F426041

General Info

Members Datasets Scaffolds Average Seq Length
372 139 744 442

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10018337|Ga0105248_100183377
Length 469
Sequence MAADPLLDAWRADMIRRLIPLGVLIPLAACGSTQKIDVAQQFGANPVLPEPSEELVAAVGVPKVVGWERGAMPSVPAGFKIEPFATGLTNPRNVYPLANGDILVVESRRVGSEPVQRPKDPIRKFIMSLAHGRGTGSSGGPPQRITLLRDADGDGKAELKSVLVDHLNSPFGVAVVGNDLYVANTDAIIRYPFTPGQTRISAAGQRVIYLPGGLIDHHWTKSLTVSPDGSKLYAGVGSNSNAQERGAEAETNRAAIWEVDPKTGAYRIFASGLRNPNGLTFYPGSNTLWTVVNERDELGPNLVPDYMTSVRLGGFYGWPYSYYGQHVDARVRPQRQDLVAKAITPDYALSSHVAALGLTFYTGSSFPAMFRGGAFIGEHGSWNRSELNGYRVVFIRFAGGRPVGRPYNFVTGFLDSNGKARGRPVGVAVDRTGALIVADDVGNTVWRVSYVGGTNIASSSSNQHSNRKV

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.57
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10018337 3300009177 Bacteria 7729
2 JGI24740J21852_10029081 3300001979 Bacteria 1819
3 JGI24739J22299_10000896 3300001989 Bacteria 11013
4 JGI24737J22298_10000355 3300001990 Bacteria 15479
5 JGI24738J21930_10001455 3300002075 Bacteria 6579
6 Ga0070658_10020353 3300005327 Bacteria 5317
7 Ga0070658_10059464 3300005327 Bacteria 3112
8 Ga0070658_10080669 3300005327 Bacteria 2672
9 Ga0070676_10003754 3300005328 Bacteria 7960
10 Ga0070676_10018284 3300005328 Bacteria 3882
11 Ga0070690_100002262 3300005330 Bacteria 10321
12 Ga0070690_100062546 3300005330 Bacteria 2400
13 Ga0070670_100000022 3300005331 Bacteria 199146
14 Ga0070670_100001163 3300005331 Bacteria 20894
15 Ga0070670_100001372 3300005331 Bacteria 19498
16 Ga0070670_100002964 3300005331 Bacteria 14060
17 Ga0070670_100041397 3300005331 Bacteria 3960
18 Ga0070677_10015132 3300005333 Bacteria 2729
19 Ga0068869_100000230 3300005334 Bacteria 29349
20 Ga0068869_100018746 3300005334 Bacteria 4717
21 Ga0070666_10000415 3300005335 Bacteria 26514
22 Ga0070666_10012697 3300005335 Bacteria 5324
23 Ga0068868_100000422 3300005338 Bacteria 28550
24 Ga0068868_100027636 3300005338 Bacteria 4328
25 Ga0070660_100006343 3300005339 Bacteria 8192
26 Ga0070660_100007252 3300005339 Bacteria 7717
27 Ga0070660_100014106 3300005339 Bacteria 5753
28 Ga0070660_100038472 3300005339 Bacteria 3632
29 Ga0070660_100058918 3300005339 Bacteria 2977
30 Ga0070660_100091906 3300005339 Bacteria 2394
31 Ga0070661_100091454 3300005344 Bacteria 2254
32 Ga0070661_100097976 3300005344 Bacteria 2177
33 Ga0070661_100109719 3300005344 Bacteria 2059
34 Ga0070692_10060100 3300005345 Bacteria 2000
35 Ga0070668_100000675 3300005347 Bacteria 23180
36 Ga0070669_100054655 3300005353 Bacteria 2925
37 Ga0070675_100048842 3300005354 Bacteria 3471
38 Ga0070671_100000972 3300005355 Bacteria 20998
39 Ga0070671_100003799 3300005355 Bacteria 11849
40 Ga0070671_100015015 3300005355 Bacteria 6254
41 Ga0070671_100018789 3300005355 Bacteria 5618
42 Ga0070671_100019284 3300005355 Bacteria 5548
43 Ga0070671_100027852 3300005355 Bacteria 4652
44 Ga0070671_100137354 3300005355 Bacteria 2061
45 Ga0070671_100156946 3300005355 Bacteria 1922
46 Ga0070674_100001888 3300005356 Bacteria 11382
47 Ga0070674_100014787 3300005356 Bacteria 4857
48 Ga0070674_100188213 3300005356 Bacteria 1586
49 Ga0070673_100000535 3300005364 Bacteria 20475
50 Ga0070673_100001888 3300005364 Bacteria 12565
51 Ga0070673_100005711 3300005364 Bacteria 8000
52 Ga0070673_100006143 3300005364 Bacteria 7786
53 Ga0070673_100014109 3300005364 Bacteria 5552
54 Ga0070673_100053198 3300005364 Bacteria 3179
55 Ga0070659_100001166 3300005366 Bacteria 19212
56 Ga0070659_100020205 3300005366 Bacteria 5057
57 Ga0070659_100096552 3300005366 Bacteria 2374
58 Ga0070659_100103676 3300005366 Bacteria 2291
59 Ga0070667_100000839 3300005367 Bacteria 28510
60 Ga0070667_100000917 3300005367 Bacteria 27218
61 Ga0070667_100004185 3300005367 Bacteria 12182
62 Ga0070667_100008376 3300005367 Bacteria 8572
63 Ga0070667_100011274 3300005367 Bacteria 7394
64 Ga0070667_100036702 3300005367 Bacteria 4109
65 Ga0070667_100046758 3300005367 Bacteria 3641
66 Ga0070663_100031088 3300005455 Bacteria 3666
67 Ga0070678_100004841 3300005456 Bacteria 7690
68 Ga0070678_100018324 3300005456 Bacteria 4536
69 Ga0070678_100021321 3300005456 Bacteria 4270
70 Ga0070662_100000390 3300005457 Bacteria 26178
71 Ga0070662_100016686 3300005457 Bacteria 4934
72 Ga0070662_100037223 3300005457 Bacteria 3449
73 Ga0070662_100048333 3300005457 Bacteria 3064
74 Ga0068867_100001732 3300005459 Bacteria 15201
75 Ga0068867_100027190 3300005459 Bacteria 4110
76 Ga0070679_100021027 3300005530 Bacteria 6368
77 Ga0068853_100003747 3300005539 Bacteria 11661
78 Ga0068853_100038160 3300005539 Bacteria 4090
79 Ga0068853_100051491 3300005539 Bacteria 3544
80 Ga0070672_100001092 3300005543 Bacteria 16526
81 Ga0070672_100009083 3300005543 Bacteria 6836
82 Ga0070672_100011598 3300005543 Bacteria 6148
83 Ga0070686_100019774 3300005544 Bacteria 3974
84 Ga0070665_100003259 3300005548 Bacteria 17418
85 Ga0070665_100015898 3300005548 Bacteria 7553
86 Ga0070665_100042458 3300005548 Bacteria 4571
87 Ga0070665_100063316 3300005548 Bacteria 3708
88 Ga0068855_100009251 3300005563 Bacteria 11904
89 Ga0068855_100039987 3300005563 Bacteria 5566
90 Ga0070664_100007140 3300005564 Bacteria 9008
91 Ga0070664_100018895 3300005564 Bacteria 5667
92 Ga0068857_100026270 3300005577 Bacteria 5130
93 Ga0068857_100059203 3300005577 Bacteria 3402
94 Ga0068854_100001945 3300005578 Bacteria 12609
95 Ga0068854_100003625 3300005578 Bacteria 9661
96 Ga0068854_100049317 3300005578 Bacteria 3007
97 Ga0068856_100206593 3300005614 Bacteria 1978
98 Ga0068852_100001242 3300005616 Bacteria 16979
99 Ga0068852_100006131 3300005616 Bacteria 8670
100 Ga0068852_100023430 3300005616 Bacteria 4969
101 Ga0068852_100028601 3300005616 Bacteria 4566
102 Ga0068852_100054505 3300005616 Bacteria 3447
103 Ga0068852_100118361 3300005616 Bacteria 2420
104 Ga0068852_100161539 3300005616 Bacteria 2092
105 Ga0068859_100006261 3300005617 Bacteria 12072
106 Ga0068859_100009159 3300005617 Bacteria 9999
107 Ga0068859_100027442 3300005617 Bacteria 5710
108 Ga0068864_100000418 3300005618 Bacteria 36672
109 Ga0068864_100000986 3300005618 Bacteria 23851
110 Ga0068864_100002647 3300005618 Bacteria 14784
111 Ga0068864_100003357 3300005618 Bacteria 13232
112 Ga0068864_100017993 3300005618 Bacteria 5897
113 Ga0068864_100030699 3300005618 Bacteria 4556
114 Ga0068861_100012537 3300005719 Bacteria 5915
115 Ga0068863_100000266 3300005841 Bacteria 54663
116 Ga0068863_100002990 3300005841 Bacteria 16711
117 Ga0068863_100013454 3300005841 Bacteria 7891
118 Ga0068863_100014012 3300005841 Bacteria 7725
119 Ga0068863_100047857 3300005841 Bacteria 4055
120 Ga0068858_100001162 3300005842 Bacteria 27292
121 Ga0068858_100002839 3300005842 Bacteria 17420
122 Ga0068858_100038086 3300005842 Bacteria 4460
123 Ga0068860_100000136 3300005843 Bacteria 120083
124 Ga0068860_100009071 3300005843 Bacteria 9899
125 Ga0068860_100033824 3300005843 Bacteria 4904
126 Ga0068860_100095612 3300005843 Bacteria 2832
127 Ga0068860_100138773 3300005843 Bacteria 2335
128 Ga0068862_100000573 3300005844 Bacteria 38295
129 Ga0068862_100046088 3300005844 Bacteria 3721
130 Ga0097621_100019226 3300006237 Bacteria 5240
131 Ga0097621_100148772 3300006237 Bacteria 2007
132 Ga0068871_100010746 3300006358 Bacteria 6695
133 Ga0068871_100037154 3300006358 Bacteria 3883
134 Ga0068865_100037095 3300006881 Bacteria 3289
135 Ga0097620_100006262 3300006931 Bacteria 12072
136 Ga0097620_100009159 3300006931 Bacteria 9999
137 Ga0097620_100027443 3300006931 Bacteria 5710
138 Ga0105250_10008405 3300009092 Bacteria 4385
139 Ga0105240_10283243 3300009093 Bacteria 1903
140 Ga0105245_10001947 3300009098 Bacteria 18731
141 Ga0105248_10001057 3300009177 Bacteria 30519
142 Ga0105248_10005736 3300009177 Bacteria 13632
143 Ga0105248_10010048 3300009177 Bacteria 10423
144 Ga0105248_10010146 3300009177 Bacteria 10375
145 Ga0105248_10017218 3300009177 Bacteria 7962
146 Ga0105248_10033228 3300009177 Bacteria 5762
147 Ga0105248_10109998 3300009177 Bacteria 3107
148 Ga0105248_10131940 3300009177 Bacteria 2819
149 Ga0105248_10204835 3300009177 Bacteria 2223
150 Ga0105238_10203513 3300009551 Bacteria 1956
151 Ga0105249_10000376 3300009553 Bacteria 44283
152 Ga0105249_10175964 3300009553 Bacteria 2078
153 Ga0157373_10010173 3300013100 Bacteria 6930
154 Ga0157373_10021842 3300013100 Bacteria 4644
155 Ga0157373_10052366 3300013100 Bacteria 2905
156 Ga0157373_10107204 3300013100 Bacteria 1964
157 Ga0157371_10004528 3300013102 Bacteria 12107
158 Ga0157371_10120089 3300013102 Bacteria 1868
159 Ga0157370_10104764 3300013104 Bacteria 2648
160 Ga0157369_10199569 3300013105 Bacteria 2100
161 Ga0157369_10270206 3300013105 Bacteria 1772
162 Ga0157374_10011420 3300013296 Bacteria 7689
163 Ga0157378_10004520 3300013297 Bacteria 12204
164 Ga0163162_10005084 3300013306 Bacteria 12672
165 Ga0163162_10096044 3300013306 Bacteria 3052
166 Ga0163162_10223558 3300013306 Bacteria 2012
167 Ga0163162_10294691 3300013306 Bacteria 1754
168 Ga0157372_10022590 3300013307 Bacteria 6808
169 Ga0157372_10168223 3300013307 Bacteria 2535
170 Ga0157372_10246004 3300013307 Bacteria 2075
171 Ga0157375_10002274 3300013308 Bacteria 16621
172 Ga0157375_10052167 3300013308 Bacteria 4019
173 Ga0157375_10065809 3300013308 Bacteria 3614
174 Ga0157375_10168277 3300013308 Bacteria 2338
175 Ga0163163_10002274 3300014325 Bacteria 16195
176 Ga0163163_10015289 3300014325 Bacteria 7092
177 Ga0157379_10005800 3300014968 Bacteria 10625
178 Ga0157379_10007471 3300014968 Bacteria 9464
179 Ga0163161_10020636 3300017792 Bacteria 4626
180 Ga0206353_10668187 3300020082 Bacteria 2263
181 Ga0213876_10022162 3300021384 Bacteria 3359
182 Ga0207697_10000082 3300025315 Bacteria 41919
183 Ga0207688_10011404 3300025901 Bacteria 4839
184 Ga0207688_10042856 3300025901 Bacteria 2520
185 Ga0207680_10001418 3300025903 Bacteria 11355
186 Ga0207680_10002741 3300025903 Bacteria 8243
187 Ga0207647_10000259 3300025904 Bacteria 43433
188 Ga0207647_10006343 3300025904 Bacteria 8599
189 Ga0207647_10019662 3300025904 Bacteria 4539
190 Ga0207645_10004794 3300025907 Bacteria 9945
191 Ga0207645_10024936 3300025907 Bacteria 3874
192 Ga0207645_10028156 3300025907 Bacteria 3628
193 Ga0207645_10053670 3300025907 Bacteria 2576
194 Ga0207645_10062231 3300025907 Bacteria 2384
195 Ga0207705_10001757 3300025909 Bacteria 17137
196 Ga0207705_10003507 3300025909 Bacteria 11945
197 Ga0207705_10008679 3300025909 Bacteria 7404
198 Ga0207705_10026423 3300025909 Bacteria 4139
199 Ga0207705_10036201 3300025909 Bacteria 3532
200 Ga0207660_10048175 3300025917 Bacteria 3016
201 Ga0207657_10004090 3300025919 Bacteria 15484
202 Ga0207657_10005407 3300025919 Bacteria 13349
203 Ga0207657_10007346 3300025919 Bacteria 11302
204 Ga0207657_10019800 3300025919 Bacteria 6379
205 Ga0207657_10022895 3300025919 Bacteria 5830
206 Ga0207657_10031038 3300025919 Bacteria 4845
207 Ga0207657_10037851 3300025919 Bacteria 4303
208 Ga0207657_10059641 3300025919 Bacteria 3277
209 Ga0207657_10061810 3300025919 Bacteria 3209
210 Ga0207657_10094256 3300025919 Bacteria 2493
211 Ga0207657_10154528 3300025919 Bacteria 1867
212 Ga0207681_10002599 3300025923 Bacteria 11437
213 Ga0207681_10006254 3300025923 Bacteria 7305
214 Ga0207681_10052884 3300025923 Bacteria 2755
215 Ga0207694_10081105 3300025924 Bacteria 2547
216 Ga0207694_10175016 3300025924 Bacteria 1739
217 Ga0207650_10000016 3300025925 Bacteria 361958
218 Ga0207650_10006173 3300025925 Bacteria 8167
219 Ga0207650_10007458 3300025925 Bacteria 7455
220 Ga0207650_10082578 3300025925 Bacteria 2439
221 Ga0207650_10096817 3300025925 Bacteria 2264
222 Ga0207659_10005604 3300025926 Bacteria 7626
223 Ga0207659_10030507 3300025926 Bacteria 3685
224 Ga0207687_10004833 3300025927 Bacteria 8958
225 Ga0207644_10000151 3300025931 Bacteria 49728
226 Ga0207644_10000649 3300025931 Bacteria 21990
227 Ga0207644_10012313 3300025931 Bacteria 5679
228 Ga0207644_10021843 3300025931 Bacteria 4364
229 Ga0207690_10005828 3300025932 Bacteria 7288
230 Ga0207690_10033519 3300025932 Bacteria 3302
231 Ga0207690_10102649 3300025932 Bacteria 2045
232 Ga0207690_10138817 3300025932 Bacteria 1788
233 Ga0207706_10000891 3300025933 Bacteria 30650
234 Ga0207706_10001125 3300025933 Bacteria 27208
235 Ga0207706_10001144 3300025933 Bacteria 27026
236 Ga0207706_10004393 3300025933 Bacteria 13254
237 Ga0207706_10005360 3300025933 Bacteria 11954
238 Ga0207706_10011706 3300025933 Bacteria 7998
239 Ga0207706_10017447 3300025933 Bacteria 6467
240 Ga0207706_10017672 3300025933 Bacteria 6426
241 Ga0207706_10073417 3300025933 Bacteria 3008
242 Ga0207669_10187120 3300025937 Bacteria 1490
243 Ga0207691_10001996 3300025940 Bacteria 19962
244 Ga0207691_10002508 3300025940 Bacteria 17963
245 Ga0207691_10012675 3300025940 Bacteria 8075
246 Ga0207691_10096159 3300025940 Bacteria 2648
247 Ga0207691_10120489 3300025940 Bacteria 2326
248 Ga0207711_10000372 3300025941 Bacteria 47656
249 Ga0207711_10003496 3300025941 Bacteria 13599
250 Ga0207711_10014963 3300025941 Bacteria 6445
251 Ga0207711_10022438 3300025941 Bacteria 5278
252 Ga0207711_10028773 3300025941 Bacteria 4680
253 Ga0207711_10052094 3300025941 Bacteria 3507
254 Ga0207689_10000561 3300025942 Bacteria 35545
255 Ga0207689_10027493 3300025942 Bacteria 4760
256 Ga0207679_10008083 3300025945 Bacteria 6690
257 Ga0207679_10012009 3300025945 Bacteria 5630
258 Ga0207679_10070224 3300025945 Bacteria 2639
259 Ga0207667_10031787 3300025949 Bacteria 5695
260 Ga0207667_10073402 3300025949 Bacteria 3555
261 Ga0207667_10219270 3300025949 Bacteria 1949
262 Ga0207651_10001237 3300025960 Bacteria 11474
263 Ga0207651_10003650 3300025960 Bacteria 7592
264 Ga0207651_10004058 3300025960 Bacteria 7294
265 Ga0207651_10004376 3300025960 Bacteria 7107
266 Ga0207651_10008958 3300025960 Bacteria 5437
267 Ga0207651_10010948 3300025960 Bacteria 5052
268 Ga0207651_10039064 3300025960 Bacteria 3126
269 Ga0207712_10000794 3300025961 Bacteria 23385
270 Ga0207668_10000173 3300025972 Bacteria 44042
271 Ga0207668_10001942 3300025972 Bacteria 12115
272 Ga0207640_10001178 3300025981 Bacteria 14315
273 Ga0207640_10001487 3300025981 Bacteria 12633
274 Ga0207640_10001775 3300025981 Bacteria 11592
275 Ga0207658_10002457 3300025986 Bacteria 13540
276 Ga0207658_10004516 3300025986 Bacteria 9669
277 Ga0207658_10004820 3300025986 Bacteria 9331
278 Ga0207658_10004991 3300025986 Bacteria 9144
279 Ga0207658_10014066 3300025986 Bacteria 5478
280 Ga0207658_10028679 3300025986 Bacteria 3922
281 Ga0207658_10032516 3300025986 Bacteria 3713
282 Ga0207658_10072296 3300025986 Bacteria 2614
283 Ga0207658_10079060 3300025986 Bacteria 2515
284 Ga0207677_10001036 3300026023 Bacteria 15297
285 Ga0207677_10014000 3300026023 Bacteria 4668
286 Ga0207703_10002334 3300026035 Bacteria 16550
287 Ga0207703_10008141 3300026035 Bacteria 8287
288 Ga0207703_10013406 3300026035 Bacteria 6388
289 Ga0207639_10012525 3300026041 Bacteria 5909
290 Ga0207678_10000918 3300026067 Bacteria 26949
291 Ga0207678_10011162 3300026067 Bacteria 7890
292 Ga0207678_10054513 3300026067 Bacteria 3444
293 Ga0207702_10047447 3300026078 Bacteria 3620
294 Ga0207641_10000761 3300026088 Bacteria 34699
295 Ga0207641_10000996 3300026088 Bacteria 28985
296 Ga0207641_10004390 3300026088 Bacteria 12225
297 Ga0207641_10229958 3300026088 Bacteria 1723
298 Ga0207648_10003598 3300026089 Bacteria 16209
299 Ga0207648_10007119 3300026089 Bacteria 11033
300 Ga0207648_10011142 3300026089 Bacteria 8483
301 Ga0207676_10000055 3300026095 Bacteria 124678
302 Ga0207676_10001742 3300026095 Bacteria 15995
303 Ga0207676_10005530 3300026095 Bacteria 8944
304 Ga0207676_10006692 3300026095 Bacteria 8152
305 Ga0207676_10009721 3300026095 Bacteria 6838
306 Ga0207674_10002685 3300026116 Bacteria 22206
307 Ga0207674_10016383 3300026116 Bacteria 8115
308 Ga0207674_10097455 3300026116 Bacteria 2924
309 Ga0207675_100021805 3300026118 Bacteria 5963
310 Ga0207683_10004842 3300026121 Bacteria 11592
311 Ga0207683_10011713 3300026121 Bacteria 7486
312 Ga0207683_10041560 3300026121 Bacteria 4015
313 Ga0207698_10010672 3300026142 Bacteria 5922
314 Ga0207698_10021990 3300026142 Bacteria 4422
315 Ga0207698_10143484 3300026142 Bacteria 2061
316 Ga0207698_10155157 3300026142 Bacteria 1993
317 Ga0268266_10005833 3300028379 Bacteria 11394
318 Ga0268266_10018295 3300028379 Bacteria 5975
319 Ga0268266_10026817 3300028379 Bacteria 4902
320 Ga0268265_10008593 3300028380 Bacteria 6903
321 Ga0268265_10052940 3300028380 Bacteria 3073
322 Ga0268264_10000265 3300028381 Bacteria 92655
323 Ga0268264_10005231 3300028381 Bacteria 10985
324 Ga0268264_10009772 3300028381 Bacteria 7941
325 Ga0268264_10022540 3300028381 Bacteria 5140
326 Ga0268264_10078910 3300028381 Bacteria 2808
327 Ga0307410_10254489 3300031852 Bacteria 1367
328 Ga0307409_100159000 3300031995 Bacteria 1973
329 Ga0307415_100076648 3300032126 Bacteria 2371
330 Ga0373960_0037540 3300035121 Bacteria 1385
331 Ga0395899_0065709 3300037312 Bacteria 2665
332 Ga0395899_0068018 3300037312 Bacteria 2612
333 Ga0395900_0001134 3300037418 Bacteria 33662
334 Ga0395900_0018427 3300037418 Bacteria 7120
335 Ga0395898_0120000 3300037466 Bacteria 2519
336 Ga0395898_0334782 3300037466 Bacteria 1443
337 Ga0395905_0002566 3300037471 Bacteria 20009
338 Ga0395905_0016348 3300037471 Bacteria 7050
339 Ga0395905_0019729 3300037471 Bacteria 6391
340 Ga0395905_0085252 3300037471 Bacteria 2960
341 Ga0395905_0093328 3300037471 Bacteria 2823
342 Ga0395905_0217165 3300037471 Bacteria 1790
343 Ga0395905_0233107 3300037471 Bacteria 1721
344 Ga0395901_0043855 3300038443 Bacteria 4639
345 Ga0436365_0451685 3300039437 Bacteria 11482
346 Ga0466967_0079811 3300045976 Bacteria 2951
347 Ga0495663_0001960 3300046525 Bacteria 6333
348 Ga0495621_0000837 3300046539 Bacteria 7820
349 Ga0495668_0005247 3300046616 Bacteria 8876
350 Ga0495661_0045250 3300046665 Bacteria 2693
351 Ga0495669_0002001 3300046684 Bacteria 8363
352 Ga0495669_0007274 3300046684 Bacteria 4636
353 Ga0495677_0001724 3300047445 Bacteria 8775
354 Ga0496101_0048875 3300048904 Bacteria 3041
355 Ga0496105_0057461 3300048908 Bacteria 3213
356 Ga0496106_0106543 3300048909 Bacteria 2179
357 Ga0496108_0002625 3300048911 Bacteria 14400
358 Ga0496108_0022850 3300048911 Bacteria 5146
359 Ga0496109_0011318 3300048912 Bacteria 7663
360 Ga0496109_0025930 3300048912 Bacteria 5223
361 Ga0496109_0181985 3300048912 Bacteria 1974
362 Ga0496110_0015874 3300048913 Bacteria 6279
363 Ga0496110_0072013 3300048913 Bacteria 3066
364 Ga0496110_0081617 3300048913 Bacteria 2883
365 Ga0496111_0016091 3300048914 Bacteria 5150
366 Ga0496112_0007854 3300048915 Bacteria 9499
367 Ga0496112_0023048 3300048915 Bacteria 5941
368 Ga0496112_0038537 3300048915 Bacteria 4667
369 Ga0496113_0005302 3300048916 Bacteria 8027
370 Ga0496113_0051595 3300048916 Bacteria 3070
371 Ga0501068_0091342 3300049584 Bacteria 1879
372 Ga0500658_0000037 3300053134 Bacteria 84326
373 Ga0105248_10018337
374 JGI24740J21852_10029081
375 JGI24739J22299_10000896
376 JGI24737J22298_10000355
377 JGI24738J21930_10001455
378 Ga0070658_10020353
379 Ga0070658_10059464
380 Ga0070658_10080669
381 Ga0070676_10003754
382 Ga0070676_10018284
383 Ga0070690_100002262
384 Ga0070690_100062546
385 Ga0070670_100000022
386 Ga0070670_100001163
387 Ga0070670_100001372
388 Ga0070670_100002964
389 Ga0070670_100041397
390 Ga0070677_10015132
391 Ga0068869_100000230
392 Ga0068869_100018746
393 Ga0070666_10000415
394 Ga0070666_10012697
395 Ga0068868_100000422
396 Ga0068868_100027636
397 Ga0070660_100006343
398 Ga0070660_100007252
399 Ga0070660_100014106
400 Ga0070660_100038472
401 Ga0070660_100058918
402 Ga0070660_100091906
403 Ga0070661_100091454
404 Ga0070661_100097976
405 Ga0070661_100109719
406 Ga0070692_10060100
407 Ga0070668_100000675
408 Ga0070669_100054655
409 Ga0070675_100048842
410 Ga0070671_100000972
411 Ga0070671_100003799
412 Ga0070671_100015015
413 Ga0070671_100018789
414 Ga0070671_100019284
415 Ga0070671_100027852
416 Ga0070671_100137354
417 Ga0070671_100156946
418 Ga0070674_100001888
419 Ga0070674_100014787
420 Ga0070674_100188213
421 Ga0070673_100000535
422 Ga0070673_100001888
423 Ga0070673_100005711
424 Ga0070673_100006143
425 Ga0070673_100014109
426 Ga0070673_100053198
427 Ga0070659_100001166
428 Ga0070659_100020205
429 Ga0070659_100096552
430 Ga0070659_100103676
431 Ga0070667_100000839
432 Ga0070667_100000917
433 Ga0070667_100004185
434 Ga0070667_100008376
435 Ga0070667_100011274
436 Ga0070667_100036702
437 Ga0070667_100046758
438 Ga0070663_100031088
439 Ga0070678_100004841
440 Ga0070678_100018324
441 Ga0070678_100021321
442 Ga0070662_100000390
443 Ga0070662_100016686
444 Ga0070662_100037223
445 Ga0070662_100048333
446 Ga0068867_100001732
447 Ga0068867_100027190
448 Ga0070679_100021027
449 Ga0068853_100003747
450 Ga0068853_100038160
451 Ga0068853_100051491
452 Ga0070672_100001092
453 Ga0070672_100009083
454 Ga0070672_100011598
455 Ga0070686_100019774
456 Ga0070665_100003259
457 Ga0070665_100015898
458 Ga0070665_100042458
459 Ga0070665_100063316
460 Ga0068855_100009251
461 Ga0068855_100039987
462 Ga0070664_100007140
463 Ga0070664_100018895
464 Ga0068857_100026270
465 Ga0068857_100059203
466 Ga0068854_100001945
467 Ga0068854_100003625
468 Ga0068854_100049317
469 Ga0068856_100206593
470 Ga0068852_100001242
471 Ga0068852_100006131
472 Ga0068852_100023430
473 Ga0068852_100028601
474 Ga0068852_100054505
475 Ga0068852_100118361
476 Ga0068852_100161539
477 Ga0068859_100006261
478 Ga0068859_100009159
479 Ga0068859_100027442
480 Ga0068864_100000418
481 Ga0068864_100000986
482 Ga0068864_100002647
483 Ga0068864_100003357
484 Ga0068864_100017993
485 Ga0068864_100030699
486 Ga0068861_100012537
487 Ga0068863_100000266
488 Ga0068863_100002990
489 Ga0068863_100013454
490 Ga0068863_100014012
491 Ga0068863_100047857
492 Ga0068858_100001162
493 Ga0068858_100002839
494 Ga0068858_100038086
495 Ga0068860_100000136
496 Ga0068860_100009071
497 Ga0068860_100033824
498 Ga0068860_100095612
499 Ga0068860_100138773
500 Ga0068862_100000573
501 Ga0068862_100046088
502 Ga0097621_100019226
503 Ga0097621_100148772
504 Ga0068871_100010746
505 Ga0068871_100037154
506 Ga0068865_100037095
507 Ga0097620_100006262
508 Ga0097620_100009159
509 Ga0097620_100027443
510 Ga0105250_10008405
511 Ga0105240_10283243
512 Ga0105245_10001947
513 Ga0105248_10001057
514 Ga0105248_10005736
515 Ga0105248_10010048
516 Ga0105248_10010146
517 Ga0105248_10017218
518 Ga0105248_10033228
519 Ga0105248_10109998
520 Ga0105248_10131940
521 Ga0105248_10204835
522 Ga0105238_10203513
523 Ga0105249_10000376
524 Ga0105249_10175964
525 Ga0157373_10010173
526 Ga0157373_10021842
527 Ga0157373_10052366
528 Ga0157373_10107204
529 Ga0157371_10004528
530 Ga0157371_10120089
531 Ga0157370_10104764
532 Ga0157369_10199569
533 Ga0157369_10270206
534 Ga0157374_10011420
535 Ga0157378_10004520
536 Ga0163162_10005084
537 Ga0163162_10096044
538 Ga0163162_10223558
539 Ga0163162_10294691
540 Ga0157372_10022590
541 Ga0157372_10168223
542 Ga0157372_10246004
543 Ga0157375_10002274
544 Ga0157375_10052167
545 Ga0157375_10065809
546 Ga0157375_10168277
547 Ga0163163_10002274
548 Ga0163163_10015289
549 Ga0157379_10005800
550 Ga0157379_10007471
551 Ga0163161_10020636
552 Ga0206353_10668187
553 Ga0213876_10022162
554 Ga0207697_10000082
555 Ga0207688_10011404
556 Ga0207688_10042856
557 Ga0207680_10001418
558 Ga0207680_10002741
559 Ga0207647_10000259
560 Ga0207647_10006343
561 Ga0207647_10019662
562 Ga0207645_10004794
563 Ga0207645_10024936
564 Ga0207645_10028156
565 Ga0207645_10053670
566 Ga0207645_10062231
567 Ga0207705_10001757
568 Ga0207705_10003507
569 Ga0207705_10008679
570 Ga0207705_10026423
571 Ga0207705_10036201
572 Ga0207660_10048175
573 Ga0207657_10004090
574 Ga0207657_10005407
575 Ga0207657_10007346
576 Ga0207657_10019800
577 Ga0207657_10022895
578 Ga0207657_10031038
579 Ga0207657_10037851
580 Ga0207657_10059641
581 Ga0207657_10061810
582 Ga0207657_10094256
583 Ga0207657_10154528
584 Ga0207681_10002599
585 Ga0207681_10006254
586 Ga0207681_10052884
587 Ga0207694_10081105
588 Ga0207694_10175016
589 Ga0207650_10000016
590 Ga0207650_10006173
591 Ga0207650_10007458
592 Ga0207650_10082578
593 Ga0207650_10096817
594 Ga0207659_10005604
595 Ga0207659_10030507
596 Ga0207687_10004833
597 Ga0207644_10000151
598 Ga0207644_10000649
599 Ga0207644_10012313
600 Ga0207644_10021843
601 Ga0207690_10005828
602 Ga0207690_10033519
603 Ga0207690_10102649
604 Ga0207690_10138817
605 Ga0207706_10000891
606 Ga0207706_10001125
607 Ga0207706_10001144
608 Ga0207706_10004393
609 Ga0207706_10005360
610 Ga0207706_10011706
611 Ga0207706_10017447
612 Ga0207706_10017672
613 Ga0207706_10073417
614 Ga0207669_10187120
615 Ga0207691_10001996
616 Ga0207691_10002508
617 Ga0207691_10012675
618 Ga0207691_10096159
619 Ga0207691_10120489
620 Ga0207711_10000372
621 Ga0207711_10003496
622 Ga0207711_10014963
623 Ga0207711_10022438
624 Ga0207711_10028773
625 Ga0207711_10052094
626 Ga0207689_10000561
627 Ga0207689_10027493
628 Ga0207679_10008083
629 Ga0207679_10012009
630 Ga0207679_10070224
631 Ga0207667_10031787
632 Ga0207667_10073402
633 Ga0207667_10219270
634 Ga0207651_10001237
635 Ga0207651_10003650
636 Ga0207651_10004058
637 Ga0207651_10004376
638 Ga0207651_10008958
639 Ga0207651_10010948
640 Ga0207651_10039064
641 Ga0207712_10000794
642 Ga0207668_10000173
643 Ga0207668_10001942
644 Ga0207640_10001178
645 Ga0207640_10001487
646 Ga0207640_10001775
647 Ga0207658_10002457
648 Ga0207658_10004516
649 Ga0207658_10004820
650 Ga0207658_10004991
651 Ga0207658_10014066
652 Ga0207658_10028679
653 Ga0207658_10032516
654 Ga0207658_10072296
655 Ga0207658_10079060
656 Ga0207677_10001036
657 Ga0207677_10014000
658 Ga0207703_10002334
659 Ga0207703_10008141
660 Ga0207703_10013406
661 Ga0207639_10012525
662 Ga0207678_10000918
663 Ga0207678_10011162
664 Ga0207678_10054513
665 Ga0207702_10047447
666 Ga0207641_10000761
667 Ga0207641_10000996
668 Ga0207641_10004390
669 Ga0207641_10229958
670 Ga0207648_10003598
671 Ga0207648_10007119
672 Ga0207648_10011142
673 Ga0207676_10000055
674 Ga0207676_10001742
675 Ga0207676_10005530
676 Ga0207676_10006692
677 Ga0207676_10009721
678 Ga0207674_10002685
679 Ga0207674_10016383
680 Ga0207674_10097455
681 Ga0207675_100021805
682 Ga0207683_10004842
683 Ga0207683_10011713
684 Ga0207683_10041560
685 Ga0207698_10010672
686 Ga0207698_10021990
687 Ga0207698_10143484
688 Ga0207698_10155157
689 Ga0268266_10005833
690 Ga0268266_10018295
691 Ga0268266_10026817
692 Ga0268265_10008593
693 Ga0268265_10052940
694 Ga0268264_10000265
695 Ga0268264_10005231
696 Ga0268264_10009772
697 Ga0268264_10022540
698 Ga0268264_10078910
699 Ga0307410_10254489
700 Ga0307409_100159000
701 Ga0307415_100076648
702 Ga0373960_0037540
703 Ga0395899_0065709
704 Ga0395899_0068018
705 Ga0395900_0001134
706 Ga0395900_0018427
707 Ga0395898_0120000
708 Ga0395898_0334782
709 Ga0395905_0002566
710 Ga0395905_0016348
711 Ga0395905_0019729
712 Ga0395905_0085252
713 Ga0395905_0093328
714 Ga0395905_0217165
715 Ga0395905_0233107
716 Ga0395901_0043855
717 Ga0436365_0451685
718 Ga0466967_0079811
719 Ga0495663_0001960
720 Ga0495621_0000837
721 Ga0495668_0005247
722 Ga0495661_0045250
723 Ga0495669_0002001
724 Ga0495669_0007274
725 Ga0495677_0001724
726 Ga0496101_0048875
727 Ga0496105_0057461
728 Ga0496106_0106543
729 Ga0496108_0002625
730 Ga0496108_0022850
731 Ga0496109_0011318
732 Ga0496109_0025930
733 Ga0496109_0181985
734 Ga0496110_0015874
735 Ga0496110_0072013
736 Ga0496110_0081617
737 Ga0496111_0016091
738 Ga0496112_0007854
739 Ga0496112_0023048
740 Ga0496112_0038537
741 Ga0496113_0005302
742 Ga0496113_0051595
743 Ga0501068_0091342
744 Ga0500658_0000037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

182

394

0.81

PF23500

73

381

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qsd-assembly1.cif.gz_A crystal structure of pizza6s 0.7643 67 439
6qsd-assembly1.cif.gz_A crystal structure of pizza6s 0.7506 67 439
7zpw-assembly2.cif.gz_D crystal structure of pizza6-tsk-tsh with silicotungstic acid (sta) polyoxometalate 0.7416 67 441
2ism-assembly1.cif.gz_A crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8 0.7367 66 440
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7365 66 442
ID Description Score Start End Superfamily
af_P98164_2374_2695_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7875 78 420 2.120.10.30
af_P01132_39_362_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7711 78 301 2.120.10.30
af_Q95RU0_34_286_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7544 79 391 2.120.10.30
af_Q4DLZ5_134_347_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7488 75 291 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7354 66 442 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A840HY96-F1-model_v4 Glucose/arabinose dehydrogenase 0.9734 337 441
AF-A0A023XB83-F1-model_v4 deleted 0.9674 346 441
AF-A0A257WQ46-F1-model_v4 deleted 0.9549 334 441
AF-A0A7C1MDF0-F1-model_v4 Sorbosone dehydrogenase family protein 0.9541 162 441
AF-A0A2A3CKE1-F1-model_v4 deleted 0.9511 348 441

Map