495640_0379603
630 Ga0495586_0741176
631 Ga0495587_0013665
632 Ga0495587_0089769
633 Ga0495587_0090428
634 Ga0495645_0010698
635 Ga0495645_0158014
636 Ga0495645_0285630
637 Ga0495633_0039185
638 Ga0495667_0014799
639 Ga0495667_0022940
640 Ga0495667_0043919
641 Ga0495667_0205480
642 Ga0495668_0438699
643 Ga0495634_0139048
644 Ga0495635_0001028
645 Ga0495635_0026576
646 Ga0495635_0029305
647 Ga0495635_0236744
648 Ga0495657_0034065
649 Ga0495657_0071503
650 Ga0495657_0154252
651 Ga0495657_0306390
652 Ga0495599_0007741
653 Ga0495599_0011236
654 Ga0495599_0022881
655 Ga0495599_0329759
656 Ga0495623_0024930
657 Ga0495646_0029391
658 Ga0495646_0040769
659 Ga0495646_0210877
660 Ga0495658_0686871
661 Ga0495624_0008234
662 Ga0495624_0120524
663 Ga0495624_0447068
664 Ga0495649_0073849
665 Ga0495600_0033341
666 Ga0495600_0071248
667 Ga0495581_0009294
668 Ga0495581_0415823
669 Ga0495604_0049102
670 Ga0495604_0054001
671 Ga0495604_0404367
672 Ga0495674_0002122
673 Ga0495674_0040453
674 Ga0495674_0049517
675 Ga0495674_0053027
676 Ga0495674_0141820
677 Ga0495674_0407749
678 Ga0495676_0006485
679 Ga0495676_0416396
680 Ga0495680_0020074
681 Ga0495680_0039290
682 Ga0495680_0049764
683 Ga0495680_0068105
684 Ga0495675_0060691
685 Ga0495675_0163528
686 Ga0495679_208101
687 Ga0495685_015029
688 Ga0495684_0009473
689 Ga0495684_0037345
690 Ga0495684_0050188
691 Ga0495684_0076430
692 Ga0495686_0042777
693 Ga0495593_0159571
694 Ga0495593_0513427
695 Ga0495602_0047123
696 Ga0495602_0095268
697 Ga0495602_0118978
698 Ga0495602_0222667
699 Ga0496102_1394892
700 Ga0496108_0232629
701 Ga0496109_0408295
702 Ga0496111_0846981
703 Ga0496112_0310194
704 Ga0496113_0543892
705 Ga0496126_0112448
706 Ga0496126_0524720
707 Ga0501031_0113791
708 Ga0501036_0074347
709 Ga0501038_0076648
710 Ga0501042_0103756
711 Ga0501048_0052892
712 Ga0501068_0426826
713 Ga0501071_0074281
714 Ga0501072_0081636
715 Ga0501074_0042049
716 Ga0501075_0369981
717 Ga0501076_0011864
718 Ga0501079_0098169
719 Ga0501045_0117218
720 nmdc:mga0n895_814471_c1
721 nmdc:mga0rr50_474177_c1
722 nmdc:mga08x19_901687_c1
723 Ga0495601_0004796
724 Ga0495601_0142046
725 Ga0495612_0095871
726 Ga0495612_0175193
727 Ga0495655_0006113
728 Ga0495595_0032986
729 Ga0495619_0274107
730 Ga0500644_0467821
731 Ga0500646_0002738
732 Ga0500628_006437
733 Ga0500652_006643
734 Ga0500658_0318788
735 Ga0500577_0300454
736 Ga0500579_223337
737 Ga0500600_0027527
738 Ga0500600_0100246
739 Ga0500633_0008975
740 Ga0500656_031536
741 Ga0500587_007004
742 Ga0501084_0006180
743 Ga0501082_0102710
744 2676479481
745 2753076359
746 2768642094
747 2816422653
748 8001787974
749 8001788501
750 8047710563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

10

63

0.96

PF13560

HTH_31

Helix-turn-helix domain

5

66

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9816 2 57
5woq-assembly2.cif.gz_C crystal structure of an xre family protein transcriptional regulator from mycobacterium smegmatis 0.9806 3 56
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9762 3 57
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.976 2 56
4i6t-assembly1.cif.gz_A crystal structure of a t36a mutant of the restriction-modification controller protein c.esp1396i 0.9676 2 56
ID Description Score Start End Superfamily
5woqB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9884 3 56 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9816 2 57 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9762 3 57 1.10.260.40
2b5aA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.976 2 56 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9691 2 56 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7V5DR11-F1-model_v4 Cupin domain-containing protein 0.9817 1 58 GO:0003677
GO:0003700
GO:0005829
AF-F2ALL7-F1-model_v4 Transcriptional regulator, XRE family 0.9807 2 57 GO:0003677
GO:0003700
GO:0005829
AF-A0A7T7ALY2-F1-model_v4 Cupin domain-containing protein 0.9787 1 58 GO:0003677
GO:0003700
GO:0005829
AF-A0A7K0DE50-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9677 2 65 GO:0003677
GO:0003700
GO:0005829
AF-A0A373QD07-F1-model_v4 XRE family transcriptional regulator 0.9652 1 56 GO:0003677
GO:0003700
GO:0005829

Map