F426319

General Info

Members Datasets Scaffolds Average Seq Length
373 168 746 440

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100109687|Ga0075434_1001096874
Length 455
Sequence MSDALAIADRALEHVRPGDDLEAVVQREFSGLARFAASEVHQPTLIDNCTLQVSVVRGGALGTTSTNRVDDDGIAAAVARAGEAAASVSPDTEFPGFAEPVPPVDVDGYDGATAGLGAEDLAGLASAAISAASPLQAYGFATSGLCELAVASTNGVRVSQRFTDATVRVLAAGEGRSGFAEQTSWAAGEIDPGATGRDATAKAERTSGXXXIDPGVYRAVLEPYAFGELLQWFAWDAFSGLALIEERSALTGRLGSSWLDPKVTIVDDALDPRGLPKAFDFEGTPKQRVVLVEEGAARGVVWDRISAARAGDGPRSTGHALPLAERSYGPVPLALEVAPGEAESVEDLAELVGDGIYVTRFHYLGIVDPREGILTGMTKDGTFRIRGGRIADPLVNLRFTVAVPELLADVPGLARTQQLVSQSEYYDERYPQAALVPAIATAHFAVTGTGAAPGL

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20.91
Rhizosphere 78.55
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100109687 3300006871 Bacteria 2770
2 JGI24744J21845_10000876 3300002077 Bacteria 5685
3 Ga0070680_100081809 3300005336 Bacteria 2664
4 Ga0070682_100004603 3300005337 Bacteria 7672
5 Ga0070682_100017133 3300005337 Bacteria 4221
6 Ga0068868_100021737 3300005338 Bacteria 4834
7 Ga0068868_100081973 3300005338 Bacteria 2587
8 Ga0068868_100195809 3300005338 Bacteria 1682
9 Ga0068868_100211076 3300005338 Bacteria 1622
10 Ga0070660_100013584 3300005339 Bacteria 5848
11 Ga0070689_100076014 3300005340 Bacteria 2630
12 Ga0070687_100025608 3300005343 Bacteria 2832
13 Ga0070692_10032264 3300005345 Bacteria 2632
14 Ga0070671_100150232 3300005355 Bacteria 1967
15 Ga0070674_100022242 3300005356 Bacteria 4087
16 Ga0070688_100004745 3300005365 Bacteria 7104
17 Ga0070703_10021425 3300005406 Unclassified 1889
18 Ga0070709_10005534 3300005434 Bacteria 6839
19 Ga0070714_100048825 3300005435 Bacteria 3601
20 Ga0070710_10006010 3300005437 Bacteria 5798
21 Ga0070711_100013732 3300005439 Bacteria 5091
22 Ga0070711_100015309 3300005439 Bacteria 4854
23 Ga0070711_100167440 3300005439 Bacteria 1672
24 Ga0070705_100017679 3300005440 Bacteria 3725
25 Ga0070705_100031467 3300005440 Bacteria 2938
26 Ga0070705_100038712 3300005440 Bacteria 2700
27 Ga0070700_100010474 3300005441 Bacteria 5121
28 Ga0070694_100051117 3300005444 Bacteria 2788
29 Ga0070694_100155495 3300005444 Bacteria 1674
30 Ga0070708_100008753 3300005445 Bacteria 8136
31 Ga0070708_100041724 3300005445 Bacteria 4024
32 Ga0070708_100249364 3300005445 Bacteria 1668
33 Ga0070663_100082606 3300005455 Unclassified 2364
34 Ga0070678_100006210 3300005456 Bacteria 6987
35 Ga0068867_100008969 3300005459 Bacteria 7055
36 Ga0068867_100109026 3300005459 Bacteria 2124
37 Ga0070685_10009027 3300005466 Bacteria 5143
38 Ga0070707_100013167 3300005468 Bacteria 7731
39 Ga0070698_100025237 3300005471 Bacteria 6192
40 Ga0070698_100026648 3300005471 Bacteria 6014
41 Ga0070698_100063615 3300005471 Bacteria 3720
42 Ga0070698_100172872 3300005471 Bacteria 2100
43 Ga0070699_100022924 3300005518 Bacteria 5378
44 Ga0070699_100053850 3300005518 Bacteria 3482
45 Ga0070699_100091129 3300005518 Bacteria 2665
46 Ga0070684_100044785 3300005535 Bacteria 3828
47 Ga0068853_100010132 3300005539 Bacteria 7617
48 Ga0070672_100014701 3300005543 Bacteria 5553
49 Ga0070672_100169536 3300005543 Bacteria 1815
50 Ga0070695_100020921 3300005545 Bacteria 3998
51 Ga0070695_100035748 3300005545 Bacteria 3122
52 Ga0070695_100041284 3300005545 Bacteria 2923
53 Ga0070696_100047765 3300005546 Bacteria 2971
54 Ga0070696_100105346 3300005546 Unclassified 2026
55 Ga0070693_100036079 3300005547 Bacteria 2746
56 Ga0070693_100113924 3300005547 Bacteria 1668
57 Ga0070665_100024075 3300005548 Bacteria 6131
58 Ga0070704_100038399 3300005549 Bacteria 3280
59 Ga0070704_100128828 3300005549 Bacteria 1957
60 Ga0068855_100025157 3300005563 Bacteria 7127
61 Ga0068855_100040722 3300005563 Bacteria 5512
62 Ga0068856_100035135 3300005614 Bacteria 4912
63 Ga0068856_100116458 3300005614 Bacteria 2673
64 Ga0070702_100003435 3300005615 Bacteria 7085
65 Ga0068852_100026941 3300005616 Bacteria 4679
66 Ga0068866_10003321 3300005718 Bacteria 6606
67 Ga0068866_10037037 3300005718 Bacteria 2394
68 Ga0068861_100004687 3300005719 Bacteria 9190
69 Ga0068861_100013146 3300005719 Bacteria 5790
70 Ga0068862_100244209 3300005844 Unclassified 1634
71 Ga0081455_10017645 3300005937 Bacteria 6832
72 Ga0081540_1005146 3300005983 Bacteria 9794
73 Ga0081540_1030609 3300005983 Bacteria 2977
74 Ga0081540_1034154 3300005983 Bacteria 2748
75 Ga0081539_10000994 3300005985 Bacteria 52643
76 Ga0070716_100004195 3300006173 Bacteria 6855
77 Ga0070716_100058993 3300006173 Unclassified 2211
78 Ga0070712_100004148 3300006175 Bacteria 8902
79 Ga0070712_100004780 3300006175 Bacteria 8372
80 Ga0070712_100016843 3300006175 Bacteria 4726
81 Ga0070712_100018309 3300006175 Bacteria 4548
82 Ga0070712_100021819 3300006175 Bacteria 4212
83 Ga0097621_100201886 3300006237 Bacteria 1726
84 Ga0068871_100027631 3300006358 Bacteria 4439
85 Ga0075428_100106993 3300006844 Bacteria 3048
86 Ga0075431_100088737 3300006847 Bacteria 3191
87 Ga0075433_10021166 3300006852 Bacteria 5450
88 Ga0075433_10113544 3300006852 Bacteria 2403
89 Ga0075434_100116318 3300006871 Bacteria 2687
90 Ga0075434_100324517 3300006871 Bacteria 1560
91 Ga0068865_100006471 3300006881 Bacteria 7148
92 Ga0075436_100016059 3300006914 Bacteria 5126
93 Ga0075436_100016149 3300006914 Bacteria 5112
94 Ga0075436_100021691 3300006914 Bacteria 4407
95 Ga0075436_100032338 3300006914 Bacteria 3605
96 Ga0075435_100105880 3300007076 Bacteria 2335
97 Ga0111539_10058960 3300009094 Bacteria 4554
98 Ga0105245_10004539 3300009098 Bacteria 12257
99 Ga0105245_10013479 3300009098 Bacteria 7119
100 Ga0105245_10087804 3300009098 Bacteria 2855
101 Ga0105245_10148703 3300009098 Bacteria 2213
102 Ga0105245_10157317 3300009098 Bacteria 2153
103 Ga0105245_10187055 3300009098 Bacteria 1982
104 Ga0105245_10208126 3300009098 Bacteria 1881
105 Ga0114129_10041474 3300009147 Bacteria 6485
106 Ga0114129_10060594 3300009147 Bacteria 5291
107 Ga0114129_10232414 3300009147 Bacteria 2483
108 Ga0105243_10221333 3300009148 Bacteria 1673
109 Ga0105241_10030248 3300009174 Bacteria 4045
110 Ga0105241_10042324 3300009174 Bacteria 3445
111 Ga0105241_10080599 3300009174 Bacteria 2548
112 Ga0105248_10034152 3300009177 Bacteria 5686
113 Ga0105248_10286257 3300009177 Bacteria 1855
114 Ga0105249_10010495 3300009553 Bacteria 8138
115 Ga0105249_10013082 3300009553 Bacteria 7327
116 Ga0105249_10303005 3300009553 Unclassified 1603
117 Ga0105239_10013008 3300010375 Bacteria 9256
118 Ga0105239_10099754 3300010375 Bacteria 3211
119 Ga0105239_10282759 3300010375 Bacteria 1868
120 Ga0157374_10014140 3300013296 Bacteria 6977
121 Ga0157378_10008166 3300013297 Bacteria 9132
122 Ga0163162_10267747 3300013306 Unclassified 1840
123 Ga0157372_10021160 3300013307 Bacteria 7025
124 Ga0157375_10014033 3300013308 Bacteria 7145
125 Ga0157375_10021337 3300013308 Bacteria 5936
126 Ga0157380_10108047 3300014326 Bacteria 2331
127 Ga0157377_10017045 3300014745 Bacteria 3752
128 Ga0157376_10009541 3300014969 Bacteria 7056
129 Ga0157376_10018655 3300014969 Bacteria 5326
130 Ga0157376_10190803 3300014969 Bacteria 1879
131 Ga0163161_10192043 3300017792 Bacteria 1570
132 Ga0207692_10014225 3300025898 Bacteria 3472
133 Ga0207642_10025138 3300025899 Bacteria 2404
134 Ga0207699_10026002 3300025906 Bacteria 3221
135 Ga0207645_10062580 3300025907 Bacteria 2377
136 Ga0207684_10059481 3300025910 Bacteria 3245
137 Ga0207684_10064983 3300025910 Bacteria 3098
138 Ga0207684_10158536 3300025910 Bacteria 1948
139 Ga0207654_10045287 3300025911 Bacteria 2503
140 Ga0207693_10002227 3300025915 Bacteria 16886
141 Ga0207693_10005610 3300025915 Bacteria 10434
142 Ga0207693_10058491 3300025915 Bacteria 3020
143 Ga0207693_10086439 3300025915 Bacteria 2457
144 Ga0207663_10019776 3300025916 Bacteria 3801
145 Ga0207663_10022640 3300025916 Bacteria 3595
146 Ga0207663_10035154 3300025916 Bacteria 3003
147 Ga0207657_10012218 3300025919 Bacteria 8484
148 Ga0207657_10024093 3300025919 Bacteria 5650
149 Ga0207646_10007307 3300025922 Bacteria 11258
150 Ga0207687_10018169 3300025927 Bacteria 4638
151 Ga0207687_10020387 3300025927 Bacteria 4397
152 Ga0207687_10056438 3300025927 Bacteria 2755
153 Ga0207687_10079081 3300025927 Bacteria 2370
154 Ga0207700_10000028 3300025928 Bacteria 135555
155 Ga0207644_10096856 3300025931 Bacteria 2209
156 Ga0207706_10010088 3300025933 Bacteria 8651
157 Ga0207686_10007185 3300025934 Bacteria 5996
158 Ga0207709_10004468 3300025935 Bacteria 8078
159 Ga0207670_10006619 3300025936 Bacteria 6439
160 Ga0207669_10006051 3300025937 Bacteria 5492
161 Ga0207704_10005224 3300025938 Bacteria 5980
162 Ga0207704_10112772 3300025938 Bacteria 1842
163 Ga0207665_10001837 3300025939 Bacteria 14281
164 Ga0207665_10005910 3300025939 Bacteria 8145
165 Ga0207665_10013118 3300025939 Bacteria 5447
166 Ga0207691_10030813 3300025940 Bacteria 5010
167 Ga0207711_10036201 3300025941 Bacteria 4187
168 Ga0207711_10053053 3300025941 Bacteria 3477
169 Ga0207667_10024294 3300025949 Bacteria 6655
170 Ga0207712_10009810 3300025961 Bacteria 6068
171 Ga0207712_10055226 3300025961 Bacteria 2793
172 Ga0207712_10072569 3300025961 Bacteria 2479
173 Ga0207677_10061106 3300026023 Bacteria 2608
174 Ga0207677_10231384 3300026023 Bacteria 1489
175 Ga0207639_10008374 3300026041 Bacteria 7088
176 Ga0207678_10108439 3300026067 Unclassified 2369
177 Ga0207708_10003815 3300026075 Bacteria 11114
178 Ga0207708_10012806 3300026075 Bacteria 6255
179 Ga0207702_10155454 3300026078 Bacteria 2084
180 Ga0207648_10016830 3300026089 Bacteria 6667
181 Ga0207648_10017312 3300026089 Bacteria 6563
182 Ga0207675_100000512 3300026118 Bacteria 37635
183 Ga0207675_100017781 3300026118 Bacteria 6633
184 Ga0207675_100022778 3300026118 Bacteria 5829
185 Ga0207675_100028776 3300026118 Bacteria 5176
186 Ga0207683_10004922 3300026121 Bacteria 11491
187 Ga0207683_10008733 3300026121 Bacteria 8651
188 Ga0207683_10040744 3300026121 Bacteria 4055
189 Ga0207428_10059260 3300027907 Bacteria 3036
190 Ga0268266_10074277 3300028379 Bacteria 2952
191 Ga0307409_100056538 3300031995 Bacteria 3035
192 Ga0307416_100030895 3300032002 Bacteria 4026
193 Ga0307415_100039390 3300032126 Bacteria 3123
194 Ga0373938_0000458 3300034957 Bacteria 6640
195 Ga0373928_0001473 3300035084 Bacteria 4582
196 Ga0373944_0006071 3300035089 Bacteria 3201
197 Ga0373949_0006920 3300035090 Bacteria 2490
198 Ga0373951_0003995 3300035091 Bacteria 3539
199 Ga0373951_0020711 3300035091 Bacteria 1507
200 Ga0373960_0000202 3300035121 Bacteria 10902
201 Ga0373947_0001078 3300035725 Bacteria 16728
202 Ga0373947_0083823 3300035725 Bacteria 1977
203 Ga0395899_0007998 3300037312 Bacteria 8145
204 Ga0395899_0040515 3300037312 Bacteria 3483
205 Ga0395899_0053118 3300037312 Bacteria 3001
206 Ga0395900_0003893 3300037418 Bacteria 15947
207 Ga0395900_0007871 3300037418 Bacteria 10976
208 Ga0395900_0008744 3300037418 Bacteria 10403
209 Ga0395900_0014117 3300037418 Bacteria 8156
210 Ga0395900_0015048 3300037418 Bacteria 7886
211 Ga0395900_0016063 3300037418 Bacteria 7629
212 Ga0395900_0020357 3300037418 Bacteria 6772
213 Ga0395900_0031919 3300037418 Bacteria 5414
214 Ga0395900_0048314 3300037418 Bacteria 4383
215 Ga0395900_0048436 3300037418 Bacteria 4377
216 Ga0395900_0067952 3300037418 Bacteria 3662
217 Ga0395900_0086025 3300037418 Bacteria 3231
218 Ga0395900_0135675 3300037418 Bacteria 2521
219 Ga0395898_0003007 3300037466 Bacteria 19113
220 Ga0395898_0004196 3300037466 Bacteria 15797
221 Ga0395898_0004879 3300037466 Bacteria 14562
222 Ga0395898_0012414 3300037466 Bacteria 8807
223 Ga0395898_0017277 3300037466 Bacteria 7368
224 Ga0395898_0052842 3300037466 Bacteria 3969
225 Ga0395898_0058785 3300037466 Bacteria 3742
226 Ga0395898_0067105 3300037466 Bacteria 3474
227 Ga0395898_0068768 3300037466 Bacteria 3427
228 Ga0395898_0188604 3300037466 Unclassified 1970
229 Ga0395898_0314445 3300037466 Unclassified 1494
230 Ga0395905_0002461 3300037471 Bacteria 20514
231 Ga0395905_0014235 3300037471 Bacteria 7599
232 Ga0395905_0019388 3300037471 Bacteria 6448
233 Ga0395905_0024479 3300037471 Bacteria 5697
234 Ga0395905_0038088 3300037471 Bacteria 4511
235 Ga0395905_0041326 3300037471 Bacteria 4327
236 Ga0395905_0044888 3300037471 Bacteria 4146
237 Ga0395905_0073522 3300037471 Bacteria 3204
238 Ga0395905_0222554 3300037471 Bacteria 1766
239 Ga0395901_0005063 3300038443 Bacteria 13314
240 Ga0395901_0005189 3300038443 Bacteria 13146
241 Ga0395901_0005742 3300038443 Bacteria 12569
242 Ga0395901_0018844 3300038443 Bacteria 7054
243 Ga0395901_0020889 3300038443 Bacteria 6706
244 Ga0395901_0026934 3300038443 Bacteria 5902
245 Ga0395901_0054168 3300038443 Bacteria 4168
246 Ga0395901_0058152 3300038443 Bacteria 4022
247 Ga0395901_0110938 3300038443 Bacteria 2880
248 Ga0395901_0110984 3300038443 Bacteria 2880
249 Ga0395901_0113181 3300038443 Bacteria 2850
250 Ga0451791_1380598 3300041451 Bacteria 1906
251 Ga0451793_0344593 3300041452 Bacteria 4010
252 Ga0451835_0194716 3300041492 Bacteria 1941
253 Ga0451853_3933690 3300041512 Bacteria 2857
254 Ga0439448_0007569 3300042005 Bacteria 3152
255 Ga0451576_0189801 3300045051 Bacteria 2146
256 Ga0466967_0169097 3300045976 Bacteria 2056
257 Ga0495603_0000530 3300046455 Bacteria 21149
258 Ga0495641_0000685 3300046461 Bacteria 28551
259 Ga0495582_0019006 3300046473 Bacteria 3760
260 Ga0495582_0026184 3300046473 Bacteria 3197
261 Ga0495594_0001295 3300046499 Bacteria 13051
262 Ga0495607_0064837 3300046501 Bacteria 2062
263 Ga0495630_0020933 3300046517 Bacteria 4827
264 Ga0495630_0039568 3300046517 Bacteria 3525
265 Ga0495598_0014610 3300046537 Bacteria 1967
266 Ga0495656_0004956 3300046615 Bacteria 4586
267 Ga0495656_0031645 3300046615 Bacteria 2148
268 Ga0495634_0009573 3300046642 Bacteria 7141
269 Ga0495661_0066600 3300046665 Bacteria 2119
270 Ga0495588_0001186 3300046674 Bacteria 11233
271 Ga0495588_0035368 3300046674 Bacteria 2531
272 Ga0495613_0049687 3300046689 Bacteria 3094
273 Ga0495581_0001507 3300047315 Bacteria 12964
274 Ga0495581_0025742 3300047315 Bacteria 3412
275 Ga0495676_0000754 3300047321 Bacteria 26958
276 Ga0495677_0014027 3300047445 Bacteria 2918
277 Ga0495614_0091966 3300048089 Bacteria 1320
278 Ga0496100_0008683 3300048903 Bacteria 5675
279 Ga0496101_0009184 3300048904 Bacteria 6489
280 Ga0496101_0010769 3300048904 Bacteria 6050
281 Ga0496101_0012307 3300048904 Bacteria 5705
282 Ga0496101_0035479 3300048904 Bacteria 3527
283 Ga0496101_0050130 3300048904 Bacteria 3004
284 Ga0496102_0005216 3300048905 Bacteria 11033
285 Ga0496102_0026753 3300048905 Bacteria 5149
286 Ga0496102_0043772 3300048905 Bacteria 4061
287 Ga0496102_0045199 3300048905 Bacteria 3997
288 Ga0496103_0005343 3300048906 Bacteria 7698
289 Ga0496103_0027469 3300048906 Bacteria 3448
290 Ga0496103_0073366 3300048906 Bacteria 2144
291 Ga0496104_0000290 3300048907 Bacteria 44239
292 Ga0496104_0035157 3300048907 Bacteria 4677
293 Ga0496104_0047602 3300048907 Bacteria 4041
294 Ga0496104_0069010 3300048907 Bacteria 3359
295 Ga0496104_0088524 3300048907 Bacteria 2958
296 Ga0496104_0106597 3300048907 Bacteria 2685
297 Ga0496105_0000515 3300048908 Bacteria 25512
298 Ga0496105_0027642 3300048908 Bacteria 4636
299 Ga0496105_0073272 3300048908 Bacteria 2829
300 Ga0496106_0008647 3300048909 Bacteria 7534
301 Ga0496107_0003538 3300048910 Bacteria 10461
302 Ga0496107_0023315 3300048910 Bacteria 4376
303 Ga0496107_0056483 3300048910 Bacteria 2836
304 Ga0496108_0002973 3300048911 Bacteria 13623
305 Ga0496108_0014224 3300048911 Bacteria 6493
306 Ga0496108_0015562 3300048911 Bacteria 6203
307 Ga0496108_0054661 3300048911 Bacteria 3350
308 Ga0496108_0055361 3300048911 Bacteria 3330
309 Ga0496108_0268705 3300048911 Unclassified 1484
310 Ga0496109_0001773 3300048912 Bacteria 17931
311 Ga0496109_0005665 3300048912 Bacteria 10451
312 Ga0496109_0028277 3300048912 Bacteria 5012
313 Ga0496109_0058803 3300048912 Unclassified 3512
314 Ga0496109_0121702 3300048912 Bacteria 2431
315 Ga0496109_0173299 3300048912 Bacteria 2024
316 Ga0496109_0205912 3300048912 Unclassified 1850
317 Ga0496110_0000127 3300048913 Bacteria 43261
318 Ga0496110_0019976 3300048913 Bacteria 5647
319 Ga0496110_0029062 3300048913 Bacteria 4753
320 Ga0496110_0036538 3300048913 Bacteria 4266
321 Ga0496110_0061834 3300048913 Bacteria 3306
322 Ga0496110_0072263 3300048913 Bacteria 3060
323 Ga0496110_0111142 3300048913 Bacteria 2463
324 Ga0496111_0000056 3300048914 Bacteria 45048
325 Ga0496111_0007222 3300048914 Bacteria 7264
326 Ga0496111_0012196 3300048914 Bacteria 5812
327 Ga0496111_0015352 3300048914 Bacteria 5254
328 Ga0496111_0021783 3300048914 Bacteria 4477
329 Ga0496111_0026400 3300048914 Bacteria 4101
330 Ga0496111_0042408 3300048914 Bacteria 3267
331 Ga0496111_0062977 3300048914 Bacteria 2690
332 Ga0496112_0022575 3300048915 Bacteria 5997
333 Ga0496112_0022664 3300048915 Bacteria 5988
334 Ga0496112_0024070 3300048915 Bacteria 5828
335 Ga0496112_0033194 3300048915 Bacteria 5015
336 Ga0496112_0052020 3300048915 Bacteria 4019
337 Ga0496112_0059483 3300048915 Unclassified 3765
338 Ga0496112_0200052 3300048915 Bacteria 1957
339 Ga0496113_0000066 3300048916 Bacteria 45324
340 Ga0496113_0008233 3300048916 Bacteria 6777
341 Ga0496113_0015321 3300048916 Bacteria 5265
342 Ga0496113_0035836 3300048916 Bacteria 3631
343 Ga0496113_0063648 3300048916 Bacteria 2788
344 Ga0496113_0069780 3300048916 Bacteria 2669
345 Ga0496113_0072334 3300048916 Bacteria 2624
346 Ga0496113_0324818 3300048916 Bacteria 1234
347 Ga0496114_0008967 3300048917 Bacteria 7931
348 Ga0496114_0011565 3300048917 Bacteria 7053
349 Ga0496114_0027313 3300048917 Bacteria 4674
350 Ga0496114_0033766 3300048917 Bacteria 4217
351 Ga0496114_0080079 3300048917 Bacteria 2758
352 Ga0496115_0017822 3300048918 Bacteria 5437
353 Ga0496115_0021285 3300048918 Bacteria 5008
354 nmdc:mga05p37_244020_c1 3300050507 Bacteria 2158
355 nmdc:mga05p37_257204_c1 3300050507 Bacteria 2092
356 nmdc:mga05p37_294121_c1 3300050507 Bacteria 1932
357 nmdc:mga05p37_306049_c1 3300050507 Bacteria 1886
358 nmdc:mga05p37_68545_c1 3300050507 Bacteria 4362
359 nmdc:mga06r32_163224_c1 3300050510 Bacteria 2210
360 nmdc:mga06r32_31205_c1 3300050510 Bacteria 5003
361 nmdc:mga0n895_249945_c1 3300050512 Bacteria 1800
362 nmdc:mga0n895_26443_c1 3300050512 Bacteria 5497
363 nmdc:mga0n895_61487_c1 3300050512 Bacteria 3708
364 nmdc:mga0rr50_120246_c1 3300050513 Bacteria 2090
365 nmdc:mga0rr50_135001_c1 3300050513 Bacteria 1980
366 nmdc:mga0rr50_146660_c1 3300050513 Bacteria 1903
367 nmdc:mga0rr50_17186_c1 3300050513 Bacteria 4823
368 nmdc:mga08x19_18343_c1 3300050514 Bacteria 4289
369 nmdc:mga08x19_34292_c1 3300050514 Bacteria 3207
370 nmdc:mga0a205_170926_c1 3300050515 Unclassified 2069
371 nmdc:mga0a205_29562_c1 3300050515 Bacteria 5245
372 nmdc:mga0a205_51031_c1 3300050515 Bacteria 3993
373 Ga0530510_0101122 3300061734 Bacteria 2108
374 Ga0075434_100109687
375 JGI24744J21845_10000876
376 Ga0070680_100081809
377 Ga0070682_100004603
378 Ga0070682_100017133
379 Ga0068868_100021737
380 Ga0068868_100081973
381 Ga0068868_100195809
382 Ga0068868_100211076
383 Ga0070660_100013584
384 Ga0070689_100076014
385 Ga0070687_100025608
386 Ga0070692_10032264
387 Ga0070671_100150232
388 Ga0070674_100022242
389 Ga0070688_100004745
390 Ga0070703_10021425
391 Ga0070709_10005534
392 Ga0070714_100048825
393 Ga0070710_10006010
394 Ga0070711_100013732
395 Ga0070711_100015309
396 Ga0070711_100167440
397 Ga0070705_100017679
398 Ga0070705_100031467
399 Ga0070705_100038712
400 Ga0070700_100010474
401 Ga0070694_100051117
402 Ga0070694_100155495
403 Ga0070708_100008753
404 Ga0070708_100041724
405 Ga0070708_100249364
406 Ga0070663_100082606
407 Ga0070678_100006210
408 Ga0068867_100008969
409 Ga0068867_100109026
410 Ga0070685_10009027
411 Ga0070707_100013167
412 Ga0070698_100025237
413 Ga0070698_100026648
414 Ga0070698_100063615
415 Ga0070698_100172872
416 Ga0070699_100022924
417 Ga0070699_100053850
418 Ga0070699_100091129
419 Ga0070684_100044785
420 Ga0068853_100010132
421 Ga0070672_100014701
422 Ga0070672_100169536
423 Ga0070695_100020921
424 Ga0070695_100035748
425 Ga0070695_100041284
426 Ga0070696_100047765
427 Ga0070696_100105346
428 Ga0070693_100036079
429 Ga0070693_100113924
430 Ga0070665_100024075
431 Ga0070704_100038399
432 Ga0070704_100128828
433 Ga0068855_100025157
434 Ga0068855_100040722
435 Ga0068856_100035135
436 Ga0068856_100116458
437 Ga0070702_100003435
438 Ga0068852_100026941
439 Ga0068866_10003321
440 Ga0068866_10037037
441 Ga0068861_100004687
442 Ga0068861_100013146
443 Ga0068862_100244209
444 Ga0081455_10017645
445 Ga0081540_1005146
446 Ga0081540_1030609
447 Ga0081540_1034154
448 Ga0081539_10000994
449 Ga0070716_100004195
450 Ga0070716_100058993
451 Ga0070712_100004148
452 Ga0070712_100004780
453 Ga0070712_100016843
454 Ga0070712_100018309
455 Ga0070712_100021819
456 Ga0097621_100201886
457 Ga0068871_100027631
458 Ga0075428_100106993
459 Ga0075431_100088737
460 Ga0075433_10021166
461 Ga0075433_10113544
462 Ga0075434_100116318
463 Ga0075434_100324517
464 Ga0068865_100006471
465 Ga0075436_100016059
466 Ga0075436_100016149
467 Ga0075436_100021691
468 Ga0075436_100032338
469 Ga0075435_100105880
470 Ga0111539_10058960
471 Ga0105245_10004539
472 Ga0105245_10013479
473 Ga0105245_10087804
474 Ga0105245_10148703
475 Ga0105245_10157317
476 Ga0105245_10187055
477 Ga0105245_10208126
478 Ga0114129_10041474
479 Ga0114129_10060594
480 Ga0114129_10232414
481 Ga0105243_10221333
482 Ga0105241_10030248
483 Ga0105241_10042324
484 Ga0105241_10080599
485 Ga0105248_10034152
486 Ga0105248_10286257
487 Ga0105249_10010495
488 Ga0105249_10013082
489 Ga0105249_10303005
490 Ga0105239_10013008
491 Ga0105239_10099754
492 Ga0105239_10282759
493 Ga0157374_10014140
494 Ga0157378_10008166
495 Ga0163162_10267747
496 Ga0157372_10021160
497 Ga0157375_10014033
498 Ga0157375_10021337
499 Ga0157380_10108047
500 Ga0157377_10017045
501 Ga0157376_10009541
502 Ga0157376_10018655
503 Ga0157376_10190803
504 Ga0163161_10192043
505 Ga0207692_10014225
506 Ga0207642_10025138
507 Ga0207699_10026002
508 Ga0207645_10062580
509 Ga0207684_10059481
510 Ga0207684_10064983
511 Ga0207684_10158536
512 Ga0207654_10045287
513 Ga0207693_10002227
514 Ga0207693_10005610
515 Ga0207693_10058491
516 Ga0207693_10086439
517 Ga0207663_10019776
518 Ga0207663_10022640
519 Ga0207663_10035154
520 Ga0207657_10012218
521 Ga0207657_10024093
522 Ga0207646_10007307
523 Ga0207687_10018169
524 Ga0207687_10020387
525 Ga0207687_10056438
526 Ga0207687_10079081
527 Ga0207700_10000028
528 Ga0207644_10096856
529 Ga0207706_10010088
530 Ga0207686_10007185
531 Ga0207709_10004468
532 Ga0207670_10006619
533 Ga0207669_10006051
534 Ga0207704_10005224
535 Ga0207704_10112772
536 Ga0207665_10001837
537 Ga0207665_10005910
538 Ga0207665_10013118
539 Ga0207691_10030813
540 Ga0207711_10036201
541 Ga0207711_10053053
542 Ga0207667_10024294
543 Ga0207712_10009810
544 Ga0207712_10055226
545 Ga0207712_10072569
546 Ga0207677_10061106
547 Ga0207677_10231384
548 Ga0207639_10008374
549 Ga0207678_10108439
550 Ga0207708_10003815
551 Ga0207708_10012806
552 Ga0207702_10155454
553 Ga0207648_10016830
554 Ga0207648_10017312
555 Ga0207675_100000512
556 Ga0207675_100017781
557 Ga0207675_100022778
558 Ga0207675_100028776
559 Ga0207683_10004922
560 Ga0207683_10008733
561 Ga0207683_10040744
562 Ga0207428_10059260
563 Ga0268266_10074277
564 Ga0307409_100056538
565 Ga0307416_100030895
566 Ga0307415_100039390
567 Ga0373938_0000458
568 Ga0373928_0001473
569 Ga0373944_0006071
570 Ga0373949_0006920
571 Ga0373951_0003995
572 Ga0373951_0020711
573 Ga0373960_0000202
574 Ga0373947_0001078
575 Ga0373947_0083823
576 Ga0395899_0007998
577 Ga0395899_0040515
578 Ga0395899_0053118
579 Ga0395900_0003893
580 Ga0395900_0007871
581 Ga0395900_0008744
582 Ga0395900_0014117
583 Ga0395900_0015048
584 Ga0395900_0016063
585 Ga0395900_0020357
586 Ga0395900_0031919
587 Ga0395900_0048314
588 Ga0395900_0048436
589 Ga0395900_0067952
590 Ga0395900_0086025
591 Ga0395900_0135675
592 Ga0395898_0003007
593 Ga0395898_0004196
594 Ga0395898_0004879
595 Ga0395898_0012414
596 Ga0395898_0017277
597 Ga0395898_0052842
598 Ga0395898_0058785
599 Ga0395898_0067105
600 Ga0395898_0068768
601 Ga0395898_0188604
602 Ga0395898_0314445
603 Ga0395905_0002461
604 Ga0395905_0014235
605 Ga0395905_0019388
606 Ga0395905_0024479
607 Ga0395905_0038088
608 Ga0395905_0041326
609 Ga0395905_0044888
610 Ga0395905_0073522
611 Ga0395905_0222554
612 Ga0395901_0005063
613 Ga0395901_0005189
614 Ga0395901_0005742
615 Ga0395901_0018844
616 Ga0395901_0020889
617 Ga0395901_0026934
618 Ga0395901_0054168
619 Ga0395901_0058152
620 Ga0395901_0110938
621 Ga0395901_0110984
622 Ga0395901_0113181
623 Ga0451791_1380598
624 Ga0451793_0344593
625 Ga0451835_0194716
626 Ga0451853_3933690
627 Ga0439448_0007569
628 Ga0451576_0189801
629 Ga0466967_0169097
630 Ga0495603_0000530
631 Ga0495641_0000685
632 Ga0495582_0019006
633 Ga0495582_0026184
634 Ga0495594_0001295
635 Ga0495607_0064837
636 Ga0495630_0020933
637 Ga0495630_0039568
638 Ga0495598_0014610
639 Ga0495656_0004956
640 Ga0495656_0031645
641 Ga0495634_0009573
642 Ga0495661_0066600
643 Ga0495588_0001186
644 Ga0495588_0035368
645 Ga0495613_0049687
646 Ga0495581_0001507
647 Ga0495581_0025742
648 Ga0495676_0000754
649 Ga0495677_0014027
650 Ga0495614_0091966
651 Ga0496100_0008683
652 Ga0496101_0009184
653 Ga0496101_0010769
654 Ga0496101_0012307
655 Ga0496101_0035479
656 Ga0496101_0050130
657 Ga0496102_0005216
658 Ga0496102_0026753
659 Ga0496102_0043772
660 Ga0496102_0045199
661 Ga0496103_0005343
662 Ga0496103_0027469
663 Ga0496103_0073366
664 Ga0496104_0000290
665 Ga0496104_0035157
666 Ga0496104_0047602
667 Ga0496104_0069010
668 Ga0496104_0088524
669 Ga0496104_0106597
670 Ga0496105_0000515
671 Ga0496105_0027642
672 Ga0496105_0073272
673 Ga0496106_0008647
674 Ga0496107_0003538
675 Ga0496107_0023315
676 Ga0496107_0056483
677 Ga0496108_0002973
678 Ga0496108_0014224
679 Ga0496108_0015562
680 Ga0496108_0054661
681 Ga0496108_0055361
682 Ga0496108_0268705
683 Ga0496109_0001773
684 Ga0496109_0005665
685 Ga0496109_0028277
686 Ga0496109_0058803
687 Ga0496109_0121702
688 Ga0496109_0173299
689 Ga0496109_0205912
690 Ga0496110_0000127
691 Ga0496110_0019976
692 Ga0496110_0029062
693 Ga0496110_0036538
694 Ga0496110_0061834
695 Ga0496110_0072263
696 Ga0496110_0111142
697 Ga0496111_0000056
698 Ga0496111_0007222
699 Ga0496111_0012196
700 Ga0496111_0015352
701 Ga0496111_0021783
702 Ga0496111_0026400
703 Ga0496111_0042408
704 Ga0496111_0062977
705 Ga0496112_0022575
706 Ga0496112_0022664
707 Ga0496112_0024070
708 Ga0496112_0033194
709 Ga0496112_0052020
710 Ga0496112_0059483
711 Ga0496112_0200052
712 Ga0496113_0000066
713 Ga0496113_0008233
714 Ga0496113_0015321
715 Ga0496113_0035836
716 Ga0496113_0063648
717 Ga0496113_0069780
718 Ga0496113_0072334
719 Ga0496113_0324818
720 Ga0496114_0008967
721 Ga0496114_0011565
722 Ga0496114_0027313
723 Ga0496114_0033766
724 Ga0496114_0080079
725 Ga0496115_0017822
726 Ga0496115_0021285
727 nmdc:mga05p37_244020_c1
728 nmdc:mga05p37_257204_c1
729 nmdc:mga05p37_294121_c1
730 nmdc:mga05p37_306049_c1
731 nmdc:mga05p37_68545_c1
732 nmdc:mga06r32_163224_c1
733 nmdc:mga06r32_31205_c1
734 nmdc:mga0n895_249945_c1
735 nmdc:mga0n895_26443_c1
736 nmdc:mga0n895_61487_c1
737 nmdc:mga0rr50_120246_c1
738 nmdc:mga0rr50_135001_c1
739 nmdc:mga0rr50_146660_c1
740 nmdc:mga0rr50_17186_c1
741 nmdc:mga08x19_18343_c1
742 nmdc:mga08x19_34292_c1
743 nmdc:mga0a205_170926_c1
744 nmdc:mga0a205_29562_c1
745 nmdc:mga0a205_51031_c1
746 Ga0530510_0101122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01523

PmbA_TldD_1st

PmbA/TldA metallopeptidase domain 1

21

85

0.96

PF19289

PmbA_TldD_3rd

PmbA/TldA metallopeptidase C-terminal domain

214

448

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl4-assembly1.cif.gz_B crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution 0.8796 17 444
6j6a-assembly1.cif.gz_B crystal structure of tlde from thermococcus kodakarensis 0.8732 5 445
3tv9-assembly1.cif.gz_A-2 crystal structure of putative peptide maturation protein from shigella flexneri 0.8674 5 440
6j6a-assembly1.cif.gz_B crystal structure of tlde from thermococcus kodakarensis 0.8638 5 445
3qtd-assembly2.cif.gz_B crystal structure of putative modulator of gyrase (pmba) from pseudomonas aeruginosa pao1 0.8634 5 445
ID Description Score Start End Superfamily
af_Q57684_3_193_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8805 17 198 3.30.2290.10
3tv9A01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8694 4 201 3.30.2290.10
af_P71898_23_321_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8352 18 296 3.30.2290.10
1vpbA01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8297 3 205 3.30.2290.10
1vl4B01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8282 17 200 3.30.2290.10
ID Description Score Start End GO Terms
AF-A0A177R8K3-F1-model_v4 deleted 0.998 1 452
AF-A0A536MK72-F1-model_v4 Metalloprotease TldD/E C-terminal domain-containing protein 0.9766 170 444 GO:0006508
GO:0008237
AF-A0A538G068-F1-model_v4 TldD/PmbA family protein 0.9701 3 268 GO:0006508
GO:0008237
AF-X1BJS6-F1-model_v4 Metalloprotease TldD/E C-terminal domain-containing protein 0.97 134 399 GO:0006508
GO:0008237
AF-A0A6L7TNR4-F1-model_v4 TldD/PmbA family protein 0.9696 3 447 GO:0006508
GO:0008237

Map