F426810

General Info

Members Datasets Scaffolds Average Seq Length
374 196 748 157

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1112409|Ga0451576_1112409_284_808
Length 174
Sequence MGLGVKAAGSILAVAAALAIQTTLSRFLVRGSVAVDLVLVAVVYVALTSGPVSGMLTGTFAGLLQDAMSTGVVGIGGLAKTIVGFFAGILGTQFIVAQPLPRFVVFFGATALHAVIFMGLYVLLDVRHFDAPYAAALGQSIGNAVVGVIAFQLVELLPGAVERRRARSGSRLRR

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.55
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 16.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_1112409 3300045051 Bacteria 826
2 Ga0065715_10051700 3300005293 Bacteria 1169
3 Ga0070690_100214407 3300005330 Bacteria 1346
4 Ga0070670_100585534 3300005331 Bacteria 997
5 Ga0068869_100989438 3300005334 Unclassified 732
6 Ga0070666_10054598 3300005335 Bacteria 2695
7 Ga0070666_10237809 3300005335 Bacteria 1287
8 Ga0068868_100085546 3300005338 Bacteria 2534
9 Ga0068868_100108353 3300005338 Bacteria 2255
10 Ga0068868_100118387 3300005338 Bacteria 2159
11 Ga0070687_100005910 3300005343 Bacteria 4976
12 Ga0070668_100104481 3300005347 Bacteria 2248
13 Ga0070669_100046104 3300005353 Bacteria 3178
14 Ga0070675_100033163 3300005354 Bacteria 4184
15 Ga0070674_100274932 3300005356 Bacteria 1333
16 Ga0070674_101203374 3300005356 Bacteria 673
17 Ga0070688_100941642 3300005365 Bacteria 683
18 Ga0070659_100210320 3300005366 Unclassified 1603
19 Ga0070659_100240588 3300005366 Bacteria 1498
20 Ga0070667_100132375 3300005367 Bacteria 2178
21 Ga0070667_100519063 3300005367 Bacteria 1093
22 Ga0070667_100927660 3300005367 Unclassified 811
23 Ga0070709_10417336 3300005434 Unclassified 1005
24 Ga0070709_10801185 3300005434 Unclassified 739
25 Ga0070713_100008763 3300005436 Bacteria 7198
26 Ga0070713_100956060 3300005436 Bacteria 825
27 Ga0070710_10517523 3300005437 Unclassified 819
28 Ga0070705_100212996 3300005440 Bacteria 1333
29 Ga0070705_100501942 3300005440 Bacteria 921
30 Ga0070694_100039940 3300005444 Bacteria 3126
31 Ga0070694_100363757 3300005444 Bacteria 1124
32 Ga0070708_100344279 3300005445 Bacteria 1405
33 Ga0070708_101206132 3300005445 Bacteria 708
34 Ga0070678_100117331 3300005456 Bacteria 2093
35 Ga0070662_100095383 3300005457 Bacteria 2242
36 Ga0068867_100178543 3300005459 Bacteria 1687
37 Ga0068867_100327068 3300005459 Bacteria 1272
38 Ga0070706_100462055 3300005467 Bacteria 1181
39 Ga0070706_100566035 3300005467 Bacteria 1057
40 Ga0070707_100025871 3300005468 Bacteria 5571
41 Ga0070707_100089150 3300005468 Bacteria 2984
42 Ga0070707_100178529 3300005468 Unclassified 2070
43 Ga0070698_100412324 3300005471 Unclassified 1285
44 Ga0070698_100424552 3300005471 Bacteria 1264
45 Ga0070699_100128856 3300005518 Bacteria 2230
46 Ga0070684_100365039 3300005535 Unclassified 1329
47 Ga0070697_100815340 3300005536 Unclassified 826
48 Ga0070697_100891100 3300005536 Bacteria 789
49 Ga0070672_100600189 3300005543 Unclassified 959
50 Ga0070686_100474332 3300005544 Bacteria 966
51 Ga0070695_100005061 3300005545 Bacteria 7765
52 Ga0070695_100541530 3300005545 Bacteria 906
53 Ga0070696_100132181 3300005546 Unclassified 1817
54 Ga0070693_100076907 3300005547 Bacteria 1979
55 Ga0070665_100000826 3300005548 Bacteria 40427
56 Ga0070665_100133390 3300005548 Bacteria 2485
57 Ga0070704_100028675 3300005549 Bacteria 3707
58 Ga0070704_100061227 3300005549 Bacteria 2693
59 Ga0070704_100127994 3300005549 Bacteria 1963
60 Ga0070704_100258890 3300005549 Bacteria 1432
61 Ga0070704_100851643 3300005549 Unclassified 817
62 Ga0070664_100130892 3300005564 Bacteria 2204
63 Ga0068854_100006585 3300005578 Bacteria 7397
64 Ga0068854_100225463 3300005578 Bacteria 1485
65 Ga0070702_100112601 3300005615 Bacteria 1690
66 Ga0068852_101425211 3300005616 Bacteria 715
67 Ga0068859_100262497 3300005617 Bacteria 1818
68 Ga0068859_100803937 3300005617 Unclassified 1028
69 Ga0068864_100061904 3300005618 Bacteria 3242
70 Ga0068864_100212195 3300005618 Bacteria 1783
71 Ga0068864_100221177 3300005618 Bacteria 1747
72 Ga0068866_10045114 3300005718 Bacteria 2209
73 Ga0068866_10086331 3300005718 Bacteria 1698
74 Ga0068861_100014377 3300005719 Bacteria 5555
75 Ga0068861_101648725 3300005719 Bacteria 633
76 Ga0068851_10161985 3300005834 Bacteria 1229
77 Ga0068863_100189357 3300005841 Bacteria 1977
78 Ga0068863_100391551 3300005841 Bacteria 1358
79 Ga0068858_100005203 3300005842 Bacteria 12746
80 Ga0068858_100034756 3300005842 Bacteria 4675
81 Ga0068858_100049416 3300005842 Bacteria 3895
82 Ga0068858_100227246 3300005842 Bacteria 1769
83 Ga0068858_100337140 3300005842 Unclassified 1443
84 Ga0068858_100550360 3300005842 Unclassified 1117
85 Ga0068862_100678565 3300005844 Bacteria 996
86 Ga0081455_10420731 3300005937 Bacteria 921
87 Ga0070717_10018115 3300006028 Bacteria 5493
88 Ga0075432_10070317 3300006058 Unclassified 1256
89 Ga0070716_100061552 3300006173 Bacteria 2173
90 Ga0070716_100272343 3300006173 Bacteria 1164
91 Ga0070716_100423888 3300006173 Bacteria 963
92 Ga0070716_100434080 3300006173 Bacteria 953
93 Ga0097621_100168765 3300006237 Unclassified 1885
94 Ga0097621_100292150 3300006237 Bacteria 1437
95 Ga0068871_100002634 3300006358 Bacteria 12252
96 Ga0068871_100848607 3300006358 Bacteria 844
97 Ga0075428_100471295 3300006844 Bacteria 1344
98 Ga0075433_10028753 3300006852 Bacteria 4728
99 Ga0075433_10042724 3300006852 Bacteria 3934
100 Ga0075433_10067864 3300006852 Bacteria 3130
101 Ga0075434_100000190 3300006871 Bacteria 40653
102 Ga0075434_100020173 3300006871 Bacteria 6459
103 Ga0075434_100103315 3300006871 Bacteria 2858
104 Ga0075434_100206538 3300006871 Bacteria 1984
105 Ga0075434_100213725 3300006871 Bacteria 1949
106 Ga0075434_100413432 3300006871 Bacteria 1370
107 Ga0068865_100038171 3300006881 Bacteria 3249
108 Ga0068865_100427079 3300006881 Bacteria 1091
109 Ga0075436_100045519 3300006914 Bacteria 3026
110 Ga0075436_100165587 3300006914 Unclassified 1560
111 Ga0075436_100180112 3300006914 Bacteria 1493
112 Ga0075436_100214461 3300006914 Bacteria 1365
113 Ga0075436_100435339 3300006914 Bacteria 953
114 Ga0075436_100546337 3300006914 Bacteria 850
115 Ga0097620_100262491 3300006931 Bacteria 1818
116 Ga0097620_100803955 3300006931 Unclassified 1028
117 Ga0075435_100001001 3300007076 Bacteria 17907
118 Ga0075435_100001513 3300007076 Bacteria 14953
119 Ga0075435_100009124 3300007076 Bacteria 7160
120 Ga0075435_100145734 3300007076 Unclassified 1989
121 Ga0075435_100194215 3300007076 Bacteria 1719
122 Ga0099794_10088095 3300007265 Unclassified 1538
123 Ga0099794_10430564 3300007265 Unclassified 691
124 Ga0099795_10321633 3300007788 Bacteria 685
125 Ga0105240_10648018 3300009093 Bacteria 1158
126 Ga0111539_10395843 3300009094 Bacteria 1609
127 Ga0105245_10011683 3300009098 Bacteria 7642
128 Ga0105245_10045761 3300009098 Bacteria 3908
129 Ga0105245_10166030 3300009098 Unclassified 2099
130 Ga0105245_10418061 3300009098 Bacteria 1343
131 Ga0105245_10928212 3300009098 Bacteria 913
132 Ga0105247_10009932 3300009101 Bacteria 5765
133 Ga0105247_10039778 3300009101 Bacteria 2873
134 Ga0105247_10722248 3300009101 Bacteria 752
135 Ga0114129_10002447 3300009147 Bacteria 25785
136 Ga0114129_10024569 3300009147 Bacteria 8537
137 Ga0114129_10183884 3300009147 Bacteria 2842
138 Ga0114129_10253767 3300009147 Bacteria 2360
139 Ga0105243_10152260 3300009148 Bacteria 1985
140 Ga0105243_10405313 3300009148 Bacteria 1268
141 Ga0105241_10430595 3300009174 Bacteria 1163
142 Ga0105242_10009082 3300009176 Bacteria 7635
143 Ga0105242_10026259 3300009176 Bacteria 4615
144 Ga0105242_10234007 3300009176 Unclassified 1648
145 Ga0105242_10423947 3300009176 Unclassified 1247
146 Ga0105242_12417552 3300009176 Bacteria 573
147 Ga0105248_10051460 3300009177 Bacteria 4621
148 Ga0105248_10084912 3300009177 Bacteria 3562
149 Ga0105248_10222764 3300009177 Bacteria 2123
150 Ga0105248_10229116 3300009177 Unclassified 2091
151 Ga0105248_10270104 3300009177 Unclassified 1915
152 Ga0105249_10272255 3300009553 Bacteria 1687
153 Ga0105249_11621990 3300009553 Unclassified 719
154 Ga0099796_10100845 3300010159 Bacteria 1086
155 Ga0105239_10880262 3300010375 Unclassified 1028
156 Ga0157374_10358666 3300013296 Bacteria 1449
157 Ga0157374_11031520 3300013296 Bacteria 842
158 Ga0157378_10087304 3300013297 Bacteria 2829
159 Ga0157378_10093177 3300013297 Bacteria 2742
160 Ga0157378_10579267 3300013297 Unclassified 1131
161 Ga0163162_10113605 3300013306 Bacteria 2807
162 Ga0157375_10381252 3300013308 Bacteria 1577
163 Ga0157375_10455802 3300013308 Unclassified 1444
164 Ga0163163_10029792 3300014325 Bacteria 5252
165 Ga0163163_10116502 3300014325 Bacteria 2703
166 Ga0157380_10102111 3300014326 Bacteria 2390
167 Ga0157380_10161760 3300014326 Bacteria 1946
168 Ga0157377_10072651 3300014745 Bacteria 1992
169 Ga0157379_10018370 3300014968 Bacteria 6164
170 Ga0157379_10084312 3300014968 Bacteria 2848
171 Ga0157379_10127178 3300014968 Bacteria 2293
172 Ga0157376_10028959 3300014969 Bacteria 4409
173 Ga0157376_10081022 3300014969 Bacteria 2786
174 Ga0157376_10085296 3300014969 Bacteria 2721
175 Ga0163161_10199544 3300017792 Unclassified 1541
176 Ga0207642_10233047 3300025899 Bacteria 1035
177 Ga0207688_10017556 3300025901 Bacteria 3889
178 Ga0207680_10004930 3300025903 Bacteria 6356
179 Ga0207680_10073754 3300025903 Bacteria 2123
180 Ga0207685_10184650 3300025905 Unclassified 969
181 Ga0207699_10301224 3300025906 Unclassified 1119
182 Ga0207645_10045054 3300025907 Bacteria 2820
183 Ga0207645_10325630 3300025907 Unclassified 1025
184 Ga0207684_10760049 3300025910 Bacteria 821
185 Ga0207695_10596218 3300025913 Bacteria 986
186 Ga0207663_10040262 3300025916 Bacteria 2839
187 Ga0207663_10151236 3300025916 Bacteria 1629
188 Ga0207660_10217230 3300025917 Bacteria 1499
189 Ga0207662_10029614 3300025918 Bacteria 3173
190 Ga0207646_10059994 3300025922 Bacteria 3397
191 Ga0207646_10109222 3300025922 Unclassified 2482
192 Ga0207681_10007321 3300025923 Bacteria 6762
193 Ga0207659_10018681 3300025926 Bacteria 4548
194 Ga0207659_10138324 3300025926 Bacteria 1888
195 Ga0207687_10029972 3300025927 Bacteria 3664
196 Ga0207687_10037098 3300025927 Bacteria 3323
197 Ga0207687_10084628 3300025927 Bacteria 2299
198 Ga0207687_10292489 3300025927 Bacteria 1309
199 Ga0207700_10004263 3300025928 Bacteria 8406
200 Ga0207644_10253574 3300025931 Unclassified 1405
201 Ga0207644_10762313 3300025931 Bacteria 809
202 Ga0207690_10244695 3300025932 Bacteria 1383
203 Ga0207706_10229020 3300025933 Bacteria 1626
204 Ga0207706_10319105 3300025933 Bacteria 1352
205 Ga0207686_10021379 3300025934 Bacteria 3713
206 Ga0207686_10027547 3300025934 Bacteria 3329
207 Ga0207686_10029146 3300025934 Bacteria 3253
208 Ga0207686_10320098 3300025934 Bacteria 1158
209 Ga0207669_10049058 3300025937 Bacteria 2513
210 Ga0207669_10383044 3300025937 Bacteria 1096
211 Ga0207704_10025956 3300025938 Bacteria 3206
212 Ga0207704_10429652 3300025938 Bacteria 1049
213 Ga0207665_10450707 3300025939 Bacteria 987
214 Ga0207691_10246071 3300025940 Unclassified 1545
215 Ga0207711_10034852 3300025941 Bacteria 4263
216 Ga0207711_10042586 3300025941 Bacteria 3869
217 Ga0207711_10183582 3300025941 Bacteria 1903
218 Ga0207711_10344082 3300025941 Unclassified 1380
219 Ga0207711_10377944 3300025941 Bacteria 1314
220 Ga0207711_11016980 3300025941 Unclassified 768
221 Ga0207679_10191022 3300025945 Unclassified 1703
222 Ga0207712_10110261 3300025961 Bacteria 2063
223 Ga0207712_10737444 3300025961 Bacteria 862
224 Ga0207668_10060061 3300025972 Bacteria 2667
225 Ga0207640_10041293 3300025981 Bacteria 2933
226 Ga0207640_10203731 3300025981 Bacteria 1501
227 Ga0207640_10339532 3300025981 Bacteria 1203
228 Ga0207658_10390046 3300025986 Bacteria 1222
229 Ga0207677_10025723 3300026023 Bacteria 3677
230 Ga0207677_10052317 3300026023 Bacteria 2774
231 Ga0207677_10131213 3300026023 Bacteria 1903
232 Ga0207703_10013538 3300026035 Bacteria 6354
233 Ga0207703_10127442 3300026035 Bacteria 2193
234 Ga0207703_10133994 3300026035 Bacteria 2143
235 Ga0207703_10335757 3300026035 Unclassified 1387
236 Ga0207703_10339677 3300026035 Unclassified 1380
237 Ga0207703_10353203 3300026035 Unclassified 1354
238 Ga0207639_10435651 3300026041 Bacteria 1187
239 Ga0207708_10231326 3300026075 Bacteria 1484
240 Ga0207708_10952660 3300026075 Bacteria 744
241 Ga0207641_10139051 3300026088 Unclassified 2189
242 Ga0207641_10278502 3300026088 Unclassified 1572
243 Ga0207641_10409721 3300026088 Bacteria 1303
244 Ga0207641_10434534 3300026088 Bacteria 1266
245 Ga0207648_10110904 3300026089 Bacteria 2408
246 Ga0207676_10012549 3300026095 Bacteria 6075
247 Ga0207676_10043641 3300026095 Bacteria 3454
248 Ga0207676_10306033 3300026095 Bacteria 1453
249 Ga0207675_100030197 3300026118 Bacteria 5048
250 Ga0207675_100068140 3300026118 Bacteria 3326
251 Ga0207683_10119480 3300026121 Bacteria 2365
252 Ga0207683_11434709 3300026121 Bacteria 638
253 Ga0207698_10139954 3300026142 Unclassified 2083
254 Ga0268266_10016269 3300028379 Bacteria 6357
255 Ga0268266_10085924 3300028379 Bacteria 2749
256 Ga0268265_10004046 3300028380 Bacteria 10315
257 Ga0268265_10624107 3300028380 Bacteria 1033
258 Ga0373930_0000217 3300034816 Bacteria 7136
259 Ga0373948_0041649 3300034817 Bacteria 962
260 Ga0373958_0022647 3300034819 Bacteria 1175
261 Ga0373959_0002009 3300034820 Bacteria 3241
262 Ga0373938_0000761 3300034957 Bacteria 5223
263 Ga0373929_0000186 3300035085 Bacteria 11019
264 Ga0373940_0001073 3300035088 Bacteria 4736
265 Ga0373944_0116432 3300035089 Bacteria 917
266 Ga0373949_0000706 3300035090 Bacteria 10840
267 Ga0373951_0006238 3300035091 Bacteria 2730
268 Ga0373952_0000162 3300035092 Bacteria 10094
269 Ga0373932_0000225 3300035112 Bacteria 16906
270 Ga0373936_0056236 3300035113 Bacteria 1599
271 Ga0373939_0001068 3300035114 Bacteria 6751
272 Ga0373941_0002660 3300035115 Bacteria 3959
273 Ga0373954_0380082 3300035118 Bacteria 698
274 Ga0373956_0092045 3300035119 Bacteria 1400
275 Ga0373957_0156593 3300035120 Bacteria 937
276 Ga0373960_0000670 3300035121 Bacteria 7056
277 Ga0373955_0267974 3300035172 Bacteria 1026
278 Ga0373955_0569680 3300035172 Bacteria 693
279 Ga0373942_0003210 3300035207 Bacteria 3864
280 Ga0373961_0007396 3300035241 Bacteria 2655
281 Ga0373962_0020880 3300035242 Bacteria 1723
282 Ga0373931_0005924 3300035691 Bacteria 5683
283 Ga0373937_0145039 3300036401 Bacteria 2222
284 Ga0373937_1418264 3300036401 Bacteria 642
285 Ga0373937_1816068 3300036401 Bacteria 556
286 Ga0373925_0298661 3300037068 Bacteria 1300
287 Ga0373925_0352682 3300037068 Bacteria 1195
288 Ga0373925_1253804 3300037068 Bacteria 609
289 Ga0453683_0204455 3300044673 Bacteria 1254
290 Ga0466961_0500316 3300044693 Bacteria 734
291 Ga0451576_0001964 3300045051 Bacteria 32704
292 Ga0451576_0202139 3300045051 Bacteria 2075
293 Ga0451576_2344023 3300045051 Unclassified 547
294 Ga0466967_1436421 3300045976 Unclassified 687
295 Ga0495592_0362333 3300046454 Bacteria 927
296 Ga0495603_0183204 3300046455 Bacteria 1211
297 Ga0495629_0071533 3300046459 Bacteria 2421
298 Ga0495580_0035407 3300046472 Bacteria 3590
299 Ga0495662_0246863 3300046476 Bacteria 879
300 Ga0495608_0239009 3300046511 Bacteria 1135
301 Ga0495628_0075235 3300046516 Bacteria 2630
302 Ga0495628_0140754 3300046516 Unclassified 1841
303 Ga0495630_0079090 3300046517 Bacteria 2480
304 Ga0495630_0301857 3300046517 Bacteria 1224
305 Ga0495652_0068492 3300046529 Bacteria 2973
306 Ga0495652_0164313 3300046529 Bacteria 1720
307 Ga0495645_0029741 3300046543 Bacteria 3975
308 Ga0495667_0034979 3300046559 Bacteria 3359
309 Ga0495667_0237760 3300046559 Unclassified 1161
310 Ga0495634_0174897 3300046642 Unclassified 1348
311 Ga0495635_0018731 3300046663 Bacteria 4830
312 Ga0495635_0371634 3300046663 Bacteria 952
313 Ga0495599_0040616 3300046678 Bacteria 2921
314 Ga0495647_0016522 3300046681 Bacteria 2599
315 Ga0495658_0049451 3300046683 Bacteria 2375
316 Ga0495658_0065503 3300046683 Bacteria 2096
317 Ga0495658_0646368 3300046683 Unclassified 677
318 Ga0495669_0189791 3300046684 Bacteria 981
319 Ga0495669_0207135 3300046684 Bacteria 938
320 Ga0495600_0165177 3300046809 Unclassified 1430
321 Ga0495600_0378743 3300046809 Bacteria 883
322 Ga0495604_0079310 3300047317 Bacteria 2462
323 Ga0495676_0514330 3300047321 Unclassified 785
324 Ga0495680_0032910 3300047322 Bacteria 4203
325 Ga0495684_0001235 3300047471 Bacteria 20581
326 Ga0495684_0159227 3300047471 Bacteria 1685
327 Ga0496105_1398234 3300048908 Unclassified 507
328 Ga0496106_0071771 3300048909 Bacteria 2647
329 Ga0496106_0158173 3300048909 Bacteria 1791
330 Ga0496107_0309886 3300048910 Bacteria 1175
331 Ga0496109_0044783 3300048912 Bacteria 4015
332 Ga0496110_1644513 3300048913 Unclassified 552
333 Ga0496112_0003279 3300048915 Bacteria 13364
334 Ga0496112_0007196 3300048915 Bacteria 9859
335 Ga0496112_0071429 3300048915 Bacteria 3431
336 Ga0496112_0320663 3300048915 Bacteria 1494
337 Ga0496112_0322261 3300048915 Bacteria 1490
338 Ga0496113_0121096 3300048916 Bacteria 2046
339 Ga0496113_0501832 3300048916 Bacteria 974
340 Ga0496114_0069888 3300048917 Bacteria 2949
341 Ga0496114_0080708 3300048917 Bacteria 2747
342 Ga0496114_0562552 3300048917 Bacteria 1007
343 Ga0496115_0197917 3300048918 Bacteria 1660
344 nmdc:mga05p37_11296_c1 3300050507 Bacteria 10623
345 nmdc:mga05p37_1153093_c1 3300050507 Bacteria 806
346 nmdc:mga05p37_26125_c1 3300050507 Bacteria 7100
347 nmdc:mga05p37_294161_c1 3300050507 Unclassified 1932
348 nmdc:mga05p37_29932_c1 3300050507 Bacteria 6645
349 nmdc:mga05p37_430963_c1 3300050507 Bacteria 1532
350 nmdc:mga0n895_124847_c1 3300050512 Bacteria 2597
351 nmdc:mga0n895_26330_c1 3300050512 Bacteria 5507
352 nmdc:mga0n895_315508_c1 3300050512 Bacteria 1584
353 nmdc:mga0n895_36_c1 3300050512 Bacteria 78366
354 nmdc:mga0n895_4275_c1 3300050512 Bacteria 11689
355 nmdc:mga0n895_449304_c1 3300050512 Unclassified 1301
356 nmdc:mga0n895_97324_c1 3300050512 Bacteria 2948
357 nmdc:mga0rr50_167891_c1 3300050513 Bacteria 1786
358 nmdc:mga0rr50_186194_c1 3300050513 Bacteria 1699
359 nmdc:mga0rr50_2783_c1 3300050513 Bacteria 9941
360 nmdc:mga0rr50_29703_c1 3300050513 Bacteria 3860
361 nmdc:mga0rr50_29_c1 3300050513 Bacteria 106517
362 nmdc:mga0rr50_615_c1 3300050513 Bacteria 19064
363 nmdc:mga08x19_1545_c2 3300050514 Bacteria 9881
364 nmdc:mga08x19_154_c1 3300050514 Bacteria 56260
365 nmdc:mga0a205_30278_c1 3300050515 Bacteria 4112
366 nmdc:mga0a205_473170_c1 3300050515 Bacteria 1111
367 nmdc:mga0a205_48636_c1 3300050515 Bacteria 4093
368 Ga0495601_0006765 3300053077 Bacteria 6716
369 Ga0495601_0199118 3300053077 Bacteria 1309
370 Ga0495595_0025443 3300053084 Bacteria 2623
371 Ga0495595_0090189 3300053084 Unclassified 1470
372 Ga0495619_0010538 3300053085 Bacteria 5815
373 Ga0495619_0019739 3300053085 Bacteria 4288
374 Ga0495619_0270629 3300053085 Bacteria 1177
375 Ga0451576_1112409
376 Ga0065715_10051700
377 Ga0070690_100214407
378 Ga0070670_100585534
379 Ga0068869_100989438
380 Ga0070666_10054598
381 Ga0070666_10237809
382 Ga0068868_100085546
383 Ga0068868_100108353
384 Ga0068868_100118387
385 Ga0070687_100005910
386 Ga0070668_100104481
387 Ga0070669_100046104
388 Ga0070675_100033163
389 Ga0070674_100274932
390 Ga0070674_101203374
391 Ga0070688_100941642
392 Ga0070659_100210320
393 Ga0070659_100240588
394 Ga0070667_100132375
395 Ga0070667_100519063
396 Ga0070667_100927660
397 Ga0070709_10417336
398 Ga0070709_10801185
399 Ga0070713_100008763
400 Ga0070713_100956060
401 Ga0070710_10517523
402 Ga0070705_100212996
403 Ga0070705_100501942
404 Ga0070694_100039940
405 Ga0070694_100363757
406 Ga0070708_100344279
407 Ga0070708_101206132
408 Ga0070678_100117331
409 Ga0070662_100095383
410 Ga0068867_100178543
411 Ga0068867_100327068
412 Ga0070706_100462055
413 Ga0070706_100566035
414 Ga0070707_100025871
415 Ga0070707_100089150
416 Ga0070707_100178529
417 Ga0070698_100412324
418 Ga0070698_100424552
419 Ga0070699_100128856
420 Ga0070684_100365039
421 Ga0070697_100815340
422 Ga0070697_100891100
423 Ga0070672_100600189
424 Ga0070686_100474332
425 Ga0070695_100005061
426 Ga0070695_100541530
427 Ga0070696_100132181
428 Ga0070693_100076907
429 Ga0070665_100000826
430 Ga0070665_100133390
431 Ga0070704_100028675
432 Ga0070704_100061227
433 Ga0070704_100127994
434 Ga0070704_100258890
435 Ga0070704_100851643
436 Ga0070664_100130892
437 Ga0068854_100006585
438 Ga0068854_100225463
439 Ga0070702_100112601
440 Ga0068852_101425211
441 Ga0068859_100262497
442 Ga0068859_100803937
443 Ga0068864_100061904
444 Ga0068864_100212195
445 Ga0068864_100221177
446 Ga0068866_10045114
447 Ga0068866_10086331
448 Ga0068861_100014377
449 Ga0068861_101648725
450 Ga0068851_10161985
451 Ga0068863_100189357
452 Ga0068863_100391551
453 Ga0068858_100005203
454 Ga0068858_100034756
455 Ga0068858_100049416
456 Ga0068858_100227246
457 Ga0068858_100337140
458 Ga0068858_100550360
459 Ga0068862_100678565
460 Ga0081455_10420731
461 Ga0070717_10018115
462 Ga0075432_10070317
463 Ga0070716_100061552
464 Ga0070716_100272343
465 Ga0070716_100423888
466 Ga0070716_100434080
467 Ga0097621_100168765
468 Ga0097621_100292150
469 Ga0068871_100002634
470 Ga0068871_100848607
471 Ga0075428_100471295
472 Ga0075433_10028753
473 Ga0075433_10042724
474 Ga0075433_10067864
475 Ga0075434_100000190
476 Ga0075434_100020173
477 Ga0075434_100103315
478 Ga0075434_100206538
479 Ga0075434_100213725
480 Ga0075434_100413432
481 Ga0068865_100038171
482 Ga0068865_100427079
483 Ga0075436_100045519
484 Ga0075436_100165587
485 Ga0075436_100180112
486 Ga0075436_100214461
487 Ga0075436_100435339
488 Ga0075436_100546337
489 Ga0097620_100262491
490 Ga0097620_100803955
491 Ga0075435_100001001
492 Ga0075435_100001513
493 Ga0075435_100009124
494 Ga0075435_100145734
495 Ga0075435_100194215
496 Ga0099794_10088095
497 Ga0099794_10430564
498 Ga0099795_10321633
499 Ga0105240_10648018
500 Ga0111539_10395843
501 Ga0105245_10011683
502 Ga0105245_10045761
503 Ga0105245_10166030
504 Ga0105245_10418061
505 Ga0105245_10928212
506 Ga0105247_10009932
507 Ga0105247_10039778
508 Ga0105247_10722248
509 Ga0114129_10002447
510 Ga0114129_10024569
511 Ga0114129_10183884
512 Ga0114129_10253767
513 Ga0105243_10152260
514 Ga0105243_10405313
515 Ga0105241_10430595
516 Ga0105242_10009082
517 Ga0105242_10026259
518 Ga0105242_10234007
519 Ga0105242_10423947
520 Ga0105242_12417552
521 Ga0105248_10051460
522 Ga0105248_10084912
523 Ga0105248_10222764
524 Ga0105248_10229116
525 Ga0105248_10270104
526 Ga0105249_10272255
527 Ga0105249_11621990
528 Ga0099796_10100845
529 Ga0105239_10880262
530 Ga0157374_10358666
531 Ga0157374_11031520
532 Ga0157378_10087304
533 Ga0157378_10093177
534 Ga0157378_10579267
535 Ga0163162_10113605
536 Ga0157375_10381252
537 Ga0157375_10455802
538 Ga0163163_10029792
539 Ga0163163_10116502
540 Ga0157380_10102111
541 Ga0157380_10161760
542 Ga0157377_10072651
543 Ga0157379_10018370
544 Ga0157379_10084312
545 Ga0157379_10127178
546 Ga0157376_10028959
547 Ga0157376_10081022
548 Ga0157376_10085296
549 Ga0163161_10199544
550 Ga0207642_10233047
551 Ga0207688_10017556
552 Ga0207680_10004930
553 Ga0207680_10073754
554 Ga0207685_10184650
555 Ga0207699_10301224
556 Ga0207645_10045054
557 Ga0207645_10325630
558 Ga0207684_10760049
559 Ga0207695_10596218
560 Ga0207663_10040262
561 Ga0207663_10151236
562 Ga0207660_10217230
563 Ga0207662_10029614
564 Ga0207646_10059994
565 Ga0207646_10109222
566 Ga0207681_10007321
567 Ga0207659_10018681
568 Ga0207659_10138324
569 Ga0207687_10029972
570 Ga0207687_10037098
571 Ga0207687_10084628
572 Ga0207687_10292489
573 Ga0207700_10004263
574 Ga0207644_10253574
575 Ga0207644_10762313
576 Ga0207690_10244695
577 Ga0207706_10229020
578 Ga0207706_10319105
579 Ga0207686_10021379
580 Ga0207686_10027547
581 Ga0207686_10029146
582 Ga0207686_10320098
583 Ga0207669_10049058
584 Ga0207669_10383044
585 Ga0207704_10025956
586 Ga0207704_10429652
587 Ga0207665_10450707
588 Ga0207691_10246071
589 Ga0207711_10034852
590 Ga0207711_10042586
591 Ga0207711_10183582
592 Ga0207711_10344082
593 Ga0207711_10377944
594 Ga0207711_11016980
595 Ga0207679_10191022
596 Ga0207712_10110261
597 Ga0207712_10737444
598 Ga0207668_10060061
599 Ga0207640_10041293
600 Ga0207640_10203731
601 Ga0207640_10339532
602 Ga0207658_10390046
603 Ga0207677_10025723
604 Ga0207677_10052317
605 Ga0207677_10131213
606 Ga0207703_10013538
607 Ga0207703_10127442
608 Ga0207703_10133994
609 Ga0207703_10335757
610 Ga0207703_10339677
611 Ga0207703_10353203
612 Ga0207639_10435651
613 Ga0207708_10231326
614 Ga0207708_10952660
615 Ga0207641_10139051
616 Ga0207641_10278502
617 Ga0207641_10409721
618 Ga0207641_10434534
619 Ga0207648_10110904
620 Ga0207676_10012549
621 Ga0207676_10043641
622 Ga0207676_10306033
623 Ga0207675_100030197
624 Ga0207675_100068140
625 Ga0207683_10119480
626 Ga0207683_11434709
627 Ga0207698_10139954
628 Ga0268266_10016269
629 Ga0268266_10085924
630 Ga0268265_10004046
631 Ga0268265_10624107
632 Ga0373930_0000217
633 Ga0373948_0041649
634 Ga0373958_0022647
635 Ga0373959_0002009
636 Ga0373938_0000761
637 Ga0373929_0000186
638 Ga0373940_0001073
639 Ga0373944_0116432
640 Ga0373949_0000706
641 Ga0373951_0006238
642 Ga0373952_0000162
643 Ga0373932_0000225
644 Ga0373936_0056236
645 Ga0373939_0001068
646 Ga0373941_0002660
647 Ga0373954_0380082
648 Ga0373956_0092045
649 Ga0373957_0156593
650 Ga0373960_0000670
651 Ga0373955_0267974
652 Ga0373955_0569680
653 Ga0373942_0003210
654 Ga0373961_0007396
655 Ga0373962_0020880
656 Ga0373931_0005924
657 Ga0373937_0145039
658 Ga0373937_1418264
659 Ga0373937_1816068
660 Ga0373925_0298661
661 Ga0373925_0352682
662 Ga0373925_1253804
663 Ga0453683_0204455
664 Ga0466961_0500316
665 Ga0451576_0001964
666 Ga0451576_0202139
667 Ga0451576_2344023
668 Ga0466967_1436421
669 Ga0495592_0362333
670 Ga0495603_0183204
671 Ga0495629_0071533
672 Ga0495580_0035407
673 Ga0495662_0246863
674 Ga0495608_0239009
675 Ga0495628_0075235
676 Ga0495628_0140754
677 Ga0495630_0079090
678 Ga0495630_0301857
679 Ga0495652_0068492
680 Ga0495652_0164313
681 Ga0495645_0029741
682 Ga0495667_0034979
683 Ga0495667_0237760
684 Ga0495634_0174897
685 Ga0495635_0018731
686 Ga0495635_0371634
687 Ga0495599_0040616
688 Ga0495647_0016522
689 Ga0495658_0049451
690 Ga0495658_0065503
691 Ga0495658_0646368
692 Ga0495669_0189791
693 Ga0495669_0207135
694 Ga0495600_0165177
695 Ga0495600_0378743
696 Ga0495604_0079310
697 Ga0495676_0514330
698 Ga0495680_0032910
699 Ga0495684_0001235
700 Ga0495684_0159227
701 Ga0496105_1398234
702 Ga0496106_0071771
703 Ga0496106_0158173
704 Ga0496107_0309886
705 Ga0496109_0044783
706 Ga0496110_1644513
707 Ga0496112_0003279
708 Ga0496112_0007196
709 Ga0496112_0071429
710 Ga0496112_0320663
711 Ga0496112_0322261
712 Ga0496113_0121096
713 Ga0496113_0501832
714 Ga0496114_0069888
715 Ga0496114_0080708
716 Ga0496114_0562552
717 Ga0496115_0197917
718 nmdc:mga05p37_11296_c1
719 nmdc:mga05p37_1153093_c1
720 nmdc:mga05p37_26125_c1
721 nmdc:mga05p37_294161_c1
722 nmdc:mga05p37_29932_c1
723 nmdc:mga05p37_430963_c1
724 nmdc:mga0n895_124847_c1
725 nmdc:mga0n895_26330_c1
726 nmdc:mga0n895_315508_c1
727 nmdc:mga0n895_36_c1
728 nmdc:mga0n895_4275_c1
729 nmdc:mga0n895_449304_c1
730 nmdc:mga0n895_97324_c1
731 nmdc:mga0rr50_167891_c1
732 nmdc:mga0rr50_186194_c1
733 nmdc:mga0rr50_2783_c1
734 nmdc:mga0rr50_29703_c1
735 nmdc:mga0rr50_29_c1
736 nmdc:mga0rr50_615_c1
737 nmdc:mga08x19_1545_c2
738 nmdc:mga08x19_154_c1
739 nmdc:mga0a205_30278_c1
740 nmdc:mga0a205_473170_c1
741 nmdc:mga0a205_48636_c1
742 Ga0495601_0006765
743 Ga0495601_0199118
744 Ga0495595_0025443
745 Ga0495595_0090189
746 Ga0495619_0010538
747 Ga0495619_0019739
748 Ga0495619_0270629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

6

158

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dve-assembly1.cif.gz_A crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter 0.6644 35 151
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.6334 2 150
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.6276 35 151
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.617 7 158
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.6127 35 151
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8098 6 151 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7879 1 153 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7571 6 151 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.734 1 153 1.10.1760.20
af_Q2G061_16_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7174 1 153 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A521TEM4-F1-model_v4 Rod shape-determining protein MreD 0.9415 1 157 GO:0005886
GO:0008360
AF-A0A7W0LCZ4-F1-model_v4 Rod shape-determining protein MreD 0.9379 1 140 GO:0005886
GO:0008360
AF-A0A2V8H818-F1-model_v4 Rod shape-determining protein MreD 0.9377 2 165 GO:0005886
GO:0008360
AF-A0A2V7X5A2-F1-model_v4 Rod shape-determining protein MreD 0.9353 32 155 GO:0005886
GO:0008360
AF-A0A7V8WEW9-F1-model_v4 Rod shape-determining protein MreD 0.9325 1 156 GO:0000155
GO:0005886
GO:0008360
GO:0071555

Map