F426616

General Info

Members Datasets Scaffolds Average Seq Length
374 223 748 279

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10002112|Ga0070709_100021123
Length 297
Sequence VLTLCGKGVRGSNPVTDTTSSKTLHVASSHPLGAVTAEEAFLLEKLNLSRLPKHLAVIMDGNGRWAQRRHLPRIAGHRKGTETARVTIETCSRLRIEALTLYAFSVENWRRPKAEIDFLMQLLREYIRQEMPLIQKNNIRMRFLGRADELPAAVQRDTREAVEATAGNTGMVLCIALNYGGRAEIIDAANAMIAERLASGSSQKLTEGDLERQLYTAGLSDPDLLVRTSGEMRISNFLLWQIAYAEIFVTETLWPDFNRARLLESFVEFQKRDRRYGGIGESEEHEPSASHANGSSR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.01
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10002112 3300005434 Bacteria 10752
2 Ga0065715_10136750 3300005293 Bacteria 1915
3 Ga0070690_100006399 3300005330 Bacteria 6673
4 Ga0070690_100043247 3300005330 Bacteria 2856
5 Ga0070670_100001641 3300005331 Bacteria 18107
6 Ga0068869_100019943 3300005334 Bacteria 4591
7 Ga0068868_100020304 3300005338 Bacteria 4988
8 Ga0068868_100066124 3300005338 Bacteria 2874
9 Ga0070660_100432081 3300005339 Bacteria 1091
10 Ga0070689_100157120 3300005340 Bacteria 1836
11 Ga0070661_100200137 3300005344 Bacteria 1526
12 Ga0070673_100218336 3300005364 Bacteria 1649
13 Ga0070667_100483063 3300005367 Bacteria 1134
14 Ga0070709_10063502 3300005434 Bacteria 2359
15 Ga0070709_10122146 3300005434 Bacteria 1767
16 Ga0070709_10149434 3300005434 Bacteria 1613
17 Ga0070714_100081041 3300005435 Bacteria 2825
18 Ga0070713_100070959 3300005436 Bacteria 2942
19 Ga0070713_100083328 3300005436 Bacteria 2733
20 Ga0070713_100139775 3300005436 Unclassified 2144
21 Ga0070710_10036152 3300005437 Bacteria 2699
22 Ga0070711_100007795 3300005439 Bacteria 6523
23 Ga0070711_100022010 3300005439 Bacteria 4127
24 Ga0070711_100432439 3300005439 Bacteria 1074
25 Ga0070711_100522484 3300005439 Bacteria 981
26 Ga0070705_100002438 3300005440 Bacteria 9351
27 Ga0070705_100095745 3300005440 Bacteria 1862
28 Ga0070700_100044968 3300005441 Bacteria 2722
29 Ga0070694_100005001 3300005444 Bacteria 7995
30 Ga0070694_100138050 3300005444 Bacteria 1768
31 Ga0070708_100054117 3300005445 Bacteria 3563
32 Ga0070708_100061785 3300005445 Bacteria 3348
33 Ga0070708_100317974 3300005445 Bacteria 1466
34 Ga0070708_100323197 3300005445 Bacteria 1453
35 Ga0070662_100119795 3300005457 Bacteria 2016
36 Ga0070681_10008275 3300005458 Bacteria 10182
37 Ga0070706_100008677 3300005467 Bacteria 9473
38 Ga0070706_100011845 3300005467 Bacteria 8094
39 Ga0070706_100074171 3300005467 Bacteria 3150
40 Ga0070707_100009912 3300005468 Bacteria 8869
41 Ga0070707_100156105 3300005468 Bacteria 2223
42 Ga0070707_100508752 3300005468 Bacteria 1166
43 Ga0070698_100009742 3300005471 Bacteria 10269
44 Ga0070698_100013121 3300005471 Bacteria 8768
45 Ga0070698_100023656 3300005471 Bacteria 6418
46 Ga0070699_100023538 3300005518 Bacteria 5306
47 Ga0070679_100002531 3300005530 Bacteria 16572
48 Ga0070679_100086678 3300005530 Bacteria 3118
49 Ga0070679_100294109 3300005530 Bacteria 1575
50 Ga0070684_100002502 3300005535 Bacteria 13548
51 Ga0070684_100010422 3300005535 Bacteria 7365
52 Ga0070697_100041234 3300005536 Bacteria 3735
53 Ga0070697_100188572 3300005536 Bacteria 1749
54 Ga0070697_100295882 3300005536 Unclassified 1391
55 Ga0068853_100095248 3300005539 Bacteria 2625
56 Ga0068853_100146700 3300005539 Bacteria 2121
57 Ga0070695_100007966 3300005545 Bacteria 6274
58 Ga0070696_100008246 3300005546 Bacteria 6974
59 Ga0070696_100069482 3300005546 Bacteria 2475
60 Ga0070696_100186408 3300005546 Bacteria 1542
61 Ga0070693_100000486 3300005547 Bacteria 17813
62 Ga0070665_100002449 3300005548 Bacteria 20462
63 Ga0070704_100018623 3300005549 Bacteria 4446
64 Ga0068855_100004334 3300005563 Bacteria 17348
65 Ga0068855_100013796 3300005563 Bacteria 9740
66 Ga0068855_100016514 3300005563 Bacteria 8879
67 Ga0070664_100025964 3300005564 Bacteria 4856
68 Ga0070664_100341676 3300005564 Bacteria 1360
69 Ga0068857_100000411 3300005577 Bacteria 30229
70 Ga0068857_100008869 3300005577 Bacteria 8712
71 Ga0068854_100022405 3300005578 Bacteria 4303
72 Ga0068854_100103020 3300005578 Bacteria 2142
73 Ga0068856_100002442 3300005614 Bacteria 19116
74 Ga0068856_100003710 3300005614 Bacteria 15327
75 Ga0068856_100011382 3300005614 Bacteria 8631
76 Ga0068856_100012212 3300005614 Bacteria 8322
77 Ga0070702_100120806 3300005615 Bacteria 1640
78 Ga0068859_100010653 3300005617 Bacteria 9254
79 Ga0068859_100282989 3300005617 Bacteria 1751
80 Ga0068864_100010505 3300005618 Bacteria 7651
81 Ga0068864_100178497 3300005618 Bacteria 1940
82 Ga0068861_100185386 3300005719 Bacteria 1735
83 Ga0068863_100007870 3300005841 Bacteria 10422
84 Ga0068863_100091190 3300005841 Bacteria 2890
85 Ga0068858_100013464 3300005842 Bacteria 7717
86 Ga0068858_100141097 3300005842 Bacteria 2262
87 Ga0068858_100144881 3300005842 Bacteria 2231
88 Ga0068860_100015978 3300005843 Bacteria 7326
89 Ga0068860_100091500 3300005843 Bacteria 2898
90 Ga0068860_100125119 3300005843 Bacteria 2464
91 Ga0081455_10152250 3300005937 Bacteria 1782
92 Ga0070717_10006698 3300006028 Bacteria 8497
93 Ga0070717_10034215 3300006028 Bacteria 4106
94 Ga0070717_10076481 3300006028 Bacteria 2802
95 Ga0070716_100033996 3300006173 Bacteria 2793
96 Ga0070716_100199310 3300006173 Bacteria 1329
97 Ga0070712_100092253 3300006175 Bacteria 2221
98 Ga0097621_100000310 3300006237 Bacteria 32966
99 Ga0097621_100000410 3300006237 Bacteria 29942
100 Ga0068871_100001885 3300006358 Bacteria 14189
101 Ga0075430_100273583 3300006846 Bacteria 1398
102 Ga0075431_100565475 3300006847 Bacteria 1123
103 Ga0075433_10017396 3300006852 Bacteria 5953
104 Ga0075433_10159777 3300006852 Bacteria 2005
105 Ga0075434_100020852 3300006871 Bacteria 6363
106 Ga0075434_100137875 3300006871 Bacteria 2459
107 Ga0075429_100214096 3300006880 Bacteria 1688
108 Ga0068865_100063790 3300006881 Bacteria 2591
109 Ga0075436_100041837 3300006914 Bacteria 3161
110 Ga0075436_100045448 3300006914 Bacteria 3029
111 Ga0075436_100152077 3300006914 Unclassified 1629
112 Ga0097620_100010653 3300006931 Bacteria 9254
113 Ga0097620_100282980 3300006931 Bacteria 1751
114 Ga0075435_100038131 3300007076 Bacteria 3831
115 Ga0099794_10015102 3300007265 Bacteria 3401
116 Ga0099794_10020343 3300007265 Bacteria 3002
117 Ga0099794_10048344 3300007265 Bacteria 2042
118 Ga0105240_10011923 3300009093 Bacteria 12054
119 Ga0105240_10017217 3300009093 Bacteria 9749
120 Ga0105240_10154684 3300009093 Bacteria 2729
121 Ga0111539_10459653 3300009094 Bacteria 1482
122 Ga0105245_10153836 3300009098 Bacteria 2177
123 Ga0105247_10132137 3300009101 Bacteria 1628
124 Ga0105247_10195267 3300009101 Bacteria 1357
125 Ga0114129_10161887 3300009147 Bacteria 3056
126 Ga0114129_10335902 3300009147 Bacteria 2005
127 Ga0105241_10007687 3300009174 Bacteria 7926
128 Ga0105242_10117336 3300009176 Bacteria 2278
129 Ga0105248_10006289 3300009177 Bacteria 13029
130 Ga0105248_10015336 3300009177 Bacteria 8450
131 Ga0105248_10053940 3300009177 Bacteria 4509
132 Ga0105248_10148059 3300009177 Bacteria 2649
133 Ga0105238_10001073 3300009551 Bacteria 27609
134 Ga0099796_10008468 3300010159 Bacteria 2744
135 Ga0105239_10083310 3300010375 Bacteria 3522
136 Ga0105239_10138790 3300010375 Bacteria 2708
137 Ga0157373_10011165 3300013100 Bacteria 6609
138 Ga0157373_10187623 3300013100 Bacteria 1457
139 Ga0157371_10047501 3300013102 Bacteria 3052
140 Ga0157369_10000226 3300013105 Bacteria 77681
141 Ga0157369_10016104 3300013105 Bacteria 8413
142 Ga0157374_10001532 3300013296 Bacteria 19457
143 Ga0157374_10001626 3300013296 Bacteria 18829
144 Ga0157374_10028973 3300013296 Bacteria 5006
145 Ga0157374_10161187 3300013296 Bacteria 2184
146 Ga0157374_10522249 3300013296 Bacteria 1193
147 Ga0157378_10000041 3300013297 Bacteria 112069
148 Ga0157378_10000545 3300013297 Bacteria 35778
149 Ga0157378_10003556 3300013297 Bacteria 13809
150 Ga0157378_10004410 3300013297 Bacteria 12389
151 Ga0157378_10006679 3300013297 Bacteria 10079
152 Ga0157378_10626327 3300013297 Bacteria 1089
153 Ga0163162_10125326 3300013306 Bacteria 2674
154 Ga0157372_10000321 3300013307 Bacteria 52711
155 Ga0157372_10003562 3300013307 Bacteria 16764
156 Ga0157375_10124814 3300013308 Bacteria 2688
157 Ga0157380_10177468 3300014326 Bacteria 1868
158 Ga0157380_10640934 3300014326 Bacteria 1058
159 Ga0157379_10040945 3300014968 Bacteria 4136
160 Ga0157376_10000004 3300014969 Bacteria 508493
161 Ga0206356_11727457 3300020070 Bacteria 1448
162 Ga0207653_10007482 3300025885 Bacteria 3404
163 Ga0207642_10019110 3300025899 Bacteria 2646
164 Ga0207710_10103668 3300025900 Bacteria 1344
165 Ga0207647_10028046 3300025904 Bacteria 3663
166 Ga0207699_10017022 3300025906 Bacteria 3815
167 Ga0207699_10090601 3300025906 Bacteria 1919
168 Ga0207699_10096083 3300025906 Bacteria 1870
169 Ga0207684_10023330 3300025910 Bacteria 5283
170 Ga0207684_10112417 3300025910 Bacteria 2331
171 Ga0207684_10147508 3300025910 Bacteria 2024
172 Ga0207707_10066463 3300025912 Bacteria 3140
173 Ga0207695_10031483 3300025913 Bacteria 5816
174 Ga0207695_10155981 3300025913 Bacteria 2217
175 Ga0207693_10096801 3300025915 Bacteria 2314
176 Ga0207693_10207134 3300025915 Bacteria 1542
177 Ga0207663_10133874 3300025916 Bacteria 1717
178 Ga0207663_10170467 3300025916 Bacteria 1545
179 Ga0207663_10282333 3300025916 Bacteria 1234
180 Ga0207663_10313210 3300025916 Bacteria 1177
181 Ga0207660_10039380 3300025917 Bacteria 3304
182 Ga0207652_10002182 3300025921 Bacteria 16719
183 Ga0207652_10027017 3300025921 Bacteria 4783
184 Ga0207652_10115116 3300025921 Bacteria 2388
185 Ga0207646_10004615 3300025922 Bacteria 14886
186 Ga0207646_10074561 3300025922 Unclassified 3031
187 Ga0207646_10444687 3300025922 Bacteria 1170
188 Ga0207681_10253332 3300025923 Bacteria 1375
189 Ga0207694_10002635 3300025924 Bacteria 14542
190 Ga0207694_10216355 3300025924 Bacteria 1562
191 Ga0207700_10022162 3300025928 Bacteria 4352
192 Ga0207700_10031145 3300025928 Unclassified 3786
193 Ga0207700_10053884 3300025928 Bacteria 3016
194 Ga0207700_10131544 3300025928 Bacteria 2044
195 Ga0207686_10162482 3300025934 Bacteria 1567
196 Ga0207686_10304838 3300025934 Bacteria 1184
197 Ga0207704_10277933 3300025938 Bacteria 1271
198 Ga0207665_10001611 3300025939 Bacteria 15221
199 Ga0207665_10017992 3300025939 Bacteria 4644
200 Ga0207665_10040699 3300025939 Bacteria 3102
201 Ga0207665_10041039 3300025939 Bacteria 3089
202 Ga0207665_10099717 3300025939 Bacteria 2026
203 Ga0207665_10132393 3300025939 Bacteria 1772
204 Ga0207665_10168934 3300025939 Bacteria 1578
205 Ga0207711_10050293 3300025941 Bacteria 3568
206 Ga0207711_10336517 3300025941 Bacteria 1396
207 Ga0207711_10484392 3300025941 Bacteria 1152
208 Ga0207689_10019971 3300025942 Bacteria 5642
209 Ga0207661_10015943 3300025944 Bacteria 5538
210 Ga0207661_10017880 3300025944 Bacteria 5257
211 Ga0207679_10285065 3300025945 Bacteria 1418
212 Ga0207667_10006927 3300025949 Bacteria 13697
213 Ga0207667_10144231 3300025949 Bacteria 2451
214 Ga0207651_10116458 3300025960 Bacteria 2017
215 Ga0207712_10087377 3300025961 Bacteria 2286
216 Ga0207640_10022089 3300025981 Bacteria 3803
217 Ga0207658_10531889 3300025986 Bacteria 1050
218 Ga0207677_10023222 3300026023 Bacteria 3826
219 Ga0207677_10026448 3300026023 Bacteria 3639
220 Ga0207677_10103725 3300026023 Bacteria 2100
221 Ga0207703_10096625 3300026035 Bacteria 2495
222 Ga0207703_10137443 3300026035 Bacteria 2117
223 Ga0207639_10085907 3300026041 Bacteria 2504
224 Ga0207708_10067680 3300026075 Bacteria 2732
225 Ga0207702_10005291 3300026078 Bacteria 11322
226 Ga0207702_10005881 3300026078 Bacteria 10666
227 Ga0207702_10036657 3300026078 Bacteria 4102
228 Ga0207702_10039360 3300026078 Bacteria 3960
229 Ga0207641_10016741 3300026088 Bacteria 6004
230 Ga0207641_10050836 3300026088 Bacteria 3508
231 Ga0207648_10147235 3300026089 Bacteria 2077
232 Ga0207676_10006270 3300026095 Bacteria 8397
233 Ga0207676_10062125 3300026095 Bacteria 2961
234 Ga0207676_10148826 3300026095 Bacteria 2014
235 Ga0207674_10002224 3300026116 Bacteria 24572
236 Ga0207674_10013561 3300026116 Bacteria 9033
237 Ga0207675_100004830 3300026118 Bacteria 12980
238 Ga0207675_100333704 3300026118 Bacteria 1483
239 Ga0209588_1005109 3300027671 Bacteria 3741
240 Ga0209588_1010466 3300027671 Bacteria 2789
241 Ga0265354_1000015 3300028016 Bacteria 26137
242 Ga0268266_10005497 3300028379 Bacteria 11797
243 Ga0268266_10071502 3300028379 Bacteria 3007
244 Ga0268264_10030086 3300028381 Bacteria 4452
245 Ga0268264_10064368 3300028381 Bacteria 3086
246 Ga0268264_10074903 3300028381 Bacteria 2877
247 Ga0265770_1006639 3300030878 Bacteria 1611
248 Ga0265765_1000128 3300030879 Bacteria 4523
249 Ga0265330_10054895 3300031235 Bacteria 1740
250 Ga0265316_10062979 3300031344 Bacteria 2877
251 Ga0307408_100017479 3300031548 Bacteria 4800
252 Ga0265314_10068860 3300031711 Bacteria 2377
253 Ga0307405_10145079 3300031731 Bacteria 1661
254 Ga0307413_10005464 3300031824 Bacteria 5678
255 Ga0307410_10024394 3300031852 Bacteria 3777
256 Ga0307410_10056688 3300031852 Bacteria 2665
257 Ga0307407_10039023 3300031903 Bacteria 2637
258 Ga0307412_10034819 3300031911 Bacteria 3212
259 Ga0307416_100286647 3300032002 Bacteria 1627
260 Ga0307411_10246338 3300032005 Bacteria 1402
261 Ga0316212_1005799 3300033547 Unclassified 1791
262 Ga0373934_0028146 3300035086 Bacteria 2188
263 Ga0373954_0085267 3300035118 Bacteria 1512
264 Ga0373962_0038980 3300035242 Bacteria 1332
265 Ga0373931_0159825 3300035691 Bacteria 1320
266 Ga0373927_0152909 3300035695 Bacteria 1511
267 Ga0373947_0043045 3300035725 Bacteria 2696
268 Ga0373937_0406848 3300036401 Bacteria 1291
269 Ga0373925_0005438 3300037068 Bacteria 9486
270 Ga0373925_0008674 3300037068 Bacteria 7408
271 Ga0373925_0014800 3300037068 Bacteria 5639
272 Ga0373925_0498734 3300037068 Bacteria 999
273 Ga0436363_1086449 3300039450 Bacteria 2552
274 Ga0451576_0057406 3300045051 Bacteria 4069
275 Ga0451576_0577112 3300045051 Bacteria 1182
276 Ga0495592_0207201 3300046454 Bacteria 1319
277 Ga0495603_0147148 3300046455 Bacteria 1369
278 Ga0495629_0008109 3300046459 Bacteria 7730
279 Ga0495629_0035317 3300046459 Bacteria 3533
280 Ga0495651_0208969 3300046462 Bacteria 1360
281 Ga0495580_0000271 3300046472 Bacteria 41618
282 Ga0495580_0003970 3300046472 Bacteria 12485
283 Ga0495580_0012094 3300046472 Bacteria 6642
284 Ga0495580_0087259 3300046472 Bacteria 2173
285 Ga0495580_0110302 3300046472 Bacteria 1911
286 Ga0495580_0292793 3300046472 Bacteria 1109
287 Ga0495582_0006558 3300046473 Bacteria 6458
288 Ga0495582_0021921 3300046473 Bacteria 3495
289 Ga0495582_0047502 3300046473 Bacteria 2365
290 Ga0495639_0008948 3300046475 Bacteria 4291
291 Ga0495662_0027442 3300046476 Bacteria 2750
292 Ga0495664_0122553 3300046477 Bacteria 1572
293 Ga0495628_0334462 3300046516 Bacteria 1116
294 Ga0495666_0134997 3300046526 Bacteria 1152
295 Ga0495665_0054037 3300046531 Bacteria 2122
296 Ga0495640_0256223 3300046533 Bacteria 1094
297 Ga0495586_0017364 3300046535 Bacteria 3825
298 Ga0495587_0034762 3300046536 Bacteria 3038
299 Ga0495587_0073376 3300046536 Bacteria 1988
300 Ga0495645_0029768 3300046543 Unclassified 3974
301 Ga0495635_0072282 3300046663 Bacteria 2364
302 Ga0495647_0002970 3300046681 Bacteria 5388
303 Ga0495658_0025072 3300046683 Bacteria 3184
304 Ga0495624_0051168 3300046690 Bacteria 2615
305 Ga0495674_0021210 3300047319 Bacteria 6011
306 Ga0495674_0050969 3300047319 Bacteria 3651
307 Ga0495674_0386318 3300047319 Bacteria 1132
308 Ga0495676_0039344 3300047321 Bacteria 3917
309 Ga0495680_0298199 3300047322 Bacteria 1132
310 Ga0495675_0100544 3300047444 Bacteria 1810
311 Ga0496100_0226638 3300048903 Bacteria 1374
312 Ga0496100_0379024 3300048903 Bacteria 1074
313 Ga0496101_0127334 3300048904 Bacteria 1931
314 Ga0496101_0160686 3300048904 Bacteria 1723
315 Ga0496102_0015333 3300048905 Bacteria 6674
316 Ga0496104_0313300 3300048907 Bacteria 1482
317 Ga0496105_0361345 3300048908 Bacteria 1158
318 Ga0496112_0014270 3300048915 Bacteria 7362
319 Ga0496112_0031950 3300048915 Bacteria 5110
320 Ga0496112_0084620 3300048915 Bacteria 3137
321 Ga0496112_0109049 3300048915 Bacteria 2739
322 Ga0496114_0020137 3300048917 Bacteria 5413
323 Ga0496115_0005620 3300048918 Bacteria 9128
324 Ga0496115_0012969 3300048918 Bacteria 6287
325 Ga0496115_0047240 3300048918 Bacteria 3442
326 Ga0501031_0004244 3300049568 Bacteria 9254
327 Ga0501032_0001765 3300049569 Bacteria 17062
328 Ga0501033_0081282 3300049570 Bacteria 2376
329 Ga0501034_0030720 3300049571 Bacteria 5459
330 Ga0501034_0033943 3300049571 Bacteria 5173
331 Ga0501036_0004893 3300049572 Bacteria 10819
332 Ga0501037_0008582 3300049573 Bacteria 7496
333 Ga0501038_0004813 3300049574 Bacteria 12539
334 Ga0501039_0026542 3300049575 Bacteria 4450
335 Ga0501043_0017561 3300049579 Bacteria 5609
336 Ga0501046_0001287 3300049580 Bacteria 24285
337 Ga0501047_0118661 3300049581 Bacteria 2527
338 Ga0501048_0018783 3300049582 Bacteria 5082
339 Ga0501067_0014793 3300049583 Bacteria 4316
340 Ga0501068_0006031 3300049584 Bacteria 6658
341 Ga0501068_0273573 3300049584 Bacteria 1078
342 Ga0501069_0021684 3300049585 Bacteria 3489
343 Ga0501070_0012218 3300049586 Bacteria 7244
344 Ga0501072_0003647 3300049588 Bacteria 11593
345 Ga0501073_0002520 3300049589 Bacteria 13685
346 Ga0501074_0027652 3300049590 Bacteria 4112
347 Ga0501076_0189175 3300049592 Bacteria 1679
348 Ga0501079_0023055 3300049741 Bacteria 4778
349 Ga0501080_0002089 3300049742 Bacteria 17337
350 Ga0501081_0131969 3300049743 Bacteria 1785
351 Ga0501083_0003451 3300049744 Bacteria 11042
352 Ga0501035_0037054 3300049822 Bacteria 4417
353 Ga0501044_0021174 3300049823 Bacteria 6942
354 Ga0501045_0191953 3300049824 Bacteria 1522
355 nmdc:mga05p37_555348_c1 3300050507 Bacteria 1306
356 nmdc:mga0qj67_30139_c1 3300050509 Bacteria 4219
357 nmdc:mga06r32_450358_c1 3300050510 Bacteria 1267
358 nmdc:mga0n895_13162_c1 3300050512 Bacteria 7450
359 nmdc:mga0n895_136878_c1 3300050512 Bacteria 2476
360 nmdc:mga0n895_44989_c1 3300050512 Bacteria 4306
361 nmdc:mga0rr50_11440_c1 3300050513 Bacteria 5682
362 nmdc:mga0rr50_322678_c1 3300050513 Bacteria 1295
363 nmdc:mga08x19_1879_c1 3300050514 Bacteria 12868
364 nmdc:mga08x19_788_c1 3300050514 Bacteria 20243
365 nmdc:mga0a205_312562_c1 3300050515 Bacteria 1443
366 nmdc:mga0a205_6715_c1 3300050515 Bacteria 10407
367 Ga0495612_0072794 3300053078 Bacteria 1435
368 Ga0495619_0155437 3300053085 Bacteria 1578
369 Ga0495619_0401593 3300053085 Bacteria 946
370 Ga0500588_0103652 3300053146 Bacteria 984
371 Ga0501084_0001785 3300054114 Bacteria 17123
372 Ga0501084_0249368 3300054114 Bacteria 1499
373 Ga0501082_0028552 3300060353 Bacteria 4805
374 Ga0530510_0133513 3300061734 Bacteria 1827
375 Ga0070709_10002112
376 Ga0065715_10136750
377 Ga0070690_100006399
378 Ga0070690_100043247
379 Ga0070670_100001641
380 Ga0068869_100019943
381 Ga0068868_100020304
382 Ga0068868_100066124
383 Ga0070660_100432081
384 Ga0070689_100157120
385 Ga0070661_100200137
386 Ga0070673_100218336
387 Ga0070667_100483063
388 Ga0070709_10063502
389 Ga0070709_10122146
390 Ga0070709_10149434
391 Ga0070714_100081041
392 Ga0070713_100070959
393 Ga0070713_100083328
394 Ga0070713_100139775
395 Ga0070710_10036152
396 Ga0070711_100007795
397 Ga0070711_100022010
398 Ga0070711_100432439
399 Ga0070711_100522484
400 Ga0070705_100002438
401 Ga0070705_100095745
402 Ga0070700_100044968
403 Ga0070694_100005001
404 Ga0070694_100138050
405 Ga0070708_100054117
406 Ga0070708_100061785
407 Ga0070708_100317974
408 Ga0070708_100323197
409 Ga0070662_100119795
410 Ga0070681_10008275
411 Ga0070706_100008677
412 Ga0070706_100011845
413 Ga0070706_100074171
414 Ga0070707_100009912
415 Ga0070707_100156105
416 Ga0070707_100508752
417 Ga0070698_100009742
418 Ga0070698_100013121
419 Ga0070698_100023656
420 Ga0070699_100023538
421 Ga0070679_100002531
422 Ga0070679_100086678
423 Ga0070679_100294109
424 Ga0070684_100002502
425 Ga0070684_100010422
426 Ga0070697_100041234
427 Ga0070697_100188572
428 Ga0070697_100295882
429 Ga0068853_100095248
430 Ga0068853_100146700
431 Ga0070695_100007966
432 Ga0070696_100008246
433 Ga0070696_100069482
434 Ga0070696_100186408
435 Ga0070693_100000486
436 Ga0070665_100002449
437 Ga0070704_100018623
438 Ga0068855_100004334
439 Ga0068855_100013796
440 Ga0068855_100016514
441 Ga0070664_100025964
442 Ga0070664_100341676
443 Ga0068857_100000411
444 Ga0068857_100008869
445 Ga0068854_100022405
446 Ga0068854_100103020
447 Ga0068856_100002442
448 Ga0068856_100003710
449 Ga0068856_100011382
450 Ga0068856_100012212
451 Ga0070702_100120806
452 Ga0068859_100010653
453 Ga0068859_100282989
454 Ga0068864_100010505
455 Ga0068864_100178497
456 Ga0068861_100185386
457 Ga0068863_100007870
458 Ga0068863_100091190
459 Ga0068858_100013464
460 Ga0068858_100141097
461 Ga0068858_100144881
462 Ga0068860_100015978
463 Ga0068860_100091500
464 Ga0068860_100125119
465 Ga0081455_10152250
466 Ga0070717_10006698
467 Ga0070717_10034215
468 Ga0070717_10076481
469 Ga0070716_100033996
470 Ga0070716_100199310
471 Ga0070712_100092253
472 Ga0097621_100000310
473 Ga0097621_100000410
474 Ga0068871_100001885
475 Ga0075430_100273583
476 Ga0075431_100565475
477 Ga0075433_10017396
478 Ga0075433_10159777
479 Ga0075434_100020852
480 Ga0075434_100137875
481 Ga0075429_100214096
482 Ga0068865_100063790
483 Ga0075436_100041837
484 Ga0075436_100045448
485 Ga0075436_100152077
486 Ga0097620_100010653
487 Ga0097620_100282980
488 Ga0075435_100038131
489 Ga0099794_10015102
490 Ga0099794_10020343
491 Ga0099794_10048344
492 Ga0105240_10011923
493 Ga0105240_10017217
494 Ga0105240_10154684
495 Ga0111539_10459653
496 Ga0105245_10153836
497 Ga0105247_10132137
498 Ga0105247_10195267
499 Ga0114129_10161887
500 Ga0114129_10335902
501 Ga0105241_10007687
502 Ga0105242_10117336
503 Ga0105248_10006289
504 Ga0105248_10015336
505 Ga0105248_10053940
506 Ga0105248_10148059
507 Ga0105238_10001073
508 Ga0099796_10008468
509 Ga0105239_10083310
510 Ga0105239_10138790
511 Ga0157373_10011165
512 Ga0157373_10187623
513 Ga0157371_10047501
514 Ga0157369_10000226
515 Ga0157369_10016104
516 Ga0157374_10001532
517 Ga0157374_10001626
518 Ga0157374_10028973
519 Ga0157374_10161187
520 Ga0157374_10522249
521 Ga0157378_10000041
522 Ga0157378_10000545
523 Ga0157378_10003556
524 Ga0157378_10004410
525 Ga0157378_10006679
526 Ga0157378_10626327
527 Ga0163162_10125326
528 Ga0157372_10000321
529 Ga0157372_10003562
530 Ga0157375_10124814
531 Ga0157380_10177468
532 Ga0157380_10640934
533 Ga0157379_10040945
534 Ga0157376_10000004
535 Ga0206356_11727457
536 Ga0207653_10007482
537 Ga0207642_10019110
538 Ga0207710_10103668
539 Ga0207647_10028046
540 Ga0207699_10017022
541 Ga0207699_10090601
542 Ga0207699_10096083
543 Ga0207684_10023330
544 Ga0207684_10112417
545 Ga0207684_10147508
546 Ga0207707_10066463
547 Ga0207695_10031483
548 Ga0207695_10155981
549 Ga0207693_10096801
550 Ga0207693_10207134
551 Ga0207663_10133874
552 Ga0207663_10170467
553 Ga0207663_10282333
554 Ga0207663_10313210
555 Ga0207660_10039380
556 Ga0207652_10002182
557 Ga0207652_10027017
558 Ga0207652_10115116
559 Ga0207646_10004615
560 Ga0207646_10074561
561 Ga0207646_10444687
562 Ga0207681_10253332
563 Ga0207694_10002635
564 Ga0207694_10216355
565 Ga0207700_10022162
566 Ga0207700_10031145
567 Ga0207700_10053884
568 Ga0207700_10131544
569 Ga0207686_10162482
570 Ga0207686_10304838
571 Ga0207704_10277933
572 Ga0207665_10001611
573 Ga0207665_10017992
574 Ga0207665_10040699
575 Ga0207665_10041039
576 Ga0207665_10099717
577 Ga0207665_10132393
578 Ga0207665_10168934
579 Ga0207711_10050293
580 Ga0207711_10336517
581 Ga0207711_10484392
582 Ga0207689_10019971
583 Ga0207661_10015943
584 Ga0207661_10017880
585 Ga0207679_10285065
586 Ga0207667_10006927
587 Ga0207667_10144231
588 Ga0207651_10116458
589 Ga0207712_10087377
590 Ga0207640_10022089
591 Ga0207658_10531889
592 Ga0207677_10023222
593 Ga0207677_10026448
594 Ga0207677_10103725
595 Ga0207703_10096625
596 Ga0207703_10137443
597 Ga0207639_10085907
598 Ga0207708_10067680
599 Ga0207702_10005291
600 Ga0207702_10005881
601 Ga0207702_10036657
602 Ga0207702_10039360
603 Ga0207641_10016741
604 Ga0207641_10050836
605 Ga0207648_10147235
606 Ga0207676_10006270
607 Ga0207676_10062125
608 Ga0207676_10148826
609 Ga0207674_10002224
610 Ga0207674_10013561
611 Ga0207675_100004830
612 Ga0207675_100333704
613 Ga0209588_1005109
614 Ga0209588_1010466
615 Ga0265354_1000015
616 Ga0268266_10005497
617 Ga0268266_10071502
618 Ga0268264_10030086
619 Ga0268264_10064368
620 Ga0268264_10074903
621 Ga0265770_1006639
622 Ga0265765_1000128
623 Ga0265330_10054895
624 Ga0265316_10062979
625 Ga0307408_100017479
626 Ga0265314_10068860
627 Ga0307405_10145079
628 Ga0307413_10005464
629 Ga0307410_10024394
630 Ga0307410_10056688
631 Ga0307407_10039023
632 Ga0307412_10034819
633 Ga0307416_100286647
634 Ga0307411_10246338
635 Ga0316212_1005799
636 Ga0373934_0028146
637 Ga0373954_0085267
638 Ga0373962_0038980
639 Ga0373931_0159825
640 Ga0373927_0152909
641 Ga0373947_0043045
642 Ga0373937_0406848
643 Ga0373925_0005438
644 Ga0373925_0008674
645 Ga0373925_0014800
646 Ga0373925_0498734
647 Ga0436363_1086449
648 Ga0451576_0057406
649 Ga0451576_0577112
650 Ga0495592_0207201
651 Ga0495603_0147148
652 Ga0495629_0008109
653 Ga0495629_0035317
654 Ga0495651_0208969
655 Ga0495580_0000271
656 Ga0495580_0003970
657 Ga0495580_0012094
658 Ga0495580_0087259
659 Ga0495580_0110302
660 Ga0495580_0292793
661 Ga0495582_0006558
662 Ga0495582_0021921
663 Ga0495582_0047502
664 Ga0495639_0008948
665 Ga0495662_0027442
666 Ga0495664_0122553
667 Ga0495628_0334462
668 Ga0495666_0134997
669 Ga0495665_0054037
670 Ga0495640_0256223
671 Ga0495586_0017364
672 Ga0495587_0034762
673 Ga0495587_0073376
674 Ga0495645_0029768
675 Ga0495635_0072282
676 Ga0495647_0002970
677 Ga0495658_0025072
678 Ga0495624_0051168
679 Ga0495674_0021210
680 Ga0495674_0050969
681 Ga0495674_0386318
682 Ga0495676_0039344
683 Ga0495680_0298199
684 Ga0495675_0100544
685 Ga0496100_0226638
686 Ga0496100_0379024
687 Ga0496101_0127334
688 Ga0496101_0160686
689 Ga0496102_0015333
690 Ga0496104_0313300
691 Ga0496105_0361345
692 Ga0496112_0014270
693 Ga0496112_0031950
694 Ga0496112_0084620
695 Ga0496112_0109049
696 Ga0496114_0020137
697 Ga0496115_0005620
698 Ga0496115_0012969
699 Ga0496115_0047240
700 Ga0501031_0004244
701 Ga0501032_0001765
702 Ga0501033_0081282
703 Ga0501034_0030720
704 Ga0501034_0033943
705 Ga0501036_0004893
706 Ga0501037_0008582
707 Ga0501038_0004813
708 Ga0501039_0026542
709 Ga0501043_0017561
710 Ga0501046_0001287
711 Ga0501047_0118661
712 Ga0501048_0018783
713 Ga0501067_0014793
714 Ga0501068_0006031
715 Ga0501068_0273573
716 Ga0501069_0021684
717 Ga0501070_0012218
718 Ga0501072_0003647
719 Ga0501073_0002520
720 Ga0501074_0027652
721 Ga0501076_0189175
722 Ga0501079_0023055
723 Ga0501080_0002089
724 Ga0501081_0131969
725 Ga0501083_0003451
726 Ga0501035_0037054
727 Ga0501044_0021174
728 Ga0501045_0191953
729 nmdc:mga05p37_555348_c1
730 nmdc:mga0qj67_30139_c1
731 nmdc:mga06r32_450358_c1
732 nmdc:mga0n895_13162_c1
733 nmdc:mga0n895_136878_c1
734 nmdc:mga0n895_44989_c1
735 nmdc:mga0rr50_11440_c1
736 nmdc:mga0rr50_322678_c1
737 nmdc:mga08x19_1879_c1
738 nmdc:mga08x19_788_c1
739 nmdc:mga0a205_312562_c1
740 nmdc:mga0a205_6715_c1
741 Ga0495612_0072794
742 Ga0495619_0155437
743 Ga0495619_0401593
744 Ga0500588_0103652
745 Ga0501084_0001785
746 Ga0501084_0249368
747 Ga0501082_0028552
748 Ga0530510_0133513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

58

277

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6szg-assembly1.cif.gz_A acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 0.9592 27 243
2dtn-assembly1.cif.gz_B crystal structure of helicobacter pylori undecaprenyl pyrophosphate synthase complexed with pyrophosphate 0.9553 30 245
2d2r-assembly1.cif.gz_B crystal structure of helicobacter pylori undecaprenyl pyrophosphate synthase 0.9539 30 245
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9533 29 243
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9496 27 246
ID Description Score Start End Superfamily
2dtnB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9553 30 245 3.40.1180.10
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9519 27 244 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9501 28 246 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9417 22 252 3.40.1180.10
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9402 23 246 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A4Q5ZCW5-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.983 21 167 GO:0008834
GO:0016094
GO:0045547
AF-A0A202DGC7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9829 27 157 GO:0016094
GO:0045547
AF-A0A2V2G286-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9823 23 151 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0030145
GO:0045547
AF-A0A2D5ZVQ9-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9808 27 158 GO:0016094
GO:0045547
AF-X1FLT0-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9788 27 173 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547

Map